BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045K02

Length=655
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP03680.1|  unnamed protein product                                256   4e-77   Coffea canephora [robusta coffee]
ref|XP_009601160.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    251   4e-75   Nicotiana tomentosiformis
ref|XP_009601158.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    250   4e-75   Nicotiana tomentosiformis
gb|EYU46533.1|  hypothetical protein MIMGU_mgv1a002319mg                248   7e-74   Erythranthe guttata [common monkey flower]
ref|XP_007050461.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    245   7e-74   
gb|KJB25951.1|  hypothetical protein B456_004G217800                    244   4e-73   Gossypium raimondii
gb|KJB25950.1|  hypothetical protein B456_004G217800                    244   5e-73   Gossypium raimondii
ref|XP_002280876.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    246   6e-73   Vitis vinifera
ref|XP_010646137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    245   6e-73   Vitis vinifera
gb|KJB25952.1|  hypothetical protein B456_004G217800                    244   7e-73   Gossypium raimondii
ref|XP_009798520.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    244   7e-73   Nicotiana sylvestris
ref|XP_007050460.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    245   7e-73   
gb|KJB25953.1|  hypothetical protein B456_004G217800                    244   1e-72   Gossypium raimondii
gb|KJB25949.1|  hypothetical protein B456_004G217800                    244   1e-72   Gossypium raimondii
gb|KDP21391.1|  hypothetical protein JCGZ_21862                         244   2e-72   Jatropha curcas
ref|XP_010038051.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    243   3e-72   Eucalyptus grandis [rose gum]
ref|XP_010038050.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    243   3e-72   Eucalyptus grandis [rose gum]
ref|XP_006349731.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   1e-71   Solanum tuberosum [potatoes]
ref|XP_009370747.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    238   1e-71   
ref|XP_003521263.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   1e-71   
ref|XP_006604473.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    240   2e-71   Glycine max [soybeans]
ref|XP_006604472.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   2e-71   Glycine max [soybeans]
gb|KDO68605.1|  hypothetical protein CISIN_1g006162mg                   240   2e-71   Citrus sinensis [apfelsine]
ref|XP_006604471.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   2e-71   Glycine max [soybeans]
ref|XP_006604469.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    241   2e-71   Glycine max [soybeans]
ref|XP_004247203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    240   3e-71   Solanum lycopersicum
ref|XP_006443960.1|  hypothetical protein CICLE_v10019230mg             239   5e-71   Citrus clementina [clementine]
ref|XP_006443959.1|  hypothetical protein CICLE_v10019230mg             239   6e-71   
gb|KHN10697.1|  Peptidyl-prolyl cis-trans isomerase                     241   6e-71   Glycine soja [wild soybean]
gb|KHG26228.1|  Peptidyl-prolyl cis-trans isomerase D                   226   7e-71   Gossypium arboreum [tree cotton]
ref|XP_011079927.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    240   8e-71   Sesamum indicum [beniseed]
gb|KDO68608.1|  hypothetical protein CISIN_1g006162mg                   239   9e-71   Citrus sinensis [apfelsine]
ref|XP_008235346.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   1e-70   Prunus mume [ume]
ref|XP_008235345.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   1e-70   Prunus mume [ume]
ref|XP_008235347.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    239   1e-70   
ref|XP_004493727.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    238   3e-70   Cicer arietinum [garbanzo]
ref|XP_008355416.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    236   3e-70   
ref|NP_850740.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...    231   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007199724.1|  hypothetical protein PRUPE_ppa002435mg             237   4e-70   Prunus persica
ref|XP_008366534.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    234   5e-70   
ref|XP_008366532.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    234   5e-70   
ref|XP_004146961.1|  PREDICTED: uncharacterized protein LOC101219904    237   5e-70   Cucumis sativus [cucumbers]
ref|XP_008451290.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    237   6e-70   Cucumis melo [Oriental melon]
ref|XP_004162194.1|  PREDICTED: uncharacterized LOC101219904            236   6e-70   
gb|KEH23833.1|  peptidyl-prolyl cis-trans isomerase                     236   1e-69   Medicago truncatula
ref|XP_002520955.1|  cyclophilin, putative                              236   3e-69   Ricinus communis
gb|EPS61145.1|  hypothetical protein M569_13654                         233   4e-69   Genlisea aurea
ref|XP_007162476.1|  hypothetical protein PHAVU_001G155500g             234   6e-69   Phaseolus vulgaris [French bean]
ref|XP_010527624.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   7e-69   Tarenaya hassleriana [spider flower]
ref|XP_010527623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   8e-69   Tarenaya hassleriana [spider flower]
ref|XP_010527622.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   8e-69   Tarenaya hassleriana [spider flower]
ref|NP_191899.1|  cyclophilin-like peptidyl-prolyl cis-trans isom...    231   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AAS75310.1|  multidomain cyclophilin type peptidyl-prolyl cis-...    231   1e-68   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57223.1|  AT3G63400                                              231   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527616.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   3e-68   Tarenaya hassleriana [spider flower]
ref|XP_010527621.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_010527615.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_010527619.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_010527620.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_010527617.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    231   5e-68   Tarenaya hassleriana [spider flower]
ref|XP_006402278.1|  hypothetical protein EUTSA_v10006033mg             224   1e-67   
ref|XP_006290850.1|  hypothetical protein CARUB_v10016960mg             228   2e-67   
ref|XP_002876720.1|  hypothetical protein ARALYDRAFT_324764             227   4e-67   
gb|AJA29688.1|  peptidyl-prolyl cis-trans isomerase                     229   7e-67   Betula luminifera [liang ye hua]
ref|XP_011032623.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    228   1e-66   Populus euphratica
ref|XP_002306802.2|  hypothetical protein POPTR_0005s23730g             228   2e-66   Populus trichocarpa [western balsam poplar]
emb|CDX93909.1|  BnaC04g20680D                                          226   2e-66   
ref|XP_002302085.2|  hypothetical protein POPTR_0002s04800g             228   2e-66   
emb|CAN75764.1|  hypothetical protein VITISV_034442                     229   3e-66   Vitis vinifera
ref|XP_010249988.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    229   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010249986.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    229   3e-66   Nelumbo nucifera [Indian lotus]
ref|XP_010512756.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    227   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010468852.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    225   4e-66   Camelina sativa [gold-of-pleasure]
emb|CDY53714.1|  BnaAnng12550D                                          223   1e-65   Brassica napus [oilseed rape]
ref|XP_009138664.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    223   1e-65   Brassica rapa
ref|XP_010274266.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    225   3e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010274267.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   4e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010274268.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   4e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010274264.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   5e-65   Nelumbo nucifera [Indian lotus]
ref|XP_011026088.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    224   5e-65   Populus euphratica
ref|XP_011458604.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    223   8e-65   Fragaria vesca subsp. vesca
ref|XP_010679140.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    223   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679138.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    223   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010679137.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    223   1e-64   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010413155.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    221   3e-64   
ref|XP_010413154.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    220   3e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010925250.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    223   8e-64   Elaeis guineensis
ref|XP_008785212.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    219   1e-62   Phoenix dactylifera
ref|XP_006838913.1|  hypothetical protein AMTR_s00002p00269760          217   5e-62   
ref|XP_001780456.1|  predicted protein                                  203   1e-61   
ref|XP_008792090.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   1e-61   Phoenix dactylifera
ref|XP_009388658.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    216   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001633810.1|  predicted protein                                  207   3e-61   Nematostella vectensis
tpg|DAA59762.1|  TPA: hypothetical protein ZEAMMB73_415877              206   3e-61   
tpg|DAA42557.1|  TPA: hypothetical protein ZEAMMB73_596682              201   3e-61   
ref|XP_010772716.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    200   5e-61   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003221776.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    206   7e-61   Anolis carolinensis [Carolina anole]
ref|XP_011077231.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   2e-60   Sesamum indicum [beniseed]
ref|XP_008286043.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    205   2e-60   Stegastes partitus
ref|XP_009419289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    213   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008785095.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     198   2e-60   Phoenix dactylifera
ref|XP_005299363.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    204   3e-60   Chrysemys picta bellii
ref|XP_006661010.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   3e-60   Oryza brachyantha
ref|XP_007071343.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    204   4e-60   Chelonia mydas [green seaturtle]
ref|NP_001232291.1|  putative peptidylprolyl isomerase D                199   4e-60   
gb|KJB80893.1|  hypothetical protein B456_013G120200                    198   6e-60   Gossypium raimondii
ref|XP_001761081.1|  predicted protein                                  203   7e-60   
ref|XP_009399355.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    210   8e-60   
ref|XP_009399354.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    210   8e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006867984.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    203   8e-60   Chrysochloris asiatica
ref|XP_001760224.1|  predicted protein                                  198   9e-60   
ref|XP_010914920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    211   9e-60   Elaeis guineensis
tpg|DAA42555.1|  TPA: hypothetical protein ZEAMMB73_596682              201   9e-60   
ref|XP_006121931.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    203   1e-59   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_004382106.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    203   1e-59   Trichechus manatus latirostris
dbj|BAE29632.1|  unnamed protein product                                202   1e-59   Mus musculus [mouse]
ref|XP_003324829.1|  hypothetical protein PGTG_06366                    205   1e-59   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_007436535.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    202   1e-59   Python bivittatus
ref|NP_080628.1|  peptidyl-prolyl cis-trans isomerase D                 202   1e-59   Mus musculus [mouse]
gb|EMP24944.1|  Peptidyl-prolyl cis-trans isomerase D                   202   2e-59   Chelonia mydas [green seaturtle]
gb|KJB80890.1|  hypothetical protein B456_013G120200                    196   2e-59   Gossypium raimondii
gb|KJB80891.1|  hypothetical protein B456_013G120200                    196   2e-59   Gossypium raimondii
ref|XP_006629535.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    202   2e-59   Lepisosteus oculatus
ref|XP_006981152.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    202   2e-59   Peromyscus maniculatus bairdii
emb|CDK25020.1|  unnamed protein product                                202   2e-59   Kuraishia capsulata CBS 1993
ref|WP_017297358.1|  peptidylprolyl isomerase                           196   2e-59   Nodosilinea nodulosa
ref|XP_008852547.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    202   3e-59   Nannospalax galili
ref|XP_004394281.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    202   3e-59   Odobenus rosmarus divergens
ref|XP_007624483.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    202   3e-59   Cricetulus griseus [Chinese hamsters]
ref|XP_003504914.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   3e-59   Cricetulus griseus [Chinese hamsters]
gb|EGW00520.1|  40 kDa peptidyl-prolyl cis-trans isomerase              197   3e-59   Cricetulus griseus [Chinese hamsters]
gb|AAH14893.1|  PPID protein                                            195   3e-59   Homo sapiens [man]
ref|XP_009049213.1|  hypothetical protein LOTGIDRAFT_112989             201   3e-59   Lottia gigantea
ref|XP_005344179.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    202   3e-59   Microtus ochrogaster [prairie voles]
ref|XP_005919457.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    202   4e-59   Haplochromis burtoni
ref|XP_008359381.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    200   4e-59   
ref|NP_001004279.1|  peptidyl-prolyl cis-trans isomerase D              201   4e-59   Rattus norvegicus [brown rat]
ref|XP_004708796.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   4e-59   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005076198.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   4e-59   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005486377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   5e-59   Zonotrichia albicollis
gb|ACH45652.1|  putative peptidylprolyl isomerase D                     201   5e-59   Taeniopygia guttata
gb|ERE90429.1|  peptidyl-prolyl cis-trans isomerase D-like protein      201   5e-59   Cricetulus griseus [Chinese hamsters]
ref|XP_007611328.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   5e-59   
ref|XP_004685424.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   5e-59   Condylura cristata
ref|XP_003477039.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   5e-59   Cavia porcellus [guinea pig]
ref|XP_004553696.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   6e-59   Maylandia zebra
gb|AAP44536.1|  cyclophilin-like protein                                207   6e-59   Triticum aestivum [Canadian hard winter wheat]
dbj|GAM29016.1|  hypothetical protein SAMD00019534_121920               195   6e-59   Acytostelium subglobosum LB1
gb|EEC72707.1|  hypothetical protein OsI_06299                          209   6e-59   Oryza sativa Indica Group [Indian rice]
gb|EEE56526.1|  hypothetical protein OsJ_05815                          207   6e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010935780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    207   7e-59   Elaeis guineensis
ref|XP_011074689.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     194   7e-59   Sesamum indicum [beniseed]
ref|XP_004337460.1|  peptidylprolyl cis-trans isomerase                 194   8e-59   Acanthamoeba castellanii str. Neff
ref|XP_005517649.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   8e-59   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_003443392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   8e-59   Oreochromis niloticus
ref|XP_010228289.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    207   8e-59   Brachypodium distachyon [annual false brome]
ref|XP_003557489.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    206   9e-59   Brachypodium distachyon [annual false brome]
ref|XP_010381484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   9e-59   Rhinopithecus roxellana
gb|ACH45651.1|  putative peptidylprolyl isomerase D                     201   9e-59   Taeniopygia guttata
gb|ELU12765.1|  hypothetical protein CAPTEDRAFT_170435                  200   9e-59   Capitella teleta
ref|XP_004956263.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   1e-58   Setaria italica
ref|XP_007998311.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   1e-58   Chlorocebus sabaeus
gb|KDP23701.1|  hypothetical protein JCGZ_23534                         194   1e-58   Jatropha curcas
ref|XP_007184203.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   1e-58   Balaenoptera acutorostrata scammoni
ref|WP_035985162.1|  peptidylprolyl isomerase                           194   1e-58   Leptolyngbya sp. KIOST-1
ref|XP_009798524.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    207   1e-58   Nicotiana sylvestris
ref|XP_004955636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    206   1e-58   Setaria italica
gb|KHG05845.1|  Peptidyl-prolyl cis-trans isomerase CYP19-3 -like...    195   1e-58   Gossypium arboreum [tree cotton]
ref|NP_001002065.1|  peptidyl-prolyl cis-trans isomerase D              200   1e-58   Danio rerio [leopard danio]
ref|XP_007551094.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   1e-58   Poecilia formosa
ref|XP_008651151.1|  PREDICTED: uncharacterized protein LOC100274...    206   1e-58   
ref|XP_003564091.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    201   1e-58   Brachypodium distachyon [annual false brome]
ref|XP_004606206.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    200   1e-58   Sorex araneus [Eurasian shrew]
ref|XP_004955639.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    206   1e-58   Setaria italica
ref|XP_001774773.1|  predicted protein                                  200   1e-58   
ref|XP_007229920.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    200   1e-58   Astyanax mexicanus [blind cave fish]
ref|XP_008651149.1|  PREDICTED: uncharacterized protein LOC100274...    206   1e-58   Zea mays [maize]
ref|XP_008651150.1|  PREDICTED: uncharacterized protein LOC100274...    206   1e-58   
ref|XP_001941476.1|  peptidyl-prolyl cis-trans isomerase                194   1e-58   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_007949832.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    200   1e-58   Orycteropus afer afer
ref|XP_005800637.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    200   2e-58   Xiphophorus maculatus
gb|KJB80889.1|  hypothetical protein B456_013G120200                    194   2e-58   Gossypium raimondii
ref|XP_002815298.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    200   2e-58   Pongo abelii [orang utan]
ref|XP_006023222.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   2e-58   Alligator sinensis
ref|XP_008419300.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    200   2e-58   
gb|KDP27580.1|  hypothetical protein JCGZ_19585                         193   2e-58   Jatropha curcas
gb|AFP44118.1|  cyclophilin                                             193   2e-58   Lycoris longituba
ref|XP_004007561.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   2e-58   
dbj|BAJ87064.1|  predicted protein                                      205   2e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006023221.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   2e-58   Alligator sinensis
ref|XP_532704.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    199   3e-58   Canis lupus familiaris [dogs]
ref|XP_008142683.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   3e-58   Eptesicus fuscus
ref|XP_004040619.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   3e-58   Gorilla gorilla gorilla [lowland gorilla]
emb|CEF66075.1|  Peptidyl-prolyl cis-trans isomerase D                  193   3e-58   Strongyloides ratti
ref|XP_004017329.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   3e-58   
ref|XP_002367801.1|  20 kDa cyclophilin precursor                       199   3e-58   Toxoplasma gondii ME49
gb|EPR61465.1|  cyclophilin precursor                                   199   3e-58   Toxoplasma gondii GT1
gb|EHH30637.1|  hypothetical protein EGK_20384                          199   3e-58   Macaca mulatta [rhesus macaque]
emb|CDI79350.1|  20 kDa cyclophilin precursor, putative                 193   3e-58   Eimeria acervulina
gb|AAA17998.1|  20 kDa cyclophilin precursor                            198   3e-58   Toxoplasma gondii
ref|XP_005909484.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   3e-58   Bos mutus
gb|AGI78541.1|  cyclophilin                                             193   4e-58   Suaeda salsa
ref|NP_776578.1|  peptidyl-prolyl cis-trans isomerase D                 199   4e-58   Bos taurus [bovine]
emb|CAA69622.1|  cyclophylin                                            193   4e-58   Digitalis lanata [Grecian foxglove]
ref|XP_003418541.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   4e-58   Loxodonta africana [African bush elephant]
ref|XP_006694995.1|  putative cis-trans protein                         199   4e-58   Chaetomium thermophilum var. thermophilum DSM 1495
gb|ADV04050.1|  cyclophilin                                             192   4e-58   Hevea brasiliensis [jebe]
ref|XP_006892841.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   4e-58   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_002459866.1|  hypothetical protein SORBIDRAFT_02g012590          192   5e-58   Sorghum bicolor [broomcorn]
ref|XP_007609920.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    199   5e-58   
ref|XP_005593787.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   5e-58   
ref|XP_006657500.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    204   5e-58   Oryza brachyantha
ref|XP_006657499.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    204   5e-58   
ref|XP_010746147.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   5e-58   Larimichthys crocea [croceine croaker]
ref|XP_007530443.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   5e-58   Erinaceus europaeus [common hedgehog]
ref|XP_003984955.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   5e-58   Felis catus [cat]
ref|XP_001145793.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   5e-58   Pan troglodytes
ref|XP_002745353.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   5e-58   Callithrix jacchus [common marmoset]
ref|XP_007998308.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   5e-58   Chlorocebus sabaeus
ref|XP_003899367.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   5e-58   Papio anubis [baboon]
ref|NP_001252763.1|  peptidylprolyl isomerase D                         199   5e-58   Macaca mulatta [rhesus macaque]
ref|NP_001271664.1|  uncharacterized protein LOC101867179               199   6e-58   Macaca fascicularis [crab eating macaque]
ref|XP_010898283.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    199   6e-58   Esox lucius
ref|XP_002921709.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   6e-58   Ailuropoda melanoleuca
gb|AAX36352.1|  peptidylprolyl isomerase D                              198   6e-58   synthetic construct
ref|XP_007692567.1|  hypothetical protein COCMIDRAFT_30232              192   6e-58   Bipolaris oryzae ATCC 44560
ref|XP_010090292.1|  Peptidyl-prolyl cis-trans isomerase                192   6e-58   Morus notabilis
ref|NP_001063993.1|  Os09g0571400                                       192   6e-58   
ref|XP_005666719.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   6e-58   
ref|XP_004777378.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   6e-58   Mustela putorius furo [black ferret]
gb|EHH54044.1|  hypothetical protein EGM_14781                          198   6e-58   Macaca fascicularis [crab eating macaque]
ref|XP_009381127.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    206   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADP90618.1|  peptidyl-prolyl cis-trans isomerase D                   198   6e-58   Homo sapiens [man]
ref|NP_001231315.1|  peptidyl-prolyl cis-trans isomerase D              198   6e-58   Sus scrofa [pigs]
ref|XP_006442714.1|  hypothetical protein CICLE_v10022535mg             192   7e-58   Citrus clementina [clementine]
gb|AAX43155.1|  peptidylprolyl isomerase D                              198   7e-58   synthetic construct
ref|XP_001094929.2|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   7e-58   
emb|CDQ62287.1|  unnamed protein product                                198   7e-58   Oncorhynchus mykiss
ref|NP_005029.1|  peptidyl-prolyl cis-trans isomerase D                 198   7e-58   Homo sapiens [man]
ref|NP_001149489.1|  peptidyl-prolyl cis-trans isomerase CYP19-3        192   7e-58   Zea mays [maize]
gb|ACG35589.1|  peptidyl-prolyl cis-trans isomerase CYP19-3             192   7e-58   Zea mays [maize]
emb|CAG46878.1|  PPID                                                   198   7e-58   Homo sapiens [man]
ref|XP_010268679.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     192   7e-58   Nelumbo nucifera [Indian lotus]
ref|XP_001500384.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   7e-58   Equus caballus [domestic horse]
gb|ACI66097.1|  40 kDa peptidyl-prolyl cis-trans isomerase              198   7e-58   Salmo salar
ref|XP_003970715.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   7e-58   
ref|XP_010233732.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     192   7e-58   Brachypodium distachyon [annual false brome]
gb|EFB29938.1|  hypothetical protein PANDA_010618                       197   8e-58   Ailuropoda melanoleuca
ref|XP_006487422.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   8e-58   Citrus sinensis [apfelsine]
ref|XP_004450852.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   8e-58   
ref|XP_003927981.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   8e-58   Saimiri boliviensis boliviensis
ref|XP_007030475.1|  Rotamase cyclophilin 2                             192   8e-58   Theobroma cacao [chocolate]
ref|XP_007998309.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   8e-58   Chlorocebus sabaeus
emb|CDO76132.1|  hypothetical protein BN946_scf184332.g2                198   9e-58   Trametes cinnabarina
gb|EHH26276.1|  hypothetical protein EGK_16197                          198   9e-58   Macaca mulatta [rhesus macaque]
ref|XP_006647053.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    206   9e-58   Oryza brachyantha
ref|XP_005860591.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   9e-58   Myotis brandtii
dbj|BAJ93699.1|  predicted protein                                      198   9e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004883006.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   9e-58   
ref|XP_009610666.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     192   1e-57   Nicotiana tomentosiformis
ref|XP_006647052.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    206   1e-57   Oryza brachyantha
ref|XP_002459423.1|  hypothetical protein SORBIDRAFT_02g004430          204   1e-57   Sorghum bicolor [broomcorn]
ref|XP_003257958.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   1e-57   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_007159996.1|  hypothetical protein PHAVU_002G284200g             192   1e-57   Phaseolus vulgaris [French bean]
ref|XP_006081911.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   1e-57   Myotis lucifugus
gb|ADG34846.1|  cyclophilin                                             192   1e-57   Vanda hybrid cultivar
ref|XP_006752724.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   1e-57   Myotis davidii
ref|XP_004655951.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    198   1e-57   Jaculus jaculus
ref|XP_002982010.1|  hypothetical protein SELMODRAFT_115473             192   1e-57   
gb|AER12108.1|  CYP                                                     191   1e-57   Gossypium hirsutum [American cotton]
gb|ACG70968.1|  cyclophilin                                             191   1e-57   Ziziphus jujuba [Chinese jujube]
ref|XP_006487732.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   1e-57   Citrus sinensis [apfelsine]
dbj|BAJ98045.1|  predicted protein                                      199   1e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007446681.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   1e-57   Lipotes vexillifer [baiji]
ref|XP_001057061.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   1e-57   
ref|XP_007117529.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   1e-57   
emb|CAG04643.1|  unnamed protein product                                198   1e-57   Tetraodon nigroviridis
ref|XP_002521961.1|  cyclophilin, putative                              191   1e-57   
ref|XP_005401022.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   1e-57   Chinchilla lanigera
ref|XP_006412177.1|  hypothetical protein EUTSA_v10027585mg             192   1e-57   
gb|EMT18379.1|  Peptidyl-prolyl cis-trans isomerase CYP40               197   1e-57   
ref|XP_007701371.1|  hypothetical protein COCSADRAFT_92320              191   1e-57   
ref|XP_004266204.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   1e-57   
gb|KDO20890.1|  hypothetical protein SPRG_14121                         199   2e-57   
ref|NP_001276071.1|  uncharacterized protein LOC102623101               191   2e-57   
ref|XP_011036276.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   2e-57   
gb|EFA76366.1|  cyclophilin-type peptidylprolyl cis-trans isomerase     191   2e-57   
ref|XP_004086518.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   2e-57   
ref|NP_001087854.1|  peptidyl-prolyl cis-trans isomerase D              197   2e-57   
ref|NP_001169674.1|  hypothetical protein                               198   2e-57   
ref|XP_005985804.1|  PREDICTED: LOW QUALITY PROTEIN: peptidylprol...    197   2e-57   
ref|XP_004289844.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   2e-57   
pdb|4JJM|A  Chain A, Structure Of A Cyclophilin From Citrus Sinen...    191   2e-57   
ref|XP_005593336.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   2e-57   
ref|XP_002510543.1|  cyclophilin, putative                              191   2e-57   
ref|XP_008324858.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   2e-57   
ref|XP_007117530.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   2e-57   
dbj|BAQ21277.1|  cyclophilin                                            191   2e-57   
ref|XP_010584392.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   2e-57   
gb|EMD94092.1|  hypothetical protein COCHEDRAFT_1201904                 191   2e-57   
gb|KEY72096.1|  hypothetical protein S7711_00112                        197   2e-57   
ref|XP_006388902.1|  peptidyl-prolyl cis-trans isomerase family p...    191   2e-57   
ref|XP_010953800.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   2e-57   
ref|XP_009788636.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     191   2e-57   
ref|XP_010066256.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     191   2e-57   
ref|XP_005148983.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   2e-57   
ref|XP_426283.3|  PREDICTED: peptidyl-prolyl cis-trans isomerase ...    197   2e-57   
ref|XP_008668501.1|  PREDICTED: uncharacterized protein LOC100384...    202   2e-57   
ref|XP_006403025.1|  hypothetical protein EUTSA_v10006270mg             191   2e-57   
ref|XP_008043657.1|  peptidyl-prolyl cis-trans isomerase Cpr7           197   2e-57   
ref|XP_006213657.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   2e-57   
ref|XP_009412893.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     191   3e-57   
ref|XP_008050630.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   3e-57   
ref|NP_001170592.1|  uncharacterized protein LOC100384625               202   3e-57   
ref|XP_010274820.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    191   3e-57   
emb|CDJ57377.1|  20 kDa cyclophilin precursor, putative                 191   3e-57   
gb|KFA77235.1|  hypothetical protein S40288_01249                       197   3e-57   
ref|XP_010584391.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   3e-57   
ref|NP_001130700.1|  uncharacterized protein LOC100191803               197   3e-57   
ref|XP_006917064.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   3e-57   
ref|XP_001083759.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   3e-57   
ref|XP_008886041.1|  cyclophilin precursor                              190   3e-57   
ref|XP_004777377.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   3e-57   
ref|XP_011361987.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   3e-57   
ref|XP_004639295.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   3e-57   
ref|XP_008802286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    203   4e-57   
ref|XP_011226330.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   4e-57   
ref|XP_010985159.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   4e-57   
ref|XP_008802283.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    203   4e-57   
ref|XP_002436713.1|  hypothetical protein SORBIDRAFT_10g007410          197   4e-57   
ref|XP_008802287.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    202   4e-57   
ref|XP_009346636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   4e-57   
ref|XP_008802285.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    202   4e-57   
ref|XP_008236203.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     190   4e-57   
gb|ACV88654.1|  cyclophilin                                             190   4e-57   
gb|AIZ74330.1|  cyclophilin                                             190   4e-57   
ref|XP_004421028.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   4e-57   
tpg|DAA42558.1|  TPA: hypothetical protein ZEAMMB73_596682              202   4e-57   
gb|AAU87301.1|  cyclophilin                                             190   4e-57   
ref|XP_008447986.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     190   5e-57   
gb|AAQ87931.1|  Bet v 7-like protein                                    190   5e-57   
gb|ABL67655.1|  putative cyclophilin                                    190   5e-57   
ref|XP_006000743.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    197   5e-57   
gb|ACH70718.1|  peptidylprolyl isomerase D (cyclophilin D)              196   5e-57   
gb|EXA44444.1|  peptidyl-prolyl cis-trans isomerase D                   196   5e-57   
gb|EMT63236.1|  Peptidyl-prolyl cis-trans isomerase D                   196   5e-57   
gb|ACO07506.1|  40 kDa peptidyl-prolyl cis-trans isomerase              196   5e-57   
gb|EGU77847.1|  hypothetical protein FOXB_11611                         196   5e-57   
emb|CAA69598.1|  cyclophilin                                            190   6e-57   
ref|WP_039311101.1|  peptidylprolyl isomerase                           190   6e-57   
ref|XP_009377655.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     190   6e-57   
emb|CEG03364.1|  unnamed protein product                                196   6e-57   
gb|EGV19991.1|  peptidyl-prolyl cis-trans isomerase cyclophilin type    190   6e-57   
ref|XP_004952611.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   6e-57   
gb|EEE66674.1|  hypothetical protein OsJ_23316                          201   7e-57   
pdb|2MC9|A  Chain A, Cat R 1                                            190   7e-57   
ref|XP_003715059.1|  peptidyl-prolyl cis-trans isomerase                196   7e-57   
ref|XP_003524582.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   7e-57   
gb|KFK30119.1|  hypothetical protein AALP_AA7G219300                    189   7e-57   
gb|ABZ88806.1|  cyclophilin                                             189   7e-57   
ref|XP_011037275.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   8e-57   
ref|XP_008218307.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   8e-57   
ref|XP_001322019.1|  cytosolic cyclophilin                              189   8e-57   
ref|XP_008584597.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   8e-57   
sp|Q39613.1|CYPH_CATRO  RecName: Full=Peptidyl-prolyl cis-trans i...    189   8e-57   
ref|XP_001903954.1|  hypothetical protein                               196   8e-57   
gb|AFK44397.1|  unknown                                                 189   8e-57   
ref|XP_008614859.1|  hypothetical protein SDRG_10636                    198   9e-57   
gb|KDP36915.1|  hypothetical protein JCGZ_08206                         189   9e-57   
gb|EEC81610.1|  hypothetical protein OsI_25113                          201   9e-57   
ref|XP_004591469.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   9e-57   
ref|XP_010043280.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    190   1e-56   
ref|XP_003882240.1|  Peptidyl-prolyl cis-trans isomerase A, related     189   1e-56   
ref|XP_006579808.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   1e-56   
gb|EYU37917.1|  hypothetical protein MIMGU_mgv1a014959mg                189   1e-56   
ref|XP_002313736.1|  peptidyl-prolyl cis-trans isomerase family p...    189   1e-56   
ref|WP_040729484.1|  peptidylprolyl isomerase                           189   1e-56   
ref|NP_001057148.1|  Os06g0216800                                       196   1e-56   
ref|XP_002274869.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     189   1e-56   
ref|XP_009116305.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   1e-56   
gb|KIL96596.1|  peptidyl-prolyl cis-trans isomerase d                   194   1e-56   
ref|XP_003970636.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   1e-56   
emb|CDQ63777.1|  unnamed protein product                                195   1e-56   
ref|XP_003295671.1|  hypothetical protein PTT_02276                     189   1e-56   
ref|XP_002772409.1|  20 kDa cyclophilin precursor, putative             189   1e-56   
ref|XP_008683780.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   1e-56   
ref|XP_003794741.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   1e-56   
ref|XP_008788379.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   1e-56   
ref|XP_004964864.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    196   1e-56   
ref|XP_011088559.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   1e-56   
ref|XP_005839292.1|  cyclophilin type peptidyl-prolyl cis-trans i...    189   1e-56   
gb|ACO07673.1|  40 kDa peptidyl-prolyl cis-trans isomerase              195   1e-56   
ref|XP_010941286.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   1e-56   
gb|AEF01110.1|  cyclophilin 2                                           189   2e-56   
gb|AAC05639.1|  cyclophilin 1                                           189   2e-56   
ref|XP_009772522.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   2e-56   
emb|CAC81066.1|  putative cyclosporin A-binding protein                 189   2e-56   
ref|XP_010694773.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   2e-56   
ref|XP_006261512.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   2e-56   
ref|XP_011045074.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   2e-56   
ref|XP_001700372.1|  peptidyl-prolyl cis-trans isomerase, cycloph...    188   2e-56   
ref|XP_007041920.1|  Cyclophilin-like peptidyl-prolyl cis-trans i...    188   2e-56   
gb|KIZ04415.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    189   2e-56   
ref|XP_007714724.1|  hypothetical protein COCCADRAFT_102503             188   2e-56   
gb|KJB77728.1|  hypothetical protein B456_012G153200                    188   2e-56   
ref|XP_007201241.1|  hypothetical protein PRUPE_ppa012332mg             188   2e-56   
ref|XP_002985196.1|  hypothetical protein SELMODRAFT_121931             194   2e-56   
gb|KIK67886.1|  hypothetical protein GYMLUDRAFT_36683                   194   2e-56   
ref|XP_009623610.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   2e-56   
ref|XP_011046718.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   2e-56   
ref|XP_003650848.1|  hypothetical protein THITE_2094562                 194   2e-56   
gb|KDQ32919.1|  hypothetical protein PLEOSDRAFT_1069266                 194   2e-56   
gb|AEM44784.1|  cyclophilin                                             188   2e-56   
gb|EMD36826.1|  hypothetical protein CERSUDRAFT_114733                  194   2e-56   
ref|XP_003631573.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     188   2e-56   
ref|XP_004357939.1|  cyclophilin-type peptidylprolyl cis-trans is...    192   3e-56   
emb|CDJ42041.1|  20 kDa cyclophilin precursor, putative                 192   3e-56   
emb|CDP07390.1|  unnamed protein product                                188   3e-56   
ref|XP_006291930.1|  hypothetical protein CARUB_v10018115mg             188   3e-56   
ref|XP_009399694.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   3e-56   
ref|XP_009399695.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    195   3e-56   
ref|XP_008584596.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   3e-56   
ref|XP_008799420.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     188   3e-56   
ref|XP_002734227.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   3e-56   
emb|CEG04112.1|  unnamed protein product                                194   3e-56   
gb|ABK96333.1|  unknown                                                 188   3e-56   
ref|XP_010504491.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   3e-56   
ref|XP_011001198.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   3e-56   
ref|XP_007206000.1|  hypothetical protein PRUPE_ppa012309mg             188   3e-56   
ref|XP_010660113.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   3e-56   
ref|XP_004302078.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    188   4e-56   
ref|XP_002969864.1|  hypothetical protein SELMODRAFT_92589              194   4e-56   
gb|ACB05668.1|  cyclophilin                                             187   4e-56   
ref|XP_009399693.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   4e-56   
gb|KFH65352.1|  peptidyl-prolyl isomerase D (cyclophilin D)             194   4e-56   
ref|XP_008028418.1|  hypothetical protein SETTUDRAFT_164317             187   4e-56   
ref|XP_010104463.1|  Peptidyl-prolyl cis-trans isomerase                187   4e-56   
ref|XP_008364692.1|  PREDICTED: LOW QUALITY PROTEIN: peptidyl-pro...    187   4e-56   
ref|XP_002878060.1|  hypothetical protein ARALYDRAFT_907041             187   4e-56   
ref|XP_010526905.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     187   4e-56   
gb|ACF48822.1|  cyclophilin                                             187   4e-56   
ref|XP_002765236.1|  20 kDa cyclophilin precursor, putative             187   4e-56   
gb|AEY79726.1|  cyclophilin                                             187   4e-56   
gb|ABV26711.1|  cyclophilin                                             187   4e-56   
ref|XP_010043279.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    189   5e-56   
emb|CDH54639.1|  peptidyl-prolyl cis-trans isomerase                    193   5e-56   
gb|EPS65110.1|  peptidyl-prolyl cis-trans isomerase                     187   5e-56   
ref|XP_011029022.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     187   5e-56   
gb|KJB47605.1|  hypothetical protein B456_008G034100                    187   5e-56   
ref|XP_002521846.1|  peptidyl-prolyl cis-trans isomerase d, ppid,...    193   5e-56   
emb|CDJ67647.1|  20 kDa cyclophilin precursor, putative                 187   5e-56   
emb|CEI95580.1|  Putative Peptidyl-prolyl cis-trans isomerase D         193   5e-56   
emb|CEG74476.1|  Putative Peptidyl-prolyl cis-trans isomerase D         193   5e-56   
ref|XP_003050932.1|  predicted protein                                  193   5e-56   
emb|CDS13662.1|  hypothetical protein LRAMOSA05836                      193   5e-56   
ref|WP_030697934.1|  peptidylprolyl isomerase                           187   5e-56   
ref|XP_008370733.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    187   5e-56   
ref|XP_010548088.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    187   5e-56   
ref|XP_010043281.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    187   6e-56   
ref|NP_988984.1|  peptidyl-prolyl cis-trans isomerase D                 193   6e-56   
ref|XP_011083569.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    187   6e-56   
ref|XP_005330996.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   6e-56   
emb|CDW88516.1|  cyclophilin b                                          187   7e-56   
ref|XP_006384447.1|  SQUINT family protein                              193   7e-56   
gb|EWM25247.1|  hypothetical protein Naga_100571g1                      191   7e-56   
ref|XP_010516206.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    187   7e-56   
emb|CCT68318.1|  probable CPR6-member of the cyclophilin family         193   7e-56   
ref|XP_008683779.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    194   7e-56   
ref|XP_002788075.1|  cyclophilin 1, putative                            187   7e-56   
ref|XP_009590739.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    187   7e-56   
ref|XP_011402103.1|  Peptidyl-prolyl cis-trans isomerase CYP18-4        187   8e-56   
ref|XP_002301975.1|  Peptidyl-prolyl cis-trans isomerase family p...    187   8e-56   
gb|ACO08154.1|  40 kDa peptidyl-prolyl cis-trans isomerase              193   8e-56   
ref|XP_009759250.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     187   8e-56   
ref|XP_003664466.1|  hypothetical protein MYCTH_2307319                 193   8e-56   
dbj|GAN06990.1|  peptidyl-prolyl cis-trans isomerase D                  192   8e-56   
gb|AAO63777.1|  cyclophilin                                             187   9e-56   
ref|XP_006286099.1|  hypothetical protein CARUB_v10007642mg             187   9e-56   
ref|XP_001640978.1|  predicted protein                                  189   9e-56   
gb|ABK96400.1|  unknown                                                 187   9e-56   
ref|XP_010999957.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   9e-56   
ref|XP_009844129.1|  peptidyl-prolyl cis-trans isomerase 1              187   9e-56   
ref|XP_007572017.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    186   9e-56   
ref|XP_009034963.1|  cyclophilin                                        187   9e-56   
ref|XP_006969038.1|  predicted protein                                  193   9e-56   
ref|XP_010530785.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    186   1e-55   
ref|XP_003550075.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    192   1e-55   
ref|XP_006656773.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    193   1e-55   
ref|XP_011092880.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    186   1e-55   
gb|KIZ00361.1|  peptidyl-prolyl cis-trans isomerase, cyclophilin-...    186   1e-55   
emb|CBJ93268.1|  cyclophilin                                            186   1e-55   
ref|XP_008645736.1|  PREDICTED: peptidyl-prolyl cis-trans isomerase     186   1e-55   
ref|XP_010427414.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    186   1e-55   
ref|XP_010432371.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    186   1e-55   
gb|AEV66153.1|  cyclophilin                                             186   1e-55   
gb|AFK43730.1|  unknown                                                 186   1e-55   
dbj|BAH66378.1|  cyclophilin                                            184   1e-55   
ref|XP_003522746.1|  PREDICTED: peptidyl-prolyl cis-trans isomera...    186   1e-55   
gb|KHN80348.1|  Peptidyl-prolyl cis-trans isomerase 3                   186   1e-55   
gb|AAV48823.1|  cyclophilin 1                                           186   1e-55   



>emb|CDP03680.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   256 bits (653),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVFFDVS DG P +RI +ELFADVVP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MSKKKNPLVFFDVSIDGSPAERITIELFADVVPKTAENFRALCTGEKGIGSSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKF DENFKLDHSE GLLSMANSGPNTNG
Sbjct  61   GSSFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKLDHSEAGLLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKRQPHLD
Sbjct  121  SQFFITFKRQPHLD  134



>ref|XP_009601160.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Nicotiana tomentosiformis]
Length=661

 Score =   251 bits (640),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG P +RIV+ELFAD+VPRTAENFR+LCTGEKG+G STGKPLHYK
Sbjct  1    MKKKKNPLVFLDVSMDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            GC+FHR+IKGFMAQGGDFSKGNGTGGESIYGGKF DENFK+DH+E G+LSMANSGPNTNG
Sbjct  61   GCLFHRVIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKVDHTEAGILSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKR PHLD
Sbjct  121  SQFFITFKRTPHLD  134



>ref|XP_009601158.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana tomentosiformis]
Length=662

 Score =   250 bits (639),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG P +RIV+ELFAD+VPRTAENFR+LCTGEKG+G STGKPLHYK
Sbjct  1    MKKKKNPLVFLDVSMDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            GC+FHR+IKGFMAQGGDFSKGNGTGGESIYGGKF DENFK+DH+E G+LSMANSGPNTNG
Sbjct  61   GCLFHRVIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKVDHTEAGILSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKR PHLD
Sbjct  121  SQFFITFKRTPHLD  134



>gb|EYU46533.1| hypothetical protein MIMGU_mgv1a002319mg [Erythranthe guttata]
Length=688

 Score =   248 bits (633),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + K KNPLVF +VS +G   +RIV+ELFAD VP+TAENFRALCTGEKG+G STGKPLHYK
Sbjct  1    MKKTKNPLVFLEVSIEGDTAERIVIELFADTVPKTAENFRALCTGEKGVGTSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            GC FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMAN GPNTNG
Sbjct  61   GCTFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANGGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFIIFKRQPHLD  134



>ref|XP_007050461.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOX94618.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 2 [Theobroma cacao]
Length=557

 Score =   245 bits (625),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG PV+RI++ELFADVVP+TAENFRALCTGEKG+G STGKPLHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDPVERIIIELFADVVPKTAENFRALCTGEKGVGKSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G   HRIIKGFMAQGGDFSKGNGTGGESIYGGK  DENFKL H  PG+LSMANSGPNTNG
Sbjct  61   GSFLHRIIKGFMAQGGDFSKGNGTGGESIYGGKLVDENFKLAHDGPGVLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKRQPHLD
Sbjct  121  SQFFITFKRQPHLD  134



>gb|KJB25951.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=602

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP+VFFDVS  G  V+RI++ELFADVVP+TAENFRALCTGEKGIG  TGKPLHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL H  PG+LSMANSGPNTNG
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLTHDGPGVLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKRQPHLD
Sbjct  121  SQFFITFKRQPHLD  134



>gb|KJB25950.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=599

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP+VFFDVS  G  V+RI++ELFADVVP+TAENFRALCTGEKGIG  TGKPLHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL H  PG+LSMANSGPNTNG
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLTHDGPGVLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKRQPHLD
Sbjct  121  SQFFITFKRQPHLD  134



>ref|XP_002280876.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Vitis vinifera]
Length=702

 Score =   246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG PV++IV+ELFADVVP+TAENFRALCTGEKG+G STGKPLHYK
Sbjct  1    MTKKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFK  H  PG LSMANSGPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKRAHEGPGFLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFF+TFKRQPHLD
Sbjct  121  SQFFMTFKRQPHLD  134



>ref|XP_010646137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Vitis vinifera]
 emb|CBI25055.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   245 bits (626),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG PV++IV+ELFADVVP+TAENFRALCTGEKG+G STGKPLHYK
Sbjct  1    MTKKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFK  H  PG LSMANSGPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKRAHEGPGFLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFF+TFKRQPHLD
Sbjct  121  SQFFMTFKRQPHLD  134



>gb|KJB25952.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=626

 Score =   244 bits (622),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP+VFFDVS  G  V+RI++ELFADVVP+TAENFRALCTGEKGIG  TGKPLHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL H  PG+LSMANSGPNTNG
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLTHDGPGVLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKRQPHLD
Sbjct  121  SQFFITFKRQPHLD  134



>ref|XP_009798520.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798521.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009798522.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Nicotiana sylvestris]
Length=660

 Score =   244 bits (624),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG P +RIV+ELFAD+VPRTAENFR+LCTGEKG+G STGKPLHYK
Sbjct  1    MKKKKNPLVFLDVSIDGNPAERIVIELFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            GC+FHR+IKGFMAQGGDFSKGNGTGGESIYGGKF DENFK+ H+  GLLSMANSGPNTNG
Sbjct  61   GCLFHRVIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKVVHTGAGLLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKR PHLD
Sbjct  121  SQFFITFKRTPHLD  134



>ref|XP_007050460.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX94617.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein, 
putative isoform 1 [Theobroma cacao]
Length=676

 Score =   245 bits (625),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG PV+RI++ELFADVVP+TAENFRALCTGEKG+G STGKPLHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDPVERIIIELFADVVPKTAENFRALCTGEKGVGKSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G   HRIIKGFMAQGGDFSKGNGTGGESIYGGK  DENFKL H  PG+LSMANSGPNTNG
Sbjct  61   GSFLHRIIKGFMAQGGDFSKGNGTGGESIYGGKLVDENFKLAHDGPGVLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKRQPHLD
Sbjct  121  SQFFITFKRQPHLD  134



>gb|KJB25953.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=634

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP+VFFDVS  G  V+RI++ELFADVVP+TAENFRALCTGEKGIG  TGKPLHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL H  PG+LSMANSGPNTNG
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLTHDGPGVLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKRQPHLD
Sbjct  121  SQFFITFKRQPHLD  134



>gb|KJB25949.1| hypothetical protein B456_004G217800 [Gossypium raimondii]
Length=661

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/134 (86%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP+VFFDVS  G  V+RI++ELFADVVP+TAENFRALCTGEKGIG  TGKPLHYK
Sbjct  1    MSKKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKCTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKL H  PG+LSMANSGPNTNG
Sbjct  61   GTFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLTHDGPGVLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKRQPHLD
Sbjct  121  SQFFITFKRQPHLD  134



>gb|KDP21391.1| hypothetical protein JCGZ_21862 [Jatropha curcas]
Length=716

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + K+KNPLVFFDVS DG PV+RI  ELFA+ VP+TAENFRALCTGEKGIG +TGKPLHYK
Sbjct  1    MSKRKNPLVFFDVSIDGDPVERIAFELFANFVPKTAENFRALCTGEKGIGKTTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRII+GFMAQGGDFSKGNGTGGESIYGGKFADENF L H EPGLLSMANSGPNTNG
Sbjct  61   GSFFHRIIRGFMAQGGDFSKGNGTGGESIYGGKFADENFILKHDEPGLLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFF+TFKRQPHLD
Sbjct  121  SQFFVTFKRQPHLD  134



>ref|XP_010038051.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Eucalyptus grandis]
Length=661

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + K+KNPLVF DVS DG PV+RIV+ELFAD VPRTAENFR+LCTGEKG+G +TGKPLHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPVERIVIELFADTVPRTAENFRSLCTGEKGVGKTTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKFADENFKL H  PGLLSMAN GPNTNG
Sbjct  61   GSYFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLAHDGPGLLSMANGGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFIIFKRQPHLD  134



>ref|XP_010038050.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Eucalyptus grandis]
 gb|KCW49849.1| hypothetical protein EUGRSUZ_K03321 [Eucalyptus grandis]
Length=664

 Score =   243 bits (620),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + K+KNPLVF DVS DG PV+RIV+ELFAD VPRTAENFR+LCTGEKG+G +TGKPLHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPVERIVIELFADTVPRTAENFRSLCTGEKGVGKTTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKFADENFKL H  PGLLSMAN GPNTNG
Sbjct  61   GSYFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLAHDGPGLLSMANGGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFIIFKRQPHLD  134



>ref|XP_006349731.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Solanum 
tuberosum]
Length=658

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG   ++IV+ELFAD VPRTAENFR+LCTGEKG+G STGKPLHYK
Sbjct  1    MSKKKNPLVFLDVSIDGDTAEKIVIELFADTVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            GC+FHR+IKGFMAQGGDFSKGNGTGGESIYGGKF DENFK+ H+E GLLSMANSGPNTNG
Sbjct  61   GCLFHRVIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKVAHTEAGLLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKR PHLD
Sbjct  121  SQFFIIFKRTPHLD  134



>ref|XP_009370747.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Pyrus x 
bretschneideri]
Length=535

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS D  PV++IV+ELFADVVP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MSKKKNPRVFLDVSIDRDPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKFADENF L H  PGLLSMAN+GPNTNG
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADENFNLKHDRPGLLSMANAGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI F+RQPHLD
Sbjct  121  SQFFIIFRRQPHLD  134



>ref|XP_003521263.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like [Glycine 
max]
Length=668

 Score =   241 bits (616),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            +KNP VFFDVS DG PV+RIV++LFA +VPRTAENFRALCTGEKGIG+STGKPLHYKG  
Sbjct  4    EKNPRVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGESTGKPLHYKGTS  63

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
             HRII+GFMAQGGDFS+GNGTGGESIYGGKFADENFKL H  PG+LSMANSGPNTNGSQF
Sbjct  64   LHRIIRGFMAQGGDFSRGNGTGGESIYGGKFADENFKLTHDGPGILSMANSGPNTNGSQF  123

Query  622  FITFKRQPHLD  654
            FITFKRQPHLD
Sbjct  124  FITFKRQPHLD  134



>ref|XP_006604473.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X5 [Glycine max]
Length=635

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            +KNPLVFFDVS DG PV+RIV++LFA +VPRTAENFRALCTGEKGIG+ TGKPLHYKG  
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
            FHRII+GFMAQGGDFS+GNGTGGESIYGGKF DENFKL H  PG+LSMANSGPNTNGSQF
Sbjct  64   FHRIIRGFMAQGGDFSRGNGTGGESIYGGKFVDENFKLTHDGPGVLSMANSGPNTNGSQF  123

Query  622  FITFKRQPHLD  654
            FITFKRQPHLD
Sbjct  124  FITFKRQPHLD  134



>ref|XP_006604472.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X4 [Glycine max]
Length=640

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            +KNPLVFFDVS DG PV+RIV++LFA +VPRTAENFRALCTGEKGIG+ TGKPLHYKG  
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
            FHRII+GFMAQGGDFS+GNGTGGESIYGGKF DENFKL H  PG+LSMANSGPNTNGSQF
Sbjct  64   FHRIIRGFMAQGGDFSRGNGTGGESIYGGKFVDENFKLTHDGPGVLSMANSGPNTNGSQF  123

Query  622  FITFKRQPHLD  654
            FITFKRQPHLD
Sbjct  124  FITFKRQPHLD  134



>gb|KDO68605.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=622

 Score =   240 bits (613),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + +KKNPLVF DVS DG PV++IV+ELFADVVP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MSEKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G +FHRIIKGFM QGGDFSKGNGTGGESIYGGKF DENFKLDH+ PG+LSMANSG NTNG
Sbjct  61   GTMFHRIIKGFMIQGGDFSKGNGTGGESIYGGKFTDENFKLDHNGPGILSMANSGANTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITF+RQ HLD
Sbjct  121  SQFFITFRRQHHLD  134



>ref|XP_006604471.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Glycine max]
 gb|KHN02546.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=659

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            +KNPLVFFDVS DG PV+RIV++LFA +VPRTAENFRALCTGEKGIG+ TGKPLHYKG  
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
            FHRII+GFMAQGGDFS+GNGTGGESIYGGKF DENFKL H  PG+LSMANSGPNTNGSQF
Sbjct  64   FHRIIRGFMAQGGDFSRGNGTGGESIYGGKFVDENFKLTHDGPGVLSMANSGPNTNGSQF  123

Query  622  FITFKRQPHLD  654
            FITFKRQPHLD
Sbjct  124  FITFKRQPHLD  134



>ref|XP_006604469.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Glycine max]
 ref|XP_006604470.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Glycine max]
Length=664

 Score =   241 bits (614),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            +KNPLVFFDVS DG PV+RIV++LFA +VPRTAENFRALCTGEKGIG+ TGKPLHYKG  
Sbjct  4    EKNPLVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGELTGKPLHYKGTS  63

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
            FHRII+GFMAQGGDFS+GNGTGGESIYGGKF DENFKL H  PG+LSMANSGPNTNGSQF
Sbjct  64   FHRIIRGFMAQGGDFSRGNGTGGESIYGGKFVDENFKLTHDGPGVLSMANSGPNTNGSQF  123

Query  622  FITFKRQPHLD  654
            FITFKRQPHLD
Sbjct  124  FITFKRQPHLD  134



>ref|XP_004247203.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Solanum lycopersicum]
Length=660

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG   ++IV+ELFAD VPRTAENFR+LCTGEKG+G STGKPLHYK
Sbjct  1    MSKKKNPLVFLDVSVDGDAAEKIVIELFADTVPRTAENFRSLCTGEKGVGVSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            GC+FHR+IKGFMAQGGDFSKGNGTGGESIYGGKF DENFK+ H+E GLLSMANSGPNTNG
Sbjct  61   GCLFHRVIKGFMAQGGDFSKGNGTGGESIYGGKFPDENFKVAHAEAGLLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKR PHLD
Sbjct  121  SQFFIIFKRTPHLD  134



>ref|XP_006443960.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479627.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Citrus sinensis]
 ref|XP_006479628.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Citrus sinensis]
 gb|ESR57200.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68607.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=650

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + +KKNPLVF DVS DG PV++IV+ELFADVVP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MSEKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G +FHRIIKGFM QGGDFSKGNGTGGESIYGGKF DENFKLDH+ PG+LSMANSG NTNG
Sbjct  61   GTMFHRIIKGFMIQGGDFSKGNGTGGESIYGGKFTDENFKLDHNGPGILSMANSGANTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITF+RQ HLD
Sbjct  121  SQFFITFRRQHHLD  134



>ref|XP_006443959.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 ref|XP_006479629.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Citrus sinensis]
 gb|ESR57199.1| hypothetical protein CICLE_v10019230mg [Citrus clementina]
 gb|KDO68606.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=643

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + +KKNPLVF DVS DG PV++IV+ELFADVVP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MSEKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G +FHRIIKGFM QGGDFSKGNGTGGESIYGGKF DENFKLDH+ PG+LSMANSG NTNG
Sbjct  61   GTMFHRIIKGFMIQGGDFSKGNGTGGESIYGGKFTDENFKLDHNGPGILSMANSGANTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITF+RQ HLD
Sbjct  121  SQFFITFRRQHHLD  134



>gb|KHN10697.1| Peptidyl-prolyl cis-trans isomerase [Glycine soja]
Length=727

 Score =   241 bits (614),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            +KNP VFFDVS DG PV+RIV++LFA +VPRTAENFRALCTGEKGIG+STGKPLHYKG  
Sbjct  63   EKNPRVFFDVSIDGDPVERIVIQLFASIVPRTAENFRALCTGEKGIGESTGKPLHYKGTS  122

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
             HRII+GFMAQGGDFS+GNGTGGESIYGGKFADENFKL H  PG+LSMANSGPNTNGSQF
Sbjct  123  LHRIIRGFMAQGGDFSRGNGTGGESIYGGKFADENFKLTHDGPGILSMANSGPNTNGSQF  182

Query  622  FITFKRQPHLD  654
            FITFKRQPHLD
Sbjct  183  FITFKRQPHLD  193



>gb|KHG26228.1| Peptidyl-prolyl cis-trans isomerase D [Gossypium arboreum]
Length=177

 Score =   226 bits (575),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 120/143 (84%), Gaps = 11/143 (8%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            KKKNP+VFFDVS  G  V+RI++ELFADVVP+TAENFRALCTGEKGIG STGKPLHYKG 
Sbjct  3    KKKNPMVFFDVSIGGDLVERIIIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGT  62

Query  439  IFHRIIKGFMAQGGDFSKGNG-----------TGGESIYGGKFADENFKLDHSEPGLLSM  585
              HRIIKGFMAQGGDFSKGNG           TGGESIYGGKFADENFKL H  PG+LSM
Sbjct  63   FLHRIIKGFMAQGGDFSKGNGMLAHSSASKFCTGGESIYGGKFADENFKLTHDGPGILSM  122

Query  586  ANSGPNTNGSQFFITFKRQPHLD  654
            ANSGPNTNGSQFFITFK QPHLD
Sbjct  123  ANSGPNTNGSQFFITFKGQPHLD  145



>ref|XP_011079927.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Sesamum 
indicum]
Length=696

 Score =   240 bits (612),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VF DVS D    QRIV+ELFADVVP+TAENFRALCTGEKG+G  TGKPLHYKG  F
Sbjct  5    KNPSVFLDVSIDSDTTQRIVIELFADVVPKTAENFRALCTGEKGVGSLTGKPLHYKGSTF  64

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHS PG LSMAN GPNTNGSQFF
Sbjct  65   HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSGPGFLSMANGGPNTNGSQFF  124

Query  625  ITFKRQPHLD  654
            ITFKRQPHLD
Sbjct  125  ITFKRQPHLD  134



>gb|KDO68608.1| hypothetical protein CISIN_1g006162mg [Citrus sinensis]
Length=658

 Score =   239 bits (609),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + +KKNPLVF DVS DG PV++IV+ELFADVVP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MSEKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G +FHRIIKGFM QGGDFSKGNGTGGESIYGGKF DENFKLDH+ PG+LSMANSG NTNG
Sbjct  61   GTMFHRIIKGFMIQGGDFSKGNGTGGESIYGGKFTDENFKLDHNGPGILSMANSGANTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITF+RQ HLD
Sbjct  121  SQFFITFRRQHHLD  134



>ref|XP_008235346.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G isoform X2 [Prunus 
mume]
Length=669

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            +KKNP VF DVS DG P++R+V+ELFADVVP+TAENFRALCTG+KGIG STGKPLHYKG 
Sbjct  3    RKKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGS  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIKGFMAQGGDFS GNGTGGESIYGGKFADENFKL H  PGLLSMAN+GPNTNGSQ
Sbjct  63   QFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLKHDGPGLLSMANAGPNTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFI F+RQPHLD
Sbjct  123  FFIIFRRQPHLD  134



>ref|XP_008235345.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X1 [Prunus 
mume]
Length=670

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            +KKNP VF DVS DG P++R+V+ELFADVVP+TAENFRALCTG+KGIG STGKPLHYKG 
Sbjct  3    RKKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGS  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIKGFMAQGGDFS GNGTGGESIYGGKFADENFKL H  PGLLSMAN+GPNTNGSQ
Sbjct  63   QFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLKHDGPGLLSMANAGPNTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFI F+RQPHLD
Sbjct  123  FFIIFRRQPHLD  134



>ref|XP_008235347.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 isoform X3 [Prunus 
mume]
Length=665

 Score =   239 bits (609),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            +KKNP VF DVS DG P++R+V+ELFADVVP+TAENFRALCTG+KGIG STGKPLHYKG 
Sbjct  3    RKKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGS  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIKGFMAQGGDFS GNGTGGESIYGGKFADENFKL H  PGLLSMAN+GPNTNGSQ
Sbjct  63   QFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLKHDGPGLLSMANAGPNTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFI F+RQPHLD
Sbjct  123  FFIIFRRQPHLD  134



>ref|XP_004493727.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Cicer arietinum]
Length=665

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            +KNP VF DVS DG PV+RIV+ELF+ +VP+TAENFRALCTGEKGIG+STGKPLHYKG  
Sbjct  4    EKNPCVFLDVSVDGDPVERIVIELFSSIVPKTAENFRALCTGEKGIGESTGKPLHYKGTC  63

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
            FHR+IKGFMAQGGDFS+GNGTGGESIYGGKFADEN KL H  PG+LSMANSGPNTNGSQF
Sbjct  64   FHRVIKGFMAQGGDFSRGNGTGGESIYGGKFADENVKLKHDGPGILSMANSGPNTNGSQF  123

Query  622  FITFKRQPHLD  654
            FI FKRQPHLD
Sbjct  124  FIIFKRQPHLD  134



>ref|XP_008355416.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
 ref|XP_008355417.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like [Malus 
domestica]
Length=595

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS D  PV++IV+ELFADVVP+TAENFRALCTGEKGIG STGK LHYK
Sbjct  1    MSKKKNPCVFLDVSIDRDPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKLLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKFADENFKL H  PGLLSMAN+GPNTNG
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLKHDRPGLLSMANAGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI F+RQPHLD
Sbjct  121  SQFFIIFRRQPHLD  134



>ref|NP_850740.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE80476.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=387

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PVQRIV+ELFADVVP+TAENFRALCTGE G+G STGKPLH+K
Sbjct  1    MTKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF+LDH   G+LSMAN GPNTNG
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFILFKRQPHLD  134



>ref|XP_007199724.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
 gb|EMJ00923.1| hypothetical protein PRUPE_ppa002435mg [Prunus persica]
Length=673

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            +KKNP VF DVS DG P++R+V+ELFADVVP+TAENFRALCTG+KGIG STGKPLHYKG 
Sbjct  3    RKKNPCVFLDVSTDGDPMERVVIELFADVVPKTAENFRALCTGDKGIGKSTGKPLHYKGS  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIKGFMAQGGDFS GNGTGGESIYGGKFADENFKL H  PG+LSMAN+GPNTNGSQ
Sbjct  63   QFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFADENFKLKHDGPGVLSMANAGPNTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFI F+RQPHLD
Sbjct  123  FFIIFRRQPHLD  134



>ref|XP_008366534.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X2 [Malus domestica]
Length=533

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS D  PV++IV+ELFADVVP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MSKKKNPRVFLDVSIDRAPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKFADE FKL H  PGLLSMAN+GPNTNG
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADEXFKLKHDGPGLLSMANAGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI F+ QPHLD
Sbjct  121  SQFFIIFRHQPHLD  134



>ref|XP_008366532.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
 ref|XP_008366533.1| PREDICTED: peptidyl-prolyl cis-trans isomerase cyp11-like isoform 
X1 [Malus domestica]
Length=534

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS D  PV++IV+ELFADVVP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MSKKKNPRVFLDVSIDRAPVEQIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKFADE FKL H  PGLLSMAN+GPNTNG
Sbjct  61   GSTFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFADEXFKLKHDGPGLLSMANAGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI F+ QPHLD
Sbjct  121  SQFFIIFRHQPHLD  134



>ref|XP_004146961.1| PREDICTED: uncharacterized protein LOC101219904 [Cucumis sativus]
 gb|KGN44769.1| hypothetical protein Csa_7G378580 [Cucumis sativus]
Length=668

 Score =   237 bits (605),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS  G PVQRI++ELFA+VVP+TA+NFRALCTGEKGIG +T KPLHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS+GNGTGGES+YGGKF+DENFKL H  PG+LSMANSGPNTNG
Sbjct  61   GTFFHRIIKGFMAQGGDFSRGNGTGGESVYGGKFSDENFKLKHDGPGILSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK QPHLD
Sbjct  121  SQFFITFKPQPHLD  134



>ref|XP_008451290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 8 [Cucumis melo]
Length=669

 Score =   237 bits (605),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS  G PVQRI++ELFA+VVP+TA+NFRALCTGEKGIG +T KPLHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS+GNGTGGES+YGGKF+DENFKL H  PG+LSMANSGPNTNG
Sbjct  61   GTFFHRIIKGFMAQGGDFSRGNGTGGESVYGGKFSDENFKLKHDGPGILSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK QPHLD
Sbjct  121  SQFFITFKPQPHLD  134



>ref|XP_004162194.1| PREDICTED: uncharacterized LOC101219904 [Cucumis sativus]
Length=655

 Score =   236 bits (603),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS  G PVQRI++ELFA+VVP+TA+NFRALCTGEKGIG +T KPLHYK
Sbjct  1    MSKKKNPLVFLDVSIGGEPVQRIIIELFANVVPKTADNFRALCTGEKGIGKTTEKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS+GNGTGGES+YGGKF+DENFKL H  PG+LSMANSGPNTNG
Sbjct  61   GTFFHRIIKGFMAQGGDFSRGNGTGGESVYGGKFSDENFKLKHDGPGILSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK QPHLD
Sbjct  121  SQFFITFKPQPHLD  134



>gb|KEH23833.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula]
Length=651

 Score =   236 bits (601),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDVS DG PV+RIV+ELF+ VVP+TAENFRALCTGEKGIG++TGKPLHYKG  F
Sbjct  5    KNPCVFFDVSVDGDPVERIVIELFSSVVPKTAENFRALCTGEKGIGEATGKPLHYKGTSF  64

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIKGFMAQGGDFS+GNGTGGESIYGGKFADENFKL H  PG+LSMANSGPNTNGSQFF
Sbjct  65   HRIIKGFMAQGGDFSRGNGTGGESIYGGKFADENFKLKHDGPGVLSMANSGPNTNGSQFF  124

Query  625  ITFKRQPHLD  654
            I FKRQ HLD
Sbjct  125  IIFKRQAHLD  134



>ref|XP_002520955.1| cyclophilin, putative [Ricinus communis]
 gb|EEF41372.1| cyclophilin, putative [Ricinus communis]
Length=688

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLV+FDVS DG PV+RIV+ELFADV P+TAENFRALCTGE GIG +TGKPLHYK
Sbjct  1    MSKKKNPLVYFDVSIDGDPVERIVIELFADVAPKTAENFRALCTGEMGIGKTTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKF+DENF L H   G LSMANSGPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFSDENFILKHDGAGFLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKRQP LD
Sbjct  121  SQFFITFKRQPQLD  134



>gb|EPS61145.1| hypothetical protein M569_13654 [Genlisea aurea]
Length=565

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 120/141 (85%), Gaps = 7/141 (5%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + K KNP VF D+S DG   +RIV+ELFAD VP+TAENFRALCTGEKG+G STGKPLHYK
Sbjct  1    MKKTKNPFVFLDISVDGNAAERIVIELFADAVPKTAENFRALCTGEKGVGVSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNG-------TGGESIYGGKFADENFKLDHSEPGLLSMAN  591
            G  FHRII+GFMAQGGDFSKGNG       TGGESIYGGKFADENFK DH+EPG+LSMAN
Sbjct  61   GITFHRIIRGFMAQGGDFSKGNGMLITSRRTGGESIYGGKFADENFKFDHNEPGILSMAN  120

Query  592  SGPNTNGSQFFITFKRQPHLD  654
             GPNTNGSQFFITFKRQPHLD
Sbjct  121  GGPNTNGSQFFITFKRQPHLD  141



>ref|XP_007162476.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 ref|XP_007162477.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34470.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
 gb|ESW34471.1| hypothetical protein PHAVU_001G155500g [Phaseolus vulgaris]
Length=663

 Score =   234 bits (597),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            +KN  VFFDVS D  PV+RIV++LF  +VP+TAENFRALCTGEKGIG+STGKPLHYKG  
Sbjct  4    EKNVRVFFDVSIDADPVERIVIQLFDSIVPKTAENFRALCTGEKGIGESTGKPLHYKGTS  63

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
            FHRIIKGFMAQGGDFS+GNGTGGESIYGGKFADENFKL H  PG LSMANSGPNTNGSQF
Sbjct  64   FHRIIKGFMAQGGDFSRGNGTGGESIYGGKFADENFKLRHDGPGFLSMANSGPNTNGSQF  123

Query  622  FITFKRQPHLD  654
            FITFKRQPHLD
Sbjct  124  FITFKRQPHLD  134



>ref|XP_010527624.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X9 [Tarenaya hassleriana]
Length=536

 Score =   231 bits (589),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PV+RIV++LFADVVP+TAENFRALCTGEKGIG++TGKPLH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKF+DENFKL+H   G+LSMAN GPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHL+
Sbjct  121  SQFFIIFKRQPHLN  134



>ref|XP_010527623.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X8 [Tarenaya hassleriana]
Length=538

 Score =   231 bits (589),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PV+RIV++LFADVVP+TAENFRALCTGEKGIG++TGKPLH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKF+DENFKL+H   G+LSMAN GPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHL+
Sbjct  121  SQFFIIFKRQPHLN  134



>ref|XP_010527622.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X7 [Tarenaya hassleriana]
Length=541

 Score =   231 bits (589),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PV+RIV++LFADVVP+TAENFRALCTGEKGIG++TGKPLH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKF+DENFKL+H   G+LSMAN GPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHL+
Sbjct  121  SQFFIIFKRQPHLN  134



>ref|NP_191899.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 ref|NP_001190169.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 sp|Q9LY75.1|CYP63_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase CYP63; Short=AtCYP63; 
Short=PPIase CYP63; AltName: Full=Cyclophilin-63; 
AltName: Full=Cyclophilin-like protein CypRS64 [Arabidopsis 
thaliana]
 emb|CAB87793.1| cyclophylin-like protein [Arabidopsis thaliana]
 gb|AAN41315.1| putative cyclophylin protein [Arabidopsis thaliana]
 gb|AEE80475.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
 gb|AEE80477.1| cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein 
[Arabidopsis thaliana]
Length=570

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PVQRIV+ELFADVVP+TAENFRALCTGE G+G STGKPLH+K
Sbjct  1    MTKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF+LDH   G+LSMAN GPNTNG
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFILFKRQPHLD  134



>gb|AAS75310.1| multidomain cyclophilin type peptidyl-prolyl cis-trans isomerase 
[Arabidopsis thaliana]
Length=566

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PVQRIV+ELFADVVP+TAENFRALCTGE G+G STGKPLH+K
Sbjct  1    MTKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF+LDH   G+LSMAN GPNTNG
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFILFKRQPHLD  134



>dbj|BAH57223.1| AT3G63400 [Arabidopsis thaliana]
Length=570

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PVQRIV+ELFADVVP+TAENFRALCTGE G+G STGKPLH+K
Sbjct  1    MTKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKSTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF+LDH   G+LSMAN GPNTNG
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFILFKRQPHLD  134



>ref|XP_010527616.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Tarenaya hassleriana]
Length=634

 Score =   231 bits (590),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PV+RIV++LFADVVP+TAENFRALCTGEKGIG++TGKPLH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKF+DENFKL+H   G+LSMAN GPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHL+
Sbjct  121  SQFFIIFKRQPHLN  134



>ref|XP_010527621.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X6 [Tarenaya hassleriana]
Length=629

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PV+RIV++LFADVVP+TAENFRALCTGEKGIG++TGKPLH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKF+DENFKL+H   G+LSMAN GPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHL+
Sbjct  121  SQFFIIFKRQPHLN  134



>ref|XP_010527615.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Tarenaya hassleriana]
Length=636

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PV+RIV++LFADVVP+TAENFRALCTGEKGIG++TGKPLH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKF+DENFKL+H   G+LSMAN GPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHL+
Sbjct  121  SQFFIIFKRQPHLN  134



>ref|XP_010527619.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X4 [Tarenaya hassleriana]
Length=631

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PV+RIV++LFADVVP+TAENFRALCTGEKGIG++TGKPLH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKF+DENFKL+H   G+LSMAN GPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHL+
Sbjct  121  SQFFIIFKRQPHLN  134



>ref|XP_010527620.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X5 [Tarenaya hassleriana]
Length=631

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PV+RIV++LFADVVP+TAENFRALCTGEKGIG++TGKPLH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKF+DENFKL+H   G+LSMAN GPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHL+
Sbjct  121  SQFFIIFKRQPHLN  134



>ref|XP_010527617.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Tarenaya hassleriana]
Length=633

 Score =   231 bits (590),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PV+RIV++LFADVVP+TAENFRALCTGEKGIG++TGKPLH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVERIVIQLFADVVPKTAENFRALCTGEKGIGETTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKF+DENFKL+H   G+LSMAN GPNTNG
Sbjct  61   GSFFHRIIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLEHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHL+
Sbjct  121  SQFFIIFKRQPHLN  134



>ref|XP_006402278.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 ref|XP_006402279.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43731.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
 gb|ESQ43732.1| hypothetical protein EUTSA_v10006033mg [Eutrema salsugineum]
Length=384

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KK NP VF DVS  G PV+RIV+ELFADVVP+TAENFRALCTGE GIG +TGKPL +K
Sbjct  1    MSKKNNPNVFLDVSLGGDPVERIVIELFADVVPKTAENFRALCTGEAGIGKTTGKPLQFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENFKLDH   G+LSMAN GPNTNG
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFKLDHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFILFKRQPHLD  134



>ref|XP_006290850.1| hypothetical protein CARUB_v10016960mg [Capsella rubella]
 gb|EOA23748.1| hypothetical protein CARUB_v10016960mg [Capsella rubella]
Length=551

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PV+RIV+ELFADVVP+TAENFRALCTGE G+G +T KPLH+K
Sbjct  1    MTKKKNPHVFLDVSIGGDPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTTKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF+LDH   G+LSMANSGPNTNG
Sbjct  61   GSSFHRVIKGFMAQGGDFSVGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFILFKRQPHLD  134



>ref|XP_002876720.1| hypothetical protein ARALYDRAFT_324764 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52979.1| hypothetical protein ARALYDRAFT_324764 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PVQRIV+ELFADVVP+TAENFRALCTGE G+G +T KPLH+K
Sbjct  1    MSKKKNPNVFLDVSIGGDPVQRIVIELFADVVPKTAENFRALCTGEAGVGKTTRKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF+LDH   G+LSMAN GPNTNG
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGILSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFILFKRQPHLD  134



>gb|AJA29688.1| peptidyl-prolyl cis-trans isomerase [Betula luminifera]
Length=695

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + +KKNP VF D+S DG PV+RIV+ELFADVVP+TAENFRALCTGEKGIG STGKPLHY+
Sbjct  1    MSEKKNPFVFLDLSIDGDPVERIVIELFADVVPKTAENFRALCTGEKGIGKSTGKPLHYR  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G   HRIIKGFMAQGGDFS G+GTGGESIYGGKFADENF+L H   G+LSMAN G NTNG
Sbjct  61   GSYLHRIIKGFMAQGGDFSSGDGTGGESIYGGKFADENFRLKHDGAGVLSMANCGLNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKRQPHLD
Sbjct  121  SQFFITFKRQPHLD  134



>ref|XP_011032623.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Populus 
euphratica]
 ref|XP_011032624.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Populus 
euphratica]
Length=680

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            KKKNPLVF DVS DG P +RI +ELFADVVPRTAENFRALCTGEKGIG +TGKPLHYKG 
Sbjct  3    KKKNPLVFLDVSIDGDPAERIFIELFADVVPRTAENFRALCTGEKGIGKTTGKPLHYKGS  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIK FMAQGGDFSKGNGTGGESIYGGKF+DENF L H   G LSMANSGPNTNGSQ
Sbjct  63   SFHRIIKEFMAQGGDFSKGNGTGGESIYGGKFSDENFILRHEGAGRLSMANSGPNTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFIT K Q HLD
Sbjct  123  FFITLKPQAHLD  134



>ref|XP_002306802.2| hypothetical protein POPTR_0005s23730g [Populus trichocarpa]
 gb|EEE93798.2| hypothetical protein POPTR_0005s23730g [Populus trichocarpa]
Length=673

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG P +RI +ELFADVVPRTAENFRALCTGEKG G +TGKPLHYK
Sbjct  1    MSKKKNPLVFLDVSIDGDPAERIFIELFADVVPRTAENFRALCTGEKGTGKTTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIK FMAQGGDFSKGNGTGGESIYGGKFADENF L H   G LSMANSGPNTNG
Sbjct  61   GSSFHRIIKEFMAQGGDFSKGNGTGGESIYGGKFADENFILRHEGAGHLSMANSGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFIT K Q HLD
Sbjct  121  SQFFITLKPQAHLD  134



>emb|CDX93909.1| BnaC04g20680D [Brassica napus]
Length=612

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = +1

Query  229  PVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDS  408
            P+G+      KKKNP VF DVS  G P++RIV+ELFA VVP+TAENFRALCTGE G+G +
Sbjct  70   PLGI-SMSSSKKKNPTVFLDVSIGGDPLERIVIELFAHVVPKTAENFRALCTGEAGLGKT  128

Query  409  TGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMA  588
            TGKPLH+KG  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF DENF+LDH E G+LSMA
Sbjct  129  TGKPLHFKGSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFPDENFELDHEEGGVLSMA  188

Query  589  NSGPNTNGSQFFITFKRQPHLD  654
            N GPNTNGSQFFI FKRQPHLD
Sbjct  189  NCGPNTNGSQFFILFKRQPHLD  210



>ref|XP_002302085.2| hypothetical protein POPTR_0002s04800g [Populus trichocarpa]
 gb|EEE81358.2| hypothetical protein POPTR_0002s04800g [Populus trichocarpa]
Length=688

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            ++KKKNPLVF DVS DG P +RI +ELFADVVP+TAENFRALCTGEKGIG +TGKPLHYK
Sbjct  1    MIKKKNPLVFLDVSIDGDPAERIFIELFADVVPKTAENFRALCTGEKGIGKTTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            GC FHRIIKGFMAQGGDFSK NG+GGESIYGGKFADENF L H   GLLSMANSGP+TNG
Sbjct  61   GCSFHRIIKGFMAQGGDFSKRNGSGGESIYGGKFADENFILRHEGAGLLSMANSGPDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FK   HLD
Sbjct  121  SQFFIIFKPHVHLD  134



>emb|CAN75764.1| hypothetical protein VITISV_034442 [Vitis vinifera]
Length=786

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 122/161 (76%), Gaps = 27/161 (17%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG PV++IV+ELFADVVP+TAENFRALCTGEKG+G STGKPLHYK
Sbjct  1    MTKKKNPLVFLDVSIDGDPVEKIVIELFADVVPKTAENFRALCTGEKGVGTSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNG---------------------------TGGESIYGGK  531
            G  FHRIIKGFMAQGGDFSKGNG                           TGGESIYGGK
Sbjct  61   GSFFHRIIKGFMAQGGDFSKGNGMCFLFPSSIASVDAYSLFDLYLNAQTCTGGESIYGGK  120

Query  532  FADENFKLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD  654
            FADENFK  H  PG LSMANSGPNTNGSQFF+TFKRQPHLD
Sbjct  121  FADENFKRAHEGPGFLSMANSGPNTNGSQFFMTFKRQPHLD  161



>ref|XP_010249988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X2 [Nelumbo nucifera]
Length=806

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + K+KNPLVF DVS DG P ++++ ELF DVVPRTAENFRALCTGEKGIG +TGK LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPAEKMIFELFHDVVPRTAENFRALCTGEKGIGSTTGKHLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRII+GFMAQGGDFS+G+GTGGESIYGGKFADE+FKL+H  PGLLSMAN+G NTNG
Sbjct  61   GSFFHRIIRGFMAQGGDFSRGDGTGGESIYGGKFADESFKLNHDGPGLLSMANAGSNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK  PHLD
Sbjct  121  SQFFITFKATPHLD  134



>ref|XP_010249986.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010249987.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform 
X1 [Nelumbo nucifera]
Length=807

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + K+KNPLVF DVS DG P ++++ ELF DVVPRTAENFRALCTGEKGIG +TGK LHYK
Sbjct  1    MTKRKNPLVFLDVSIDGDPAEKMIFELFHDVVPRTAENFRALCTGEKGIGSTTGKHLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRII+GFMAQGGDFS+G+GTGGESIYGGKFADE+FKL+H  PGLLSMAN+G NTNG
Sbjct  61   GSFFHRIIRGFMAQGGDFSRGDGTGGESIYGGKFADESFKLNHDGPGLLSMANAGSNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK  PHLD
Sbjct  121  SQFFITFKATPHLD  134



>ref|XP_010512756.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Camelina 
sativa]
Length=658

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = +1

Query  220  PVTPVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGI  399
            P   +      + K KNPLVF DVS    PVQRIV+ELFADVVP+TAENFRALCTGE G+
Sbjct  64   PARSLDPLRVAMTKNKNPLVFLDVSIGEDPVQRIVIELFADVVPKTAENFRALCTGEAGV  123

Query  400  GDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLL  579
            G +T KPLH+KG  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF+LDH   G+L
Sbjct  124  GKTTAKPLHFKGSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVL  183

Query  580  SMANSGPNTNGSQFFITFKRQPHLD  654
            SMAN GPNTNGSQFFI FKRQPHLD
Sbjct  184  SMANCGPNTNGSQFFILFKRQPHLD  208



>ref|XP_010468852.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP63-like [Camelina sativa]
Length=591

 Score =   225 bits (574),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS    PV+RIV+ELFADVVP+TAENFRALCTGE G+G +T KPLH+K
Sbjct  1    MTKKKNPFVFLDVSIGEDPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF+LDH   G+LSMAN GPNTNG
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FKRQPHLD
Sbjct  121  SQFFILFKRQPHLD  134



>emb|CDY53714.1| BnaAnng12550D [Brassica napus]
Length=556

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            KKKNP VF DVS  G P++RIV+ELFA +VP+TAENFRALCTGE G+G +T KPLH+KG 
Sbjct  5    KKKNPTVFLDVSIGGDPLERIVIELFAHLVPKTAENFRALCTGEAGLGKTTSKPLHFKGS  64

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHR+IKGFMAQGGDFS GNGTGGESIYGGKF DENF+LDH E G+LSMAN GPNTNGSQ
Sbjct  65   SFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFPDENFELDHEEGGVLSMANCGPNTNGSQ  124

Query  619  FFITFKRQPHLD  654
            FFI FKRQPHLD
Sbjct  125  FFILFKRQPHLD  136



>ref|XP_009138664.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 [Brassica 
rapa]
Length=556

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            KKKNP VF DVS  G P++RIV+ELFA +VP+TAENFRALCTGE G+G +T KPLH+KG 
Sbjct  5    KKKNPTVFLDVSIGGDPLERIVIELFAHLVPKTAENFRALCTGEAGLGKTTSKPLHFKGS  64

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHR+IKGFMAQGGDFS GNGTGGESIYGGKF DENF+LDH E G+LSMAN GPNTNGSQ
Sbjct  65   SFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFPDENFELDHEEGGVLSMANCGPNTNGSQ  124

Query  619  FFITFKRQPHLD  654
            FFI FKRQPHLD
Sbjct  125  FFILFKRQPHLD  136



>ref|XP_010274266.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Nelumbo nucifera]
Length=695

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            ++KK NPLVF D+S DG P +++V+ELFAD+VP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MVKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G IFHRIIKGFMAQGGDFS  NG GGESIYGGKFADENFK+ H  PGLLSMAN+G +TNG
Sbjct  61   GSIFHRIIKGFMAQGGDFSHRNGVGGESIYGGKFADENFKMLHDGPGLLSMANAGKDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK   HLD
Sbjct  121  SQFFITFKSARHLD  134



>ref|XP_010274267.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X3 [Nelumbo nucifera]
Length=693

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            ++KK NPLVF D+S DG P +++V+ELFAD+VP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MVKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G IFHRIIKGFMAQGGDFS  NG GGESIYGGKFADENFK+ H  PGLLSMAN+G +TNG
Sbjct  61   GSIFHRIIKGFMAQGGDFSHRNGVGGESIYGGKFADENFKMLHDGPGLLSMANAGKDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK   HLD
Sbjct  121  SQFFITFKSARHLD  134



>ref|XP_010274268.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X4 [Nelumbo nucifera]
Length=691

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            ++KK NPLVF D+S DG P +++V+ELFAD+VP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MVKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G IFHRIIKGFMAQGGDFS  NG GGESIYGGKFADENFK+ H  PGLLSMAN+G +TNG
Sbjct  61   GSIFHRIIKGFMAQGGDFSHRNGVGGESIYGGKFADENFKMLHDGPGLLSMANAGKDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK   HLD
Sbjct  121  SQFFITFKSARHLD  134



>ref|XP_010274264.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
 ref|XP_010274265.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Nelumbo nucifera]
Length=696

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            ++KK NPLVF D+S DG P +++V+ELFAD+VP+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MVKKMNPLVFLDISIDGNPAEKVVIELFADIVPKTAENFRALCTGEKGIGASTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G IFHRIIKGFMAQGGDFS  NG GGESIYGGKFADENFK+ H  PGLLSMAN+G +TNG
Sbjct  61   GSIFHRIIKGFMAQGGDFSHRNGVGGESIYGGKFADENFKMLHDGPGLLSMANAGKDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK   HLD
Sbjct  121  SQFFITFKSARHLD  134



>ref|XP_011026088.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Populus 
euphratica]
Length=694

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNPLVF DVS DG P   I +ELFADVVP+TAENFRALCTGEKGIG +TGKPL YK
Sbjct  1    MSKKKNPLVFLDVSIDGDPAASIFIELFADVVPKTAENFRALCTGEKGIGKTTGKPLRYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            GC FHRIIKGFMAQGGDFSKGNG+GGESIYGGKFADENF L H   GLLSMANSGP+TNG
Sbjct  61   GCSFHRIIKGFMAQGGDFSKGNGSGGESIYGGKFADENFILRHEGAGLLSMANSGPDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FK Q HLD
Sbjct  121  SQFFIIFKPQAHLD  134



>ref|XP_011458604.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
CYP63 [Fragaria vesca subsp. vesca]
Length=652

 Score =   223 bits (568),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KK NP VF DVS +  P +RIV+ELFADV P+TAENFRALCTGEKGIG STGKPLHYK
Sbjct  1    MSKKANPCVFLDVSINEAPTERIVIELFADVAPKTAENFRALCTGEKGIGKSTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFS GNGTGGESIYGGKFADE FKL H + GLLSMAN+GPNTNG
Sbjct  61   GSQFHRIIKGFMAQGGDFSAGNGTGGESIYGGKFADEAFKLKHDKLGLLSMANAGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI F   PHLD
Sbjct  121  SQFFIIFNPTPHLD  134



>ref|XP_010679140.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=658

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PVQRIV+ELFADVVP+TAENFR LCTG KG+G +TGKPLH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKG+GTGGESIYGGKFADENFKL+H+  G LSMAN G +TNG
Sbjct  61   GTNFHRIIKGFMAQGGDFSKGDGTGGESIYGGKFADENFKLEHTGTGFLSMANCGRDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKR PHLD
Sbjct  121  SQFFITFKRTPHLD  134



>ref|XP_010679138.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=659

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PVQRIV+ELFADVVP+TAENFR LCTG KG+G +TGKPLH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKG+GTGGESIYGGKFADENFKL+H+  G LSMAN G +TNG
Sbjct  61   GTNFHRIIKGFMAQGGDFSKGDGTGGESIYGGKFADENFKLEHTGTGFLSMANCGRDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKR PHLD
Sbjct  121  SQFFITFKRTPHLD  134



>ref|XP_010679137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=661

 Score =   223 bits (567),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP VF DVS  G PVQRIV+ELFADVVP+TAENFR LCTG KG+G +TGKPLH+K
Sbjct  1    MSKKKNPHVFLDVSIGGDPVQRIVIELFADVVPKTAENFRVLCTGGKGVGATTGKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRIIKGFMAQGGDFSKG+GTGGESIYGGKFADENFKL+H+  G LSMAN G +TNG
Sbjct  61   GTNFHRIIKGFMAQGGDFSKGDGTGGESIYGGKFADENFKLEHTGTGFLSMANCGRDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFKR PHLD
Sbjct  121  SQFFITFKRTPHLD  134



>ref|XP_010413155.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Camelina sativa]
Length=590

 Score =   221 bits (562),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + K KNP VF DVS   GPV+RIV+ELFADVVP+TAENFRALCTGE G+G +T KPLH+K
Sbjct  1    MTKNKNPFVFLDVSIGDGPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF+LDH   G+LSMAN GPNTNG
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FK Q HLD
Sbjct  121  SQFFILFKSQSHLD  134



>ref|XP_010413154.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Camelina sativa]
Length=596

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + K KNP VF DVS   GPV+RIV+ELFADVVP+TAENFRALCTGE G+G +T KPLH+K
Sbjct  1    MTKNKNPFVFLDVSIGDGPVERIVIELFADVVPKTAENFRALCTGEAGVGKTTAKPLHFK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHR+IKGFMAQGGDFS GNGTGGESIYGGKF+DENF+LDH   G+LSMAN GPNTNG
Sbjct  61   GSSFHRVIKGFMAQGGDFSNGNGTGGESIYGGKFSDENFRLDHDGAGVLSMANCGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFI FK Q HLD
Sbjct  121  SQFFILFKSQSHLD  134



>ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
 ref|XP_010925252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Elaeis 
guineensis]
Length=842

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 115/134 (86%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + K KNP VF DV+  GGP +R+V ELFAD+VP+TAENFRALCTGEKG+G +TGKPLHY+
Sbjct  1    MAKTKNPTVFLDVAIGGGPAERMVFELFADIVPKTAENFRALCTGEKGVGSTTGKPLHYR  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G IFHRIIKGFMAQGGDFSK +GTGGESIYGGKF DENF L H  PGLLSMAN+G +TNG
Sbjct  61   GSIFHRIIKGFMAQGGDFSKRDGTGGESIYGGKFPDENFILRHDGPGLLSMANAGRDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK  PHLD
Sbjct  121  SQFFITFKAAPHLD  134



>ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=818

 Score =   219 bits (558),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K KNP VF DV+   GP +R+V ELFAD+VP+TAENFRALCTGEKG+G STGKPLHY+G 
Sbjct  3    KTKNPTVFLDVAIGRGPAERMVFELFADIVPKTAENFRALCTGEKGVGPSTGKPLHYRGS  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
            IFHRIIKGFMAQGGDF+K +GTGGESIYGGKF DENF L H  PGLLSMAN+G +TNGSQ
Sbjct  63   IFHRIIKGFMAQGGDFAKRDGTGGESIYGGKFPDENFVLRHDGPGLLSMANAGRDTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  123  FFITFKAAPHLD  134



>ref|XP_006838913.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
 gb|ERN01482.1| hypothetical protein AMTR_s00002p00269760 [Amborella trichopoda]
Length=795

 Score =   217 bits (553),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKN LVF DVS  G P  ++V ELF+DVVP+TAENFRALCTGEKGIG  TGKPLHYK
Sbjct  1    MAKKKNSLVFLDVSIGGDPAGKMVFELFSDVVPKTAENFRALCTGEKGIGQVTGKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G IFHRIIKGFMAQGGDFS+ +GTGGESIYGGKF DENFKL H  PG+LSMAN+GP+TNG
Sbjct  61   GSIFHRIIKGFMAQGGDFSRKDGTGGESIYGGKFVDENFKLHHDGPGVLSMANAGPDTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK   HLD
Sbjct  121  SQFFITFKSTGHLD  134



>ref|XP_001780456.1| predicted protein [Physcomitrella patens]
 gb|EDQ54746.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VF D++  GGP  +++MEL+ADVVP+TAENFRALCTGEKG+G  T KPLH K  IFH
Sbjct  7    NPRVFLDITIGGGPAGKMIMELYADVVPKTAENFRALCTGEKGLGRMTKKPLHLKDTIFH  66

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RII GFMAQGGDFSK +GTGGESIYGGKF DENFKL H   G+LSMAN+GPNTNGSQFF+
Sbjct  67   RIIPGFMAQGGDFSKRDGTGGESIYGGKFDDENFKLGHDGAGILSMANAGPNTNGSQFFL  126

Query  628  TFKRQPHLD  654
            TFK QPHL+
Sbjct  127  TFKSQPHLN  135



>ref|XP_008792090.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008792091.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Phoenix dactylifera]
Length=845

 Score =   216 bits (551),  Expect = 1e-61, Method: Composition-based stats.
 Identities = 104/132 (79%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K KNP VF DV+  GGP +R+V ELFAD+VP+TAENFRALCTGEKGIG +T KPLHYKG 
Sbjct  3    KTKNPTVFLDVAIGGGPSRRMVFELFADIVPKTAENFRALCTGEKGIGPTTRKPLHYKGS  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
            IFHRIIKGFMAQGGDFSK +GTGGESIYGGKF DENF L H  PGLLSMAN+G +TNGSQ
Sbjct  63   IFHRIIKGFMAQGGDFSKRDGTGGESIYGGKFPDENFLLRHDGPGLLSMANAGRDTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  123  FFITFKAAPHLD  134



>ref|XP_009388658.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388659.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009388660.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=814

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            KKNP+VF DVS DG   +R+V ELFAD+VP+TAENFRALCTGE G G  T KPLHYKG I
Sbjct  6    KKNPIVFLDVSVDGNAARRMVFELFADIVPKTAENFRALCTGEIGFGLMTRKPLHYKGSI  65

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
            FHRIIKGFMAQGGDFS+ NGTGGESIYGGKFADENF L+H  PGLL+MAN+G +TNGSQF
Sbjct  66   FHRIIKGFMAQGGDFSRHNGTGGESIYGGKFADENFMLNHDGPGLLAMANAGRDTNGSQF  125

Query  622  FITFKRQPHLD  654
            FITFK  PHLD
Sbjct  126  FITFKAAPHLD  136



>ref|XP_001633810.1| predicted protein [Nematostella vectensis]
 gb|EDO41747.1| predicted protein [Nematostella vectensis]
Length=370

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/132 (77%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            KK NP  FFDV+  G  V R++ ELFAD VP+TAENFRALCTGEKGIG STGKPLHYKGC
Sbjct  12   KKPNPRCFFDVTIGGEKVGRVLFELFADKVPKTAENFRALCTGEKGIGPSTGKPLHYKGC  71

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIK FM QGGDFS  NGTGGESIYG KFADE+F   H +PGLLSMANSGPNTNGSQ
Sbjct  72   PFHRIIKDFMVQGGDFSNKNGTGGESIYGEKFADEDFTYKHDKPGLLSMANSGPNTNGSQ  131

Query  619  FFITFKRQPHLD  654
            FFIT    PHLD
Sbjct  132  FFITTVPTPHLD  143



>tpg|DAA59762.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
Length=340

 Score =   206 bits (524),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K KNP VF D+S  GG  +RI  ELFA+VVP+TAENFRALCTGE+G+G ST KPL+YKG 
Sbjct  3    KVKNPHVFMDISIGGGSAERITFELFANVVPKTAENFRALCTGERGLGASTQKPLYYKGT  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
              HRI+KGF+AQGGDFS G+G GGESIYGGKF DENFKL H++PG+LSMANSGP TNGSQ
Sbjct  63   YIHRIVKGFVAQGGDFSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  123  FFITFKALPHLD  134



>tpg|DAA42557.1| TPA: hypothetical protein ZEAMMB73_596682 [Zea mays]
Length=187

 Score =   201 bits (511),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K KNP VF D+S  GG  +RI  EL A+VVP+TAENFRALCTGE G+G ST KPL+YKG 
Sbjct  29   KVKNPHVFMDISISGGSAERITFELLANVVPKTAENFRALCTGESGLGASTQKPLYYKGT  88

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
              HRI+KGF+ QGGDFS+G+G GGESIYGGKF DENF+L H++PG+LSMANSGP+TNGSQ
Sbjct  89   HIHRIVKGFVVQGGDFSRGDGKGGESIYGGKFPDENFRLLHNQPGVLSMANSGPDTNGSQ  148

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  149  FFITFKALPHLD  160



>ref|XP_010772716.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Notothenia 
coriiceps]
Length=179

 Score =   200 bits (509),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +1

Query  250  KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHY  429
            K    +NP VFFDV   G    R+V+ELFAD+VP+TAENFRALCTGEKGIG STGKPLH+
Sbjct  9    KPANSENPRVFFDVDIGGERAGRLVLELFADIVPKTAENFRALCTGEKGIGKSTGKPLHF  68

Query  430  KGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTN  609
            KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H +PGLLSMANSGP+TN
Sbjct  69   KGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYIHDKPGLLSMANSGPDTN  128

Query  610  GSQFFITFKRQPHLD  654
            GSQFFIT    PHLD
Sbjct  129  GSQFFITTVATPHLD  143



>ref|XP_003221776.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Anolis carolinensis]
Length=370

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VF DV   GG   RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFLDVDIGGGRAGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H +PGLLSMAN+GPNTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDQPGLLSMANAGPNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_011077231.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3 [Sesamum 
indicum]
Length=173

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFD+        R+VMELFAD  P+TAENFRALCTGEKGIG S+GKPLHYKG  F
Sbjct  2    KNPKVFFDILIGKAKAGRVVMELFADTTPKTAENFRALCTGEKGIG-SSGKPLHYKGSKF  60

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRII  FM QGGDF+KGNGTGGESIYG KFADENFKL H+EPGLLSMAN+GPNTNGSQFF
Sbjct  61   HRIIPNFMCQGGDFTKGNGTGGESIYGAKFADENFKLKHTEPGLLSMANAGPNTNGSQFF  120

Query  625  ITFKRQPHLD  654
            IT  +   LD
Sbjct  121  ITTVKTSWLD  130



>ref|XP_008286043.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Stegastes partitus]
Length=370

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            +NP VFFDV  DG    RIV+ELFAD+ P+TAENFRALCTGEKGIG STGKPLH+KGC F
Sbjct  14   ENPRVFFDVDVDGERAGRIVLELFADITPKTAENFRALCTGEKGIGKSTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H  P LLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYKHDRPALLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009419290.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=819

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  256  MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKG  435
            M K+NP+VF DV+ DG    R++ ELFAD+VP+TAENFRALCTGE G G  T KPLHYKG
Sbjct  1    MAKRNPIVFLDVAIDGNAAGRLMFELFADIVPKTAENFRALCTGEMGFGPMTKKPLHYKG  60

Query  436  CIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGS  615
             IFHRIIKGFMAQGGDFS+ +GTGGESIYGGKFADENF L+H  PGLLSMAN+G +TNGS
Sbjct  61   SIFHRIIKGFMAQGGDFSRRDGTGGESIYGGKFADENFVLNHDGPGLLSMANAGRDTNGS  120

Query  616  QFFITFKRQPHLD  654
            QFFITFK  PHLD
Sbjct  121  QFFITFKPAPHLD  133



>ref|XP_008785095.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Phoenix dactylifera]
Length=173

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 109/130 (84%), Gaps = 1/130 (1%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
             NP+V+ DV+ +G P  RIV+ELFADV P+TAENFRALCTGEKG+G S GKPLHYKGC F
Sbjct  3    SNPMVYLDVTINGVPAGRIVIELFADVTPKTAENFRALCTGEKGLGRS-GKPLHYKGCPF  61

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HR+I GF++QGGDF+ GNGTGGESIYGGKFADENF   H+ PG++SMANSGPNTNGSQFF
Sbjct  62   HRVIPGFVSQGGDFTAGNGTGGESIYGGKFADENFVKKHTGPGVVSMANSGPNTNGSQFF  121

Query  625  ITFKRQPHLD  654
            I   + P LD
Sbjct  122  ICTTKTPWLD  131



>ref|XP_005299363.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Chrysemys 
picta bellii]
Length=364

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFADVVP+TAENFRALCTGEKGIG +TGKPLHYKGC FH
Sbjct  9    NPRVFFDVDIGGERVGRIVLELFADVVPKTAENFRALCTGEKGIGPTTGKPLHYKGCPFH  68

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFFI
Sbjct  69   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDRAGLLSMANAGPNTNGSQFFI  128

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  129  TTVPTPHLD  137



>ref|XP_006661010.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like isoform 
X1 [Oryza brachyantha]
 ref|XP_006661011.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like isoform 
X2 [Oryza brachyantha]
Length=190

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  256  MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKG  435
            M  KNP VFFD+        R+VMELFAD VPRTAENFR LCTGEKG+G S+GKPLHYKG
Sbjct  12   MAAKNPKVFFDILIGRSKAGRVVMELFADTVPRTAENFRCLCTGEKGLG-SSGKPLHYKG  70

Query  436  CIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGS  615
              FHRII  FM QGGDF++GNGTGGESIYG KFADENFKL H+ PG+LSMAN+GPNTNGS
Sbjct  71   SAFHRIIPNFMCQGGDFTRGNGTGGESIYGAKFADENFKLRHTGPGVLSMANAGPNTNGS  130

Query  616  QFFITFKRQPHLD  654
            QFFI  K  P LD
Sbjct  131  QFFICTKPTPWLD  143



>ref|XP_007071343.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Chelonia mydas]
Length=364

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFADVVP+TAENFRALCTGEKGIG +TGKPLHYKGC FH
Sbjct  9    NPRVFFDVDVGGERVGRIVLELFADVVPKTAENFRALCTGEKGIGPTTGKPLHYKGCPFH  68

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFFI
Sbjct  69   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDRAGLLSMANAGPNTNGSQFFI  128

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  129  TTVPTPHLD  137



>ref|NP_001232291.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
 gb|ACH46307.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=206

 Score =   199 bits (506),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K  NP  FFDV   G  V RIV ELFADVVP+TAENFRALCTGEKG G +TGKPLHYKGC
Sbjct  12   KASNPRAFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGC  71

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H +PGLLSMAN+GP TNGSQ
Sbjct  72   PFHRIIKQFMVQGGDFSNQNGTGGESIYGEKFEDENFHYQHDKPGLLSMANAGPGTNGSQ  131

Query  619  FFITFKRQPHLD  654
            FFIT    PHLD
Sbjct  132  FFITTVPTPHLD  143



>gb|KJB80893.1| hypothetical protein B456_013G120200 [Gossypium raimondii]
Length=186

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 109/141 (77%), Gaps = 4/141 (3%)
 Frame = +1

Query  241  FEWKV---MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDST  411
            FEW V    K  NP VFFD+        R+VMELFADVVP+TAENFRALCTGEKG+G   
Sbjct  3    FEWCVNWVSKMSNPKVFFDILIGKAKAGRVVMELFADVVPKTAENFRALCTGEKGVGQC-  61

Query  412  GKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMAN  591
            GKPLHYKG  FHRII  FM QGGDF++GNGTGGESIYG KFADENFKL H+ PG LSMAN
Sbjct  62   GKPLHYKGSAFHRIIPSFMCQGGDFTRGNGTGGESIYGMKFADENFKLKHTGPGCLSMAN  121

Query  592  SGPNTNGSQFFITFKRQPHLD  654
            +GPNTNGSQFFI  ++ P LD
Sbjct  122  AGPNTNGSQFFICTEKTPWLD  142



>ref|XP_001761081.1| predicted protein [Physcomitrella patens]
 gb|EDQ74148.1| predicted protein [Physcomitrella patens]
Length=371

 Score =   203 bits (517),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +1

Query  244  EWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPL  423
            E   M+ +NP VFFD+S  G    RIV ELFADVVP+TAENFRALCTGEKGIG  +G+PL
Sbjct  4    ETAAMESRNPKVFFDISIGGDMEGRIVFELFADVVPKTAENFRALCTGEKGIGKISGRPL  63

Query  424  HYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPN  603
            HYKG +FHR+IKGFM QGGDF   NGTGGESIYG  F DENF++ H   G+LSMAN+GPN
Sbjct  64   HYKGAVFHRVIKGFMIQGGDFENANGTGGESIYGKTFDDENFQMKHERKGMLSMANAGPN  123

Query  604  TNGSQFFITFKRQPHLD  654
            TNGSQFFI   R PHLD
Sbjct  124  TNGSQFFIITNRTPHLD  140



>ref|XP_009399355.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=691

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            KKNP VF D+S D  P +R+ +ELFADVVP+TAENFRALCTGEKGIGDST  PLHYKG  
Sbjct  4    KKNPTVFLDISVDRNPAERMEIELFADVVPKTAENFRALCTGEKGIGDSTRLPLHYKGSF  63

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
            FHRI+KGF+AQGGDFS+ +G+GGESIYG KF DENFKL H  PGLLSMA+S PN+NGSQF
Sbjct  64   FHRIVKGFVAQGGDFSRRDGSGGESIYGRKFPDENFKLKHDGPGLLSMASSAPNSNGSQF  123

Query  622  FITFKRQPHLD  654
            FITFK  P LD
Sbjct  124  FITFKATPQLD  134



>ref|XP_009399354.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=694

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            KKNP VF D+S D  P +R+ +ELFADVVP+TAENFRALCTGEKGIGDST  PLHYKG  
Sbjct  4    KKNPTVFLDISVDRNPAERMEIELFADVVPKTAENFRALCTGEKGIGDSTRLPLHYKGSF  63

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
            FHRI+KGF+AQGGDFS+ +G+GGESIYG KF DENFKL H  PGLLSMA+S PN+NGSQF
Sbjct  64   FHRIVKGFVAQGGDFSRRDGSGGESIYGRKFPDENFKLKHDGPGLLSMASSAPNSNGSQF  123

Query  622  FITFKRQPHLD  654
            FITFK  P LD
Sbjct  124  FITFKATPQLD  134



>ref|XP_006867984.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Chrysochloris 
asiatica]
Length=370

 Score =   203 bits (517),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGEQVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPNTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDQEGLLSMANAGPNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_001760224.1| predicted protein [Physcomitrella patens]
 gb|EDQ74980.1| predicted protein [Physcomitrella patens]
Length=201

 Score =   198 bits (503),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K  NP VFFDV+  G P  +IVMEL+ DV P+TAENFRALCTGEKG+G  T KPLH+K  
Sbjct  4    KTSNPRVFFDVTIGGNPAGKIVMELYTDV-PKTAENFRALCTGEKGLGRITKKPLHFKDT  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
            IFHRII GFMAQGGDFSK +GTGGESIYGGKFADENFK  H   G+LSMAN+GPNTNGSQ
Sbjct  63   IFHRIIPGFMAQGGDFSKRDGTGGESIYGGKFADENFKYGHDGAGILSMANAGPNTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FF+TFK QPHL+
Sbjct  123  FFLTFKSQPHLN  134



>ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like isoform 
X1 [Elaeis guineensis]
Length=836

 Score =   211 bits (537),  Expect = 9e-60, Method: Composition-based stats.
 Identities = 102/132 (77%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K K P VF DV+  G P  R+V ELFAD+VP+TAENFRALCTGEKGIG +TGKPLHY+G 
Sbjct  3    KTKRPTVFLDVAIGGRPSGRMVFELFADIVPKTAENFRALCTGEKGIGHTTGKPLHYRGS  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
            IFHRIIKGFMAQGGDFSK +GTGGESIYGGKF DENF L H  PGLLSMAN+G +TNGSQ
Sbjct  63   IFHRIIKGFMAQGGDFSKRDGTGGESIYGGKFPDENFVLRHDGPGLLSMANAGRDTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  123  FFITFKAAPHLD  134



>tpg|DAA42555.1| TPA: hypothetical protein ZEAMMB73_596682, partial [Zea mays]
Length=313

 Score =   201 bits (512),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K KNP VF D+S  GG  +RI  EL A+VVP+TAENFRALCTGE G+G ST KPL+YKG 
Sbjct  3    KVKNPHVFMDISISGGSAERITFELLANVVPKTAENFRALCTGESGLGASTQKPLYYKGT  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
              HRI+KGF+ QGGDFS+G+G GGESIYGGKF DENF+L H++PG+LSMANSGP+TNGSQ
Sbjct  63   HIHRIVKGFVVQGGDFSRGDGKGGESIYGGKFPDENFRLLHNQPGVLSMANSGPDTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  123  FFITFKALPHLD  134



>ref|XP_006121931.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Pelodiscus 
sinensis]
Length=364

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            +P VFFDV   G  V RIV+ELFADVVP+TAENFRALCTGEKGIG +TGKPLHYKGC FH
Sbjct  9    SPRVFFDVDIGGERVGRIVLELFADVVPKTAENFRALCTGEKGIGPTTGKPLHYKGCHFH  68

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFFI
Sbjct  69   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDRAGLLSMANAGPNTNGSQFFI  128

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  129  TTVPTPHLD  137



>ref|XP_004382106.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Trichechus 
manatus latirostris]
Length=370

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDLGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPNTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGPNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>dbj|BAE29632.1| unnamed protein product [Mus musculus]
 dbj|BAE30104.1| unnamed protein product [Mus musculus]
Length=370

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_003324829.1| hypothetical protein PGTG_06366 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
 gb|EFP80410.1| hypothetical protein PGTG_06366 [Puccinia graminis f. sp. tritici 
CRL 75-36-700-3]
Length=445

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +1

Query  214  RVPVTPVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEK  393
            ++PV    LF+      + P VFFD++ D   V RIV ELF D+VPRTAENFRALCTGEK
Sbjct  34   QLPVPSELLFKPASAGHQRPKVFFDITIDSNSVGRIVFELFDDIVPRTAENFRALCTGEK  93

Query  394  GIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPG  573
            G+  S+GKPL YKG  FHR+IK FM QGGDF+ GNGTGGESIYG KF DENF+L HS+P 
Sbjct  94   GVSQSSGKPLSYKGSTFHRVIKSFMCQGGDFTAGNGTGGESIYGDKFEDENFELKHSKPF  153

Query  574  LLSMANSGPNTNGSQFFITFKRQPHLD  654
            LLSMAN+GPNTNGSQFFIT    PHLD
Sbjct  154  LLSMANAGPNTNGSQFFITTVHTPHLD  180



>ref|XP_007436535.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Python bivittatus]
Length=370

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+T ENFRALCTGEKGIG +TGKPLHYKGC FH
Sbjct  15   NPRVFFDVDVGGERVGRIVLELFADIVPKTVENFRALCTGEKGIGPTTGKPLHYKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H +PGLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSHQNGTGGESIYGEKFEDENFHYKHDKPGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|NP_080628.1| peptidyl-prolyl cis-trans isomerase D [Mus musculus]
 sp|Q9CR16.3|PPID_MOUSE RecName: Full=Peptidyl-prolyl cis-trans isomerase D; Short=PPIase 
D; AltName: Full=40 kDa peptidyl-prolyl cis-trans isomerase; 
AltName: Full=Cyclophilin-40; Short=CYP-40; AltName: Full=Rotamase 
D [Mus musculus]
 dbj|BAB22767.1| unnamed protein product [Mus musculus]
 dbj|BAB29056.1| unnamed protein product [Mus musculus]
 gb|AAH11499.1| Peptidylprolyl isomerase D (cyclophilin D) [Mus musculus]
 gb|AAH19778.1| Peptidylprolyl isomerase D (cyclophilin D) [Mus musculus]
 dbj|BAC34686.1| unnamed protein product [Mus musculus]
Length=370

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>gb|EMP24944.1| Peptidyl-prolyl cis-trans isomerase D [Chelonia mydas]
Length=364

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFADVVP+TAENFRALCTGEKGIG +TGKPLHYKGC FH
Sbjct  9    NPRVFFDVDVGGERVGRIVLELFADVVPKTAENFRALCTGEKGIGPTTGKPLHYKGCPFH  68

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFFI
Sbjct  69   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDRAGLLSMANAGPNTNGSQFFI  128

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  129  TTVPTPHLD  137



>gb|KJB80890.1| hypothetical protein B456_013G120200 [Gossypium raimondii]
Length=183

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = +1

Query  247  WKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLH  426
            W V K  NP VFFD+        R+VMELFADVVP+TAENFRALCTGEKG+G   GKPLH
Sbjct  6    W-VSKMSNPKVFFDILIGKAKAGRVVMELFADVVPKTAENFRALCTGEKGVGQC-GKPLH  63

Query  427  YKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNT  606
            YKG  FHRII  FM QGGDF++GNGTGGESIYG KFADENFKL H+ PG LSMAN+GPNT
Sbjct  64   YKGSAFHRIIPSFMCQGGDFTRGNGTGGESIYGMKFADENFKLKHTGPGCLSMANAGPNT  123

Query  607  NGSQFFITFKRQPHLD  654
            NGSQFFI  ++ P LD
Sbjct  124  NGSQFFICTEKTPWLD  139



>gb|KJB80891.1| hypothetical protein B456_013G120200 [Gossypium raimondii]
Length=184

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = +1

Query  247  WKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLH  426
            W V K  NP VFFD+        R+VMELFADVVP+TAENFRALCTGEKG+G   GKPLH
Sbjct  7    W-VSKMSNPKVFFDILIGKAKAGRVVMELFADVVPKTAENFRALCTGEKGVGQC-GKPLH  64

Query  427  YKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNT  606
            YKG  FHRII  FM QGGDF++GNGTGGESIYG KFADENFKL H+ PG LSMAN+GPNT
Sbjct  65   YKGSAFHRIIPSFMCQGGDFTRGNGTGGESIYGMKFADENFKLKHTGPGCLSMANAGPNT  124

Query  607  NGSQFFITFKRQPHLD  654
            NGSQFFI  ++ P LD
Sbjct  125  NGSQFFICTEKTPWLD  140



>ref|XP_006629535.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Lepisosteus 
oculatus]
Length=371

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = +1

Query  250  KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHY  429
            K M   NP  FFDV   G  V RIVMELFADVVP+TAENFRALCTGEKGIG +TGKPLH+
Sbjct  9    KPMNPDNPRAFFDVDVGGERVGRIVMELFADVVPKTAENFRALCTGEKGIGATTGKPLHF  68

Query  430  KGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTN  609
            KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPNTN
Sbjct  69   KGCPFHRIIKKFMVQGGDFSNQNGTGGESIYGAKFEDENFHYKHDKEGLLSMANAGPNTN  128

Query  610  GSQFFITFKRQPHLD  654
            GSQFFIT     HLD
Sbjct  129  GSQFFITTVPTEHLD  143



>ref|XP_006981152.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Peromyscus 
maniculatus bairdii]
Length=370

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>emb|CDK25020.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=363

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +1

Query  256  MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKG  435
            M +  P VFFDVS  G P +RIV ELFADVVP+TAENFRALCTGEKG+G S GKPLHYKG
Sbjct  1    MSEVRPRVFFDVSIGGEPTRRIVFELFADVVPKTAENFRALCTGEKGVGQS-GKPLHYKG  59

Query  436  CIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGS  615
             IFHR+I+ FM QGGDF+ G+G GGESIYG KF DENF+L H +P LLSMAN+GPNTNGS
Sbjct  60   SIFHRVIESFMCQGGDFTLGDGRGGESIYGEKFEDENFQLKHDKPFLLSMANAGPNTNGS  119

Query  616  QFFITFKRQPHLD  654
            QFFIT    PHLD
Sbjct  120  QFFITTVSTPHLD  132



>ref|WP_017297358.1| peptidylprolyl isomerase [Nodosilinea nodulosa]
Length=174

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + +  NP VFFD++  G PV RIVMEL ADV P+TAENFRALCTGEKG+G + GKPLH+K
Sbjct  1    MTEATNPRVFFDITIGGTPVGRIVMELRADVAPKTAENFRALCTGEKGMG-TAGKPLHFK  59

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G  FHRII  FM QGGDF++GNGTGGESIYG KFADENF L H+ PGLLSMAN+GPNTNG
Sbjct  60   GSSFHRIIPEFMCQGGDFTRGNGTGGESIYGMKFADENFTLKHTTPGLLSMANAGPNTNG  119

Query  613  SQFFITFKRQPHLD  654
            SQFF+T    P LD
Sbjct  120  SQFFLTTVATPWLD  133



>ref|XP_008852547.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Nannospalax 
galili]
Length=370

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDRDGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_004394281.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Odobenus rosmarus 
divergens]
Length=370

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T  R PHLD
Sbjct  135  TTVRTPHLD  143



>ref|XP_007624483.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
D-like [Cricetulus griseus]
Length=370

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITIVPTPHLD  143



>ref|XP_003504914.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1, 
partial [Cricetulus griseus]
Length=267

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>gb|EGW00520.1| 40 kDa peptidyl-prolyl cis-trans isomerase [Cricetulus griseus]
Length=220

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>gb|AAH14893.1| PPID protein, partial [Homo sapiens]
Length=156

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  244  EWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPL  423
            + K     NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPL
Sbjct  7    QAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPL  66

Query  424  HYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPN  603
            H+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G N
Sbjct  67   HFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRN  126

Query  604  TNGSQFFITFKRQPHLD  654
            TNGSQFFIT    PHLD
Sbjct  127  TNGSQFFITTVPTPHLD  143



>ref|XP_009049213.1| hypothetical protein LOTGIDRAFT_112989 [Lottia gigantea]
 gb|ESP00022.1| hypothetical protein LOTGIDRAFT_112989 [Lottia gigantea]
Length=364

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 106/133 (80%), Gaps = 1/133 (1%)
 Frame = +1

Query  256  MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKG  435
            M  +NP VFFDV   G  V RI+ ELF D+VP+TAENFRALCTGEKG+G S GKPLHYKG
Sbjct  1    MASENPKVFFDVDIGGEKVGRILFELFKDIVPKTAENFRALCTGEKGVGQS-GKPLHYKG  59

Query  436  CIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGS  615
            C FHRIIK FM QGGDF+ G+GTGGESIYG KF DENFK  H  PGLLSMAN+GPNTNGS
Sbjct  60   CGFHRIIKDFMIQGGDFTAGDGTGGESIYGEKFEDENFKYKHERPGLLSMANAGPNTNGS  119

Query  616  QFFITFKRQPHLD  654
            QFFIT    PHLD
Sbjct  120  QFFITTVTTPHLD  132



>ref|XP_005344179.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Microtus ochrogaster]
Length=370

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGATTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_005919457.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Haplochromis 
burtoni]
Length=370

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            +NP VF DV  DG    RIV+ELFAD+ P+TAENFRALCTGEKG G STGKPLH+KGC F
Sbjct  14   ENPRVFLDVDIDGERAGRIVLELFADITPKTAENFRALCTGEKGTGKSTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   HS+ GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYKHSKVGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_008359381.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
B-like [Malus domestica]
Length=324

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/111 (85%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +1

Query  322  VMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNG  501
            ++ LFADVVP+TAENFRALCTGEKGIG STGKPLHYKG  FHR+IKGFMAQGGDFS GNG
Sbjct  43   ILXLFADVVPKTAENFRALCTGEKGIGKSTGKPLHYKGSTFHRVIKGFMAQGGDFSNGNG  102

Query  502  TGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD  654
            TGGESIYGGKFADE FKL H  PGLLSMAN+GPNTNGSQFFI F+ QPHLD
Sbjct  103  TGGESIYGGKFADEXFKLKHDGPGLLSMANAGPNTNGSQFFIIFRHQPHLD  153



>ref|NP_001004279.1| peptidyl-prolyl cis-trans isomerase D [Rattus norvegicus]
 sp|Q6DGG0.3|PPID_RAT RecName: Full=Peptidyl-prolyl cis-trans isomerase D; Short=PPIase 
D; AltName: Full=40 kDa peptidyl-prolyl cis-trans isomerase; 
AltName: Full=Cyclophilin-40; Short=CYP-40; AltName: Full=Rotamase 
D [Rattus norvegicus]
 gb|AAH76386.1| Peptidylprolyl isomerase D (cyclophilin D) [Rattus norvegicus]
Length=370

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_004708796.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Echinops telfairi]
Length=370

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH KGC FH
Sbjct  15   NPRVFFDVDIGGEQVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHLKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPNTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGPNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_005076198.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Mesocricetus 
auratus]
Length=370

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDVGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_005486377.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Zonotrichia 
albicollis]
Length=370

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K  NP  FFDV   G  V RIV ELFADVVP+TAENFRALCTGEKG G +TGKPLHYKGC
Sbjct  12   KASNPRAFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGC  71

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H +PGLLSMAN+GP TNGSQ
Sbjct  72   PFHRIIKEFMVQGGDFSNQNGTGGESIYGEKFEDENFHYQHDKPGLLSMANAGPGTNGSQ  131

Query  619  FFITFKRQPHLD  654
            FFIT    PHLD
Sbjct  132  FFITTVPTPHLD  143



>gb|ACH45652.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
 gb|ACH45653.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=370

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K  NP  FFDV   G  V RIV ELFADVVP+TAENFRALCTGEKG G +TGKPLHYKGC
Sbjct  12   KASNPRAFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGC  71

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H +PGLLSMAN+GP TNGSQ
Sbjct  72   PFHRIIKQFMVQGGDFSNQNGTGGESIYGEKFEDENFHYQHDKPGLLSMANAGPGTNGSQ  131

Query  619  FFITFKRQPHLD  654
            FFIT    PHLD
Sbjct  132  FFITTVPTPHLD  143



>gb|ERE90429.1| peptidyl-prolyl cis-trans isomerase D-like protein [Cricetulus 
griseus]
Length=370

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_007611328.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X2 [Cricetulus 
griseus]
Length=370

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_004685424.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Condylura cristata]
Length=370

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG STGKPL++KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPSTGKPLYFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+IK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPNTNGSQFFI
Sbjct  75   RVIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDQEGLLSMANAGPNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_003477039.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Cavia porcellus]
Length=370

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDVGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_004553696.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Maylandia 
zebra]
Length=369

 Score =   201 bits (511),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VF DV  DG    RIV+ELFAD+ P+TAENFRALCTGEKG G STGKPLH+KGC FH
Sbjct  15   NPRVFLDVDIDGERAGRIVLELFADITPKTAENFRALCTGEKGTGKSTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   HS+ GLLSMAN+GPNTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYKHSKVGLLSMANAGPNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>gb|AAP44536.1| cyclophilin-like protein [Triticum aestivum]
Length=636

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +1

Query  250  KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHY  429
            K  K  NP VF ++S DG P +RI  +LFADVVP+TAENFRALCTGEKG+G+ST KPL++
Sbjct  3    KFKKNLNPQVFLEISIDGRPAERITFQLFADVVPKTAENFRALCTGEKGLGESTKKPLYF  62

Query  430  KGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTN  609
            KG   HRII GFMAQ GDFS G+G GGESIYGGKF DENFKL H +PG+LSMANSG NTN
Sbjct  63   KGTHIHRIIPGFMAQAGDFSGGDGRGGESIYGGKFPDENFKLKHDQPGILSMANSGENTN  122

Query  610  GSQFFITFKRQPHLD  654
            GSQFFITFK  PHLD
Sbjct  123  GSQFFITFKAVPHLD  137



>dbj|GAM29016.1| hypothetical protein SAMD00019534_121920 [Acytostelium subglobosum 
LB1]
Length=171

 Score =   195 bits (495),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD+  +G  + RI+ EL ADVVP+TAENFR+LCTGEKG+G S GKPLHYKGC+FH
Sbjct  3    NPRVFFDIESNGKNLGRIIFELHADVVPKTAENFRSLCTGEKGVGKS-GKPLHYKGCVFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RII  FM QGGDF+KGNGTGGESIYG KF DENFKL H+ PGLLSMAN+GPNTNGSQFFI
Sbjct  62   RIIPNFMIQGGDFTKGNGTGGESIYGEKFNDENFKLRHTTPGLLSMANAGPNTNGSQFFI  121

Query  628  TFKRQPHLD  654
            T      LD
Sbjct  122  TTVECAWLD  130



>gb|EEC72707.1| hypothetical protein OsI_06299 [Oryza sativa Indica Group]
Length=787

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP+VF DVS    P +R+V ELFADV PRTAENFRALCTGE GIG ++ KPL+YK
Sbjct  1    MAKKKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G +FHR+IKGFMAQGGDFS G+G+GGESIYGG F DENF L H E GLLSMAN+GPNTNG
Sbjct  61   GSLFHRVIKGFMAQGGDFSNGDGSGGESIYGGTFEDENFVLRHDERGLLSMANAGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK    LD
Sbjct  121  SQFFITFKHNSRLD  134



>gb|EEE56526.1| hypothetical protein OsJ_05815 [Oryza sativa Japonica Group]
Length=670

 Score =   207 bits (528),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KKKNP+VF DVS    P +R+V ELFADV PRTAENFRALCTGE GIG ++ KPL+YK
Sbjct  1    MAKKKNPIVFMDVSIGDEPDERMVFELFADVAPRTAENFRALCTGEMGIGQTSKKPLYYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G +FHR+IKGFMAQGGDFS G+G+GGESIYGG F DENF L H E GLLSMAN+GPNTNG
Sbjct  61   GSLFHRVIKGFMAQGGDFSNGDGSGGESIYGGTFEDENFVLRHDERGLLSMANAGPNTNG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITFK    LD
Sbjct  121  SQFFITFKHNSRLD  134



>ref|XP_010935780.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like [Elaeis 
guineensis]
Length=703

 Score =   207 bits (528),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +1

Query  241  FEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKP  420
               K+ KKKNPLVF D+S DG   +RIV+ELF+DVVP+TAENFRALCTGEKGIG STGK 
Sbjct  3    LSEKMAKKKNPLVFLDISIDGNRAERIVIELFSDVVPKTAENFRALCTGEKGIGASTGKS  62

Query  421  LHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGP  600
            LHYKG IFHRI+K F AQGGD +K +G+GGESIYGGKF+DENFKL H  PG+LSMA+  P
Sbjct  63   LHYKGSIFHRIVKRFGAQGGDIAKLDGSGGESIYGGKFSDENFKLKHDGPGVLSMASPAP  122

Query  601  NTNGSQFFITFKRQPHLD  654
            ++NGSQFF++F+  P LD
Sbjct  123  DSNGSQFFMSFRAAPRLD  140



>ref|XP_011074689.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Sesamum indicum]
Length=172

 Score =   194 bits (494),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD++  G P  R+VMELFAD  PRTAENFRALCTGEKG+G S GKPLHYKG  FH
Sbjct  3    NPRVFFDITIGGQPAGRVVMELFADTTPRTAENFRALCTGEKGVGRS-GKPLHYKGSTFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+I GFM QGGDF+ GNGTGGESIYG KFADENF   H+ PG+LSMANSGPNTNGSQFFI
Sbjct  62   RVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIKQHTGPGILSMANSGPNTNGSQFFI  121

Query  628  TFKRQPHLD  654
               +   LD
Sbjct  122  CTAKTAWLD  130



>ref|XP_004337460.1| peptidylprolyl cis-trans isomerase [Acanthamoeba castellanii 
str. Neff]
 gb|ELR15447.1| peptidylprolyl cis-trans isomerase [Acanthamoeba castellanii 
str. Neff]
Length=172

 Score =   194 bits (494),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD++  G    R+ MELFADVVP+TAENFRALCTGEKG+G S GKPLH+KGC FH
Sbjct  3    NPRVFFDITIGGEAAGRVTMELFADVVPKTAENFRALCTGEKGVGRS-GKPLHFKGCAFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+IK FM QGGDF+ GNGTGGESIYGG+F DENFKL H+ PG+LSMAN+GPNTNGSQFFI
Sbjct  62   RVIKDFMIQGGDFTAGNGTGGESIYGGEFRDENFKLKHTGPGILSMANAGPNTNGSQFFI  121

Query  628  TFKRQPHLD  654
               +   LD
Sbjct  122  CTVKTTWLD  130



>ref|XP_005517649.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Pseudopodoces 
humilis]
Length=370

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K  NP  FFDV   G  V RIV ELFADVVP+TAENFRALCTGEKG G +TGKPLHYKGC
Sbjct  12   KASNPRAFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGC  71

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H +PGLLSMAN+GP TNGSQ
Sbjct  72   PFHRIIKQFMIQGGDFSNQNGTGGESIYGEKFEDENFHYQHDKPGLLSMANAGPGTNGSQ  131

Query  619  FFITFKRQPHLD  654
            FFIT    PHLD
Sbjct  132  FFITTVPTPHLD  143



>ref|XP_003443392.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Oreochromis 
niloticus]
Length=370

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            +NP VF DV  DG    RIV+ELFAD+ P+TAENFRALCTGEKG G STGKPLH+KGC F
Sbjct  14   ENPRVFLDVDIDGERAGRIVLELFADITPKTAENFRALCTGEKGTGKSTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H++ GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYKHNKEGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_010228289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X1 [Brachypodium distachyon]
Length=651

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VF D+S DG   +RI +ELF+DVVP+TAENFRALCTGEKG+G +T  PL++KG   H
Sbjct  10   NPRVFMDISIDGQAAERITIELFSDVVPKTAENFRALCTGEKGLGQTTKTPLYFKGTNIH  69

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIKGFMAQGGDFS+G+G GGESIYG KF DENFKL H +PG+LSMANSG N+NGSQFFI
Sbjct  70   RIIKGFMAQGGDFSRGDGRGGESIYGAKFPDENFKLKHDQPGVLSMANSGANSNGSQFFI  129

Query  628  TFKRQPHLD  654
            TFK  PHLD
Sbjct  130  TFKATPHLD  138



>ref|XP_003557489.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63-like isoform 
X2 [Brachypodium distachyon]
Length=637

 Score =   206 bits (525),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VF D+S DG   +RI +ELF+DVVP+TAENFRALCTGEKG+G +T  PL++KG   H
Sbjct  10   NPRVFMDISIDGQAAERITIELFSDVVPKTAENFRALCTGEKGLGQTTKTPLYFKGTNIH  69

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIKGFMAQGGDFS+G+G GGESIYG KF DENFKL H +PG+LSMANSG N+NGSQFFI
Sbjct  70   RIIKGFMAQGGDFSRGDGRGGESIYGAKFPDENFKLKHDQPGVLSMANSGANSNGSQFFI  129

Query  628  TFKRQPHLD  654
            TFK  PHLD
Sbjct  130  TFKATPHLD  138



>ref|XP_010381484.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Rhinopithecus 
roxellana]
Length=370

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC+FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCLFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>gb|ACH45651.1| putative peptidylprolyl isomerase D [Taeniopygia guttata]
Length=374

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K  NP  FFDV   G  V RIV ELFADVVP+TAENFRALCTGEKG G +TGKPLHYKGC
Sbjct  12   KASNPRAFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTGEKGTGPTTGKPLHYKGC  71

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H +PGLLSMAN+GP TNGSQ
Sbjct  72   PFHRIIKQFMVQGGDFSNQNGTGGESIYGEKFEDENFHYQHDKPGLLSMANAGPGTNGSQ  131

Query  619  FFITFKRQPHLD  654
            FFIT    PHLD
Sbjct  132  FFITTVPTPHLD  143



>gb|ELU12765.1| hypothetical protein CAPTEDRAFT_170435, partial [Capitella teleta]
Length=365

 Score =   200 bits (509),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV      V RIV ELF D+VP+T ENFRALCTGEKGIG+STGKPLH+KGC FH
Sbjct  6    NPRVFFDVKIGNDDVGRIVFELFKDIVPKTVENFRALCTGEKGIGESTGKPLHFKGCPFH  65

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIKGFM QGGDFS  NGTGGESIYG KF DENF+L H  PGLLSMAN+G NTNGSQFFI
Sbjct  66   RIIKGFMLQGGDFSNQNGTGGESIYGAKFEDENFELKHDRPGLLSMANAGKNTNGSQFFI  125

Query  628  TFKRQPHLD  654
            T     HLD
Sbjct  126  TTVPTAHLD  134



>ref|XP_004956263.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-3-like [Setaria 
italica]
Length=175

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFD+        R+VMELFAD VP+TAENFR LCTGEKG+G S GKPLHYKG +F
Sbjct  3    KNPKVFFDILIGKAKAGRVVMELFADKVPKTAENFRCLCTGEKGLGTS-GKPLHYKGSVF  61

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRII  FM QGGDF++GNGTGGESIYG KFADENFKL H+ PG+LSMAN+GPNTNGSQFF
Sbjct  62   HRIIPSFMCQGGDFTRGNGTGGESIYGAKFADENFKLHHTGPGVLSMANAGPNTNGSQFF  121

Query  625  ITFKRQPHLD  654
            I   + P LD
Sbjct  122  ICTTQTPWLD  131



>ref|XP_007998311.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X3 [Chlorocebus 
sabaeus]
Length=329

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>gb|KDP23701.1| hypothetical protein JCGZ_23534 [Jatropha curcas]
Length=174

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD+        R+VMELF+DV P+TAENFRALCTGEKG+G S GKPLHYKG +FH
Sbjct  3    NPKVFFDILIGKAKAGRVVMELFSDVTPKTAENFRALCTGEKGLGIS-GKPLHYKGSVFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RII  FM QGGDF++GNGTGGESIYG KFADENFK+ H+ PGLLSMAN+GPNTNGSQFFI
Sbjct  62   RIIPKFMCQGGDFTRGNGTGGESIYGTKFADENFKIKHTAPGLLSMANAGPNTNGSQFFI  121

Query  628  TFKRQPHLD  654
            T ++   LD
Sbjct  122  TTEKTEWLD  130



>ref|XP_007184203.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=370

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VF DV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFLDVDVGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYGGKF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGGKFEDENFHYKHDKEGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TMAPTPHLD  143



>ref|WP_035985162.1| peptidylprolyl isomerase [Leptolyngbya sp. KIOST-1]
Length=174

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 106/132 (80%), Gaps = 1/132 (1%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            +  NP VFFD++  G PV RIVMEL ADV P+TAENFRALCTGEKG+G S G PLH+KG 
Sbjct  3    EATNPRVFFDITIGGTPVGRIVMELRADVAPKTAENFRALCTGEKGMGTS-GVPLHFKGS  61

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
             FHRII  FM QGGDF++GNGTGGESIYG KFADENF L H+ PGLLSMAN+GPNTNGSQ
Sbjct  62   SFHRIIPEFMCQGGDFTRGNGTGGESIYGMKFADENFTLKHTTPGLLSMANAGPNTNGSQ  121

Query  619  FFITFKRQPHLD  654
            FF+T    P LD
Sbjct  122  FFLTTVATPWLD  133



>ref|XP_009798524.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP63 isoform 
X2 [Nicotiana sylvestris]
Length=660

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/120 (83%), Positives = 107/120 (89%), Gaps = 5/120 (4%)
 Frame = +1

Query  295  FDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQ  474
            F GG VQ     LFAD+VPRTAENFR+LCTGEKG+G STGKPLHYKGC+FHR+IKGFMAQ
Sbjct  20   FWGGNVQ-----LFADIVPRTAENFRSLCTGEKGVGVSTGKPLHYKGCLFHRVIKGFMAQ  74

Query  475  GGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFITFKRQPHLD  654
            GGDFSKGNGTGGESIYGGKF DENFK+ H+  GLLSMANSGPNTNGSQFFITFKR PHLD
Sbjct  75   GGDFSKGNGTGGESIYGGKFPDENFKVVHTGAGLLSMANSGPNTNGSQFFITFKRTPHLD  134



>ref|XP_004955636.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Setaria italica]
 ref|XP_004955637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Setaria italica]
 ref|XP_004955638.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X3 [Setaria italica]
Length=644

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K KNP VF D+S  GG  +RI  ELFA+VVP+T ENFRALCTGE+G+G ST KPL+YKG 
Sbjct  3    KAKNPHVFMDISIGGGSTERITFELFANVVPKTVENFRALCTGERGLGASTQKPLYYKGT  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
              HRI+KGF+AQGGDFSKG+G GGESIYGGKF DENF+L H +PG+LSMAN+GP+TNGSQ
Sbjct  63   NIHRIVKGFVAQGGDFSKGDGRGGESIYGGKFPDENFRLTHDQPGMLSMANAGPDTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  123  FFITFKPLPHLD  134



>gb|KHG05845.1| Peptidyl-prolyl cis-trans isomerase CYP19-3 -like protein [Gossypium 
arboreum]
Length=201

 Score =   195 bits (496),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 107/136 (79%), Gaps = 2/136 (1%)
 Frame = +1

Query  247  WKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLH  426
            W V K  NP +FFD+        R+VMELFADVVP+TAENFRALCTGEKG+G   GKPLH
Sbjct  6    W-VSKMSNPKIFFDILIGKAKAGRVVMELFADVVPKTAENFRALCTGEKGVGQ-CGKPLH  63

Query  427  YKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNT  606
            YKG  FHRII  FM QGGDF++GNGTGGESIYG KFADENFKL H+ PG LSMAN+GPNT
Sbjct  64   YKGSAFHRIIPSFMCQGGDFTRGNGTGGESIYGMKFADENFKLKHTGPGCLSMANAGPNT  123

Query  607  NGSQFFITFKRQPHLD  654
            NGSQFFI  ++ P LD
Sbjct  124  NGSQFFICTEKTPWLD  139



>ref|NP_001002065.1| peptidyl-prolyl cis-trans isomerase D [Danio rerio]
 gb|AAH71388.1| Peptidylprolyl isomerase D (cyclophilin D) [Danio rerio]
Length=371

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            +NP VFFDV      V R+V ELFADVVP+TAENFRALCTGEKG+G STGKPLH+KGC F
Sbjct  14   ENPRVFFDVEIGAERVGRVVFELFADVVPKTAENFRALCTGEKGVGKSTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKSFMIQGGDFSNQNGTGGESIYGDKFEDENFHYKHDREGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_007551094.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Poecilia formosa]
Length=397

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            +NP VFFDV  DG    RIV+ELFADV P+TAENFRALCTGEKGIG STGKPLH+KGC F
Sbjct  40   ENPRVFFDVDIDGEKAGRIVLELFADVTPKTAENFRALCTGEKGIGKSTGKPLHFKGCPF  99

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFF
Sbjct  100  HRIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYKHDKVGLLSMANAGANTNGSQFF  159

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  160  ITTVPTPHLD  169



>ref|XP_008651151.1| PREDICTED: uncharacterized protein LOC100274576 isoform X3 [Zea 
mays]
 tpg|DAA59760.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
 tpg|DAA59761.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
Length=621

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K KNP VF D+S  GG  +RI  ELFA+VVP+TAENFRALCTGE+G+G ST KPL+YKG 
Sbjct  3    KVKNPHVFMDISIGGGSAERITFELFANVVPKTAENFRALCTGERGLGASTQKPLYYKGT  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
              HRI+KGF+AQGGDFS G+G GGESIYGGKF DENFKL H++PG+LSMANSGP TNGSQ
Sbjct  63   YIHRIVKGFVAQGGDFSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  123  FFITFKALPHLD  134



>ref|XP_003564091.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP40-like [Brachypodium 
distachyon]
Length=390

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP  F DV+  G    RIV+EL+A VVPRTAENFRALCTGEKG+G S+GKPLHYKG  F
Sbjct  18   KNPRCFMDVTIGGEMEGRIVIELYASVVPRTAENFRALCTGEKGVGASSGKPLHYKGSYF  77

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HR+IKGFM QGGDF+ G+GTGGESIYG KF DENF L H   G+LSMANSGPNTNGSQFF
Sbjct  78   HRVIKGFMVQGGDFTAGDGTGGESIYGLKFEDENFVLKHERKGILSMANSGPNTNGSQFF  137

Query  625  ITFKRQPHLD  654
            IT  R PHLD
Sbjct  138  ITTTRTPHLD  147



>ref|XP_004606206.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Sorex araneus]
Length=370

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +1

Query  244  EWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPL  423
            E K     NP VF DV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G STGKPL
Sbjct  7    ETKPSNASNPRVFLDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGASTGKPL  66

Query  424  HYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPN  603
            H+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPN
Sbjct  67   HFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGPN  126

Query  604  TNGSQFFITFKRQPHLD  654
            TNGSQFFIT    PHLD
Sbjct  127  TNGSQFFITTVPTPHLD  143



>ref|XP_004955639.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X4 [Setaria italica]
Length=643

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K KNP VF D+S  GG  +RI  ELFA+VVP+T ENFRALCTGE+G+G ST KPL+YKG 
Sbjct  3    KAKNPHVFMDISIGGGSTERITFELFANVVPKTVENFRALCTGERGLGASTQKPLYYKGT  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
              HRI+KGF+AQGGDFSKG+G GGESIYGGKF DENF+L H +PG+LSMAN+GP+TNGSQ
Sbjct  63   NIHRIVKGFVAQGGDFSKGDGRGGESIYGGKFPDENFRLTHDQPGMLSMANAGPDTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  123  FFITFKPLPHLD  134



>ref|XP_001774773.1| predicted protein [Physcomitrella patens]
 gb|EDQ60444.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = +1

Query  256  MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKG  435
            M  KNP VFFD+S       RIVMELFADVVPRTAENFRALCTGEKGIG  TG+P+HYKG
Sbjct  7    MGSKNPKVFFDISIGDELEGRIVMELFADVVPRTAENFRALCTGEKGIGPVTGRPMHYKG  66

Query  436  CIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGS  615
             IFHR+IK FM QGGDF   NGTGGESIYG  F DE F + H   G+LSMAN+GPNTNGS
Sbjct  67   TIFHRVIKSFMIQGGDFENANGTGGESIYGKNFEDEVFLMKHERKGMLSMANAGPNTNGS  126

Query  616  QFFITFKRQPHLD  654
            QFFIT  R PHLD
Sbjct  127  QFFITTTRAPHLD  139



>ref|XP_007229920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Astyanax mexicanus]
Length=371

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            +NP V+FDV   G  V R+V ELFADVVP+TAENFRALCTGEKG G STGKPLH+KGC F
Sbjct  14   ENPRVYFDVDIGGERVGRVVFELFADVVPKTAENFRALCTGEKGTGKSTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMVQGGDFSNQNGTGGESIYGDKFEDENFHYKHDKEGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_008651149.1| PREDICTED: uncharacterized protein LOC100274576 isoform X1 [Zea 
mays]
Length=649

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K KNP VF D+S  GG  +RI  ELFA+VVP+TAENFRALCTGE+G+G ST KPL+YKG 
Sbjct  3    KVKNPHVFMDISIGGGSAERITFELFANVVPKTAENFRALCTGERGLGASTQKPLYYKGT  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
              HRI+KGF+AQGGDFS G+G GGESIYGGKF DENFKL H++PG+LSMANSGP TNGSQ
Sbjct  63   YIHRIVKGFVAQGGDFSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  123  FFITFKALPHLD  134



>ref|XP_008651150.1| PREDICTED: uncharacterized protein LOC100274576 isoform X2 [Zea 
mays]
 tpg|DAA59759.1| TPA: hypothetical protein ZEAMMB73_415877 [Zea mays]
Length=648

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            K KNP VF D+S  GG  +RI  ELFA+VVP+TAENFRALCTGE+G+G ST KPL+YKG 
Sbjct  3    KVKNPHVFMDISIGGGSAERITFELFANVVPKTAENFRALCTGERGLGASTQKPLYYKGT  62

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
              HRI+KGF+AQGGDFS G+G GGESIYGGKF DENFKL H++PG+LSMANSGP TNGSQ
Sbjct  63   YIHRIVKGFVAQGGDFSSGDGKGGESIYGGKFPDENFKLLHNQPGVLSMANSGPGTNGSQ  122

Query  619  FFITFKRQPHLD  654
            FFITFK  PHLD
Sbjct  123  FFITFKALPHLD  134



>ref|XP_001941476.1| peptidyl-prolyl cis-trans isomerase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU44195.1| peptidyl-prolyl cis-trans isomerase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=171

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD++  G P  RIVMELFADVVP+TAENFRALCTGEKG G S+GKPLHYKG  FH
Sbjct  3    NPRVFFDITIGGAPAGRIVMELFADVVPKTAENFRALCTGEKGTG-SSGKPLHYKGSSFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+I  FM QGGDF++GNGTGGESIYG KFADENF+L H+ PG+LSMAN+G NTNGSQFFI
Sbjct  62   RVIPQFMLQGGDFTRGNGTGGESIYGEKFADENFQLKHTGPGILSMANAGANTNGSQFFI  121

Query  628  TFKRQPHLD  654
               +   LD
Sbjct  122  CTVKTAWLD  130



>ref|XP_007949832.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Orycteropus 
afer afer]
Length=370

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGSTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_005800637.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Xiphophorus 
maculatus]
Length=371

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            +NP VFFDV  DG    RIV+ELFADV P+TAENFRALCTGEKG+G STGKPLH+KGC F
Sbjct  14   ENPRVFFDVDIDGEKAGRIVLELFADVTPKTAENFRALCTGEKGVGKSTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYKHDKVGLLSMANAGANTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>gb|KJB80889.1| hypothetical protein B456_013G120200 [Gossypium raimondii]
 gb|KJB80892.1| hypothetical protein B456_013G120200 [Gossypium raimondii]
Length=174

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD+        R+VMELFADVVP+TAENFRALCTGEKG+G   GKPLHYKG  FH
Sbjct  3    NPKVFFDILIGKAKAGRVVMELFADVVPKTAENFRALCTGEKGVGQC-GKPLHYKGSAFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RII  FM QGGDF++GNGTGGESIYG KFADENFKL H+ PG LSMAN+GPNTNGSQFFI
Sbjct  62   RIIPSFMCQGGDFTRGNGTGGESIYGMKFADENFKLKHTGPGCLSMANAGPNTNGSQFFI  121

Query  628  TFKRQPHLD  654
              ++ P LD
Sbjct  122  CTEKTPWLD  130



>ref|XP_002815298.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Pongo abelii]
Length=370

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDQEGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_006023222.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X2 [Alligator 
sinensis]
Length=347

 Score =   199 bits (506),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP  FFDV   G  V RIV ELFAD+VP+TAENFRALCTGEKG+G +TGKPLHYKGC FH
Sbjct  15   NPRAFFDVDVGGERVGRIVFELFADIVPKTAENFRALCTGEKGLGLTTGKPLHYKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPNTNGSQFFI
Sbjct  75   RIIKKFMVQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKAGLLSMANAGPNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_008419300.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
D [Poecilia reticulata]
Length=398

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            +NP VFFDV  DG    RIV+ELFADV P+TAENFRALCTGEKG+G STGKPLH+KGC F
Sbjct  41   ENPRVFFDVDIDGEKAGRIVLELFADVTPKTAENFRALCTGEKGVGKSTGKPLHFKGCPF  100

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFF
Sbjct  101  HRIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYKHDKVGLLSMANAGANTNGSQFF  160

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  161  ITTVPTPHLD  170



>gb|KDP27580.1| hypothetical protein JCGZ_19585 [Jatropha curcas]
Length=172

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD++  G PV RIVMEL+ DVVPRTAENFRALCTGEKGIG S GKPLHYKG  FH
Sbjct  3    NPKVFFDMAVGGQPVGRIVMELYQDVVPRTAENFRALCTGEKGIGKS-GKPLHYKGSSFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+I GFM QGGDF+ GNGTGGESIYG KFADENF   H+ PG+LSMAN+GP TNGSQFFI
Sbjct  62   RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFFI  121

Query  628  TFKRQPHLD  654
               +   LD
Sbjct  122  CVAKTEWLD  130



>gb|AFP44118.1| cyclophilin [Lycoris longituba]
Length=173

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD++  G P  RIVMELFADVVPRT ENFRALCTGEKG+G S GKPLHYKG  FH
Sbjct  4    NPKVFFDMTVGGAPAGRIVMELFADVVPRTTENFRALCTGEKGVGRS-GKPLHYKGSSFH  62

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+I  FM QGGDF+ GNGTGGESIYG KFADENF   H+ PG+LSMAN+GPNTNGSQFF+
Sbjct  63   RVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVRKHTGPGILSMANAGPNTNGSQFFV  122

Query  628  TFKRQPHLD  654
              ++   LD
Sbjct  123  CTEKTAWLD  131



>ref|XP_004007561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Ovis aries]
Length=259

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDTGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>dbj|BAJ87064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=620

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 110/135 (81%), Gaps = 0/135 (0%)
 Frame = +1

Query  250  KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHY  429
            K  K  NP VF D+S DG   +RI  ELFADVVP+TAENFRALCTGEKG+G+ST KPL++
Sbjct  3    KFKKNPNPRVFLDISIDGRLTERITFELFADVVPKTAENFRALCTGEKGLGESTKKPLYF  62

Query  430  KGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTN  609
            KG   HRII GFM QGGDFS+G+G GGESIYGGKF DENFKL H +PG+LSMANSG ++N
Sbjct  63   KGTHIHRIIPGFMVQGGDFSRGDGRGGESIYGGKFQDENFKLKHDQPGILSMANSGEDSN  122

Query  610  GSQFFITFKRQPHLD  654
            GSQFFITFK  PHLD
Sbjct  123  GSQFFITFKAVPHLD  137



>ref|XP_006023221.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Alligator 
sinensis]
Length=370

 Score =   199 bits (507),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP  FFDV   G  V RIV ELFAD+VP+TAENFRALCTGEKG+G +TGKPLHYKGC FH
Sbjct  15   NPRAFFDVDVGGERVGRIVFELFADIVPKTAENFRALCTGEKGLGLTTGKPLHYKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPNTNGSQFFI
Sbjct  75   RIIKKFMVQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKAGLLSMANAGPNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_532704.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform 1 [Canis 
lupus familiaris]
Length=370

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 105/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV+  G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVAIAGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_008142683.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Eptesicus fuscus]
Length=370

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGSTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_004040619.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Gorilla gorilla 
gorilla]
Length=370

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDQEGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>emb|CEF66075.1| Peptidyl-prolyl cis-trans isomerase D [Strongyloides ratti]
Length=171

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +1

Query  271  PLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFHR  450
            P VFFDVS +G P+ RIV ELF+D+VP+TAENFRALCTGEKG+G   GKPLHYKGC FHR
Sbjct  4    PKVFFDVSSNGKPIGRIVFELFSDIVPKTAENFRALCTGEKGVG-KMGKPLHYKGCTFHR  62

Query  451  IIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFIT  630
            +I  FM QGGDF+ GNGTGGESIYG KFADENF+  H+ PGLLSMAN+G NTNGSQFFIT
Sbjct  63   VIPDFMLQGGDFTHGNGTGGESIYGAKFADENFQEKHTIPGLLSMANAGANTNGSQFFIT  122

Query  631  FKRQPHLD  654
                P LD
Sbjct  123  TVPTPWLD  130



>ref|XP_004017329.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Ovis aries]
Length=370

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_002367801.1| 20 kDa cyclophilin precursor [Toxoplasma gondii ME49]
 gb|EPT29942.1| cyclophilin precursor [Toxoplasma gondii ME49]
Length=348

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = +1

Query  199  RVHSDRVPVTPVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRAL  378
            R+    +P     L+  ++    NP VFFD+S D  P  RI  ELFADVVP+TAENFRAL
Sbjct  156  RLRPGSLPCVAFCLYSSRLSTMPNPRVFFDISIDKKPAGRIEFELFADVVPKTAENFRAL  215

Query  379  CTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLD  558
            CTGEKG G S GKPL+YKGC FHRII  FM QGGDF++ NGTGGESIYG KFADENF   
Sbjct  216  CTGEKGTGRS-GKPLYYKGCPFHRIIPQFMCQGGDFTRMNGTGGESIYGEKFADENFSYK  274

Query  559  HSEPGLLSMANSGPNTNGSQFFITFKRQPHLD  654
            HSEP LLSMAN+GPNTNGSQFFIT    P LD
Sbjct  275  HSEPFLLSMANAGPNTNGSQFFITTVPCPWLD  306



>gb|EPR61465.1| cyclophilin precursor [Toxoplasma gondii GT1]
 gb|ESS33191.1| cyclophilin precursor [Toxoplasma gondii VEG]
 gb|KFG33731.1| cyclophilin precursor [Toxoplasma gondii p89]
 gb|KFG36927.1| cyclophilin precursor [Toxoplasma gondii FOU]
 gb|KFG38295.1| cyclophilin precursor [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG59101.1| cyclophilin precursor [Toxoplasma gondii RUB]
 gb|KFH00491.1| cyclophilin precursor [Toxoplasma gondii VAND]
 gb|KFH07629.1| cyclophilin precursor [Toxoplasma gondii MAS]
Length=348

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = +1

Query  199  RVHSDRVPVTPVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRAL  378
            R+    +P     L+  ++    NP VFFD+S D  P  RI  ELFADVVP+TAENFRAL
Sbjct  156  RLRPGSLPCVAFCLYSSRLSTMPNPRVFFDISIDKKPAGRIEFELFADVVPKTAENFRAL  215

Query  379  CTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLD  558
            CTGEKG G S GKPL+YKGC FHRII  FM QGGDF++ NGTGGESIYG KFADENF   
Sbjct  216  CTGEKGTGRS-GKPLYYKGCPFHRIIPQFMCQGGDFTRMNGTGGESIYGEKFADENFSYK  274

Query  559  HSEPGLLSMANSGPNTNGSQFFITFKRQPHLD  654
            HSEP LLSMAN+GPNTNGSQFFIT    P LD
Sbjct  275  HSEPFLLSMANAGPNTNGSQFFITTVPCPWLD  306



>gb|EHH30637.1| hypothetical protein EGK_20384 [Macaca mulatta]
Length=370

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTG+KGIG +TGKPLH+KGC+FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGQKGIGPTTGKPLHFKGCLFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>emb|CDI79350.1| 20 kDa cyclophilin precursor, putative [Eimeria acervulina]
Length=172

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDVS  GG  +RIVMELFAD+ P+TAENFR LCTGEKGIG S GKPLHYKG  FH
Sbjct  3    NPKVFFDVSIGGGAARRIVMELFADITPKTAENFRCLCTGEKGIGRS-GKPLHYKGSSFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RII  FM QGGDF++GNGTGGESIYG KFADENFKL H +P LLSMAN+GPNTNGSQFFI
Sbjct  62   RIIPQFMLQGGDFTRGNGTGGESIYGEKFADENFKLKHDKPFLLSMANAGPNTNGSQFFI  121

Query  628  TFKRQPHLD  654
            T      LD
Sbjct  122  TTVVCDWLD  130



>gb|AAA17998.1| 20 kDa cyclophilin precursor, partial [Toxoplasma gondii]
Length=347

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = +1

Query  199  RVHSDRVPVTPVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRAL  378
            R+    +P     L+  ++    NP VFFD+S D  P  RI  ELFADVVP+TAENFRAL
Sbjct  155  RLRPGSLPCVAFCLYSSRLSTMPNPRVFFDISIDKKPAGRIEFELFADVVPKTAENFRAL  214

Query  379  CTGEKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLD  558
            CTGEKG G S GKPL+YKGC FHRII  FM QGGDF++ NGTGGESIYG KFADENF   
Sbjct  215  CTGEKGTGRS-GKPLYYKGCPFHRIIPQFMCQGGDFTRMNGTGGESIYGEKFADENFSYK  273

Query  559  HSEPGLLSMANSGPNTNGSQFFITFKRQPHLD  654
            HSEP LLSMAN+GPNTNGSQFFIT    P LD
Sbjct  274  HSEPFLLSMANAGPNTNGSQFFITTVPCPWLD  305



>ref|XP_005909484.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Bos mutus]
 gb|ELR46335.1| Peptidyl-prolyl cis-trans isomerase D [Bos mutus]
Length=370

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>gb|AGI78541.1| cyclophilin [Suaeda salsa]
Length=176

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 104/133 (78%), Gaps = 1/133 (1%)
 Frame = +1

Query  256  MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKG  435
            M K NP VFFD+        R+VMELFADV P+TA+NFRALCTGEKGIG   GKPLHYKG
Sbjct  1    MAKPNPKVFFDILIGKSKAGRVVMELFADVTPKTADNFRALCTGEKGIG-KLGKPLHYKG  59

Query  436  CIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGS  615
              FHRII  FM QGGDF++GNGTGGESIYG KF DENFKL H+ PG+LSMAN+GPNTNGS
Sbjct  60   SAFHRIIPEFMCQGGDFTRGNGTGGESIYGSKFDDENFKLKHTGPGILSMANAGPNTNGS  119

Query  616  QFFITFKRQPHLD  654
            QFFI   R P LD
Sbjct  120  QFFICTARTPWLD  132



>ref|NP_776578.1| peptidyl-prolyl cis-trans isomerase D [Bos taurus]
 ref|XP_006073967.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Bubalus bubalis]
 ref|XP_010834386.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Bison bison 
bison]
 sp|P26882.6|PPID_BOVIN RecName: Full=Peptidyl-prolyl cis-trans isomerase D; Short=PPIase 
D; AltName: Full=40 kDa peptidyl-prolyl cis-trans isomerase; 
AltName: Full=Cyclophilin-40; Short=CYP-40; AltName: Full=Cyclophilin-related 
protein; AltName: Full=Estrogen receptor-binding 
cyclophilin; AltName: Full=Rotamase D [Bos taurus]
 pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form
 pdb|1IIP|A Chain A, Bovine Cyclophilin 40, Tetragonal Form
 dbj|BAA03159.1| cyclophilin [Bos taurus]
 gb|AAI13319.1| Peptidylprolyl isomerase D [Bos taurus]
 tpg|DAA20814.1| TPA: peptidylprolyl isomerase D [Bos taurus]
Length=370

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGSNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>emb|CAA69622.1| cyclophylin [Digitalis lanata]
Length=172

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD++  G P  RIVMEL+ADVVP+TAENFRALCTGEKG+G  TGKPLHYKG  FH
Sbjct  3    NPKVFFDMTIGGQPCGRIVMELYADVVPKTAENFRALCTGEKGVG-KTGKPLHYKGSAFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+I GFM QGGDF+ GNGTGGESIYG KFADENF   H+ PG+LSMAN+GP TNGSQFFI
Sbjct  62   RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHTGPGILSMANAGPGTNGSQFFI  121

Query  628  TFKRQPHLD  654
              ++   LD
Sbjct  122  CTEKTSWLD  130



>ref|XP_003418541.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Loxodonta africana]
Length=370

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYKHDQEGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_006694995.1| putative cis-trans protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
 gb|EGS20110.1| putative cis-trans protein [Chaetomium thermophilum var. thermophilum 
DSM 1495]
Length=382

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 105/132 (80%), Gaps = 1/132 (1%)
 Frame = +1

Query  259  KKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGC  438
            KK     FFD++  G PV RI+ EL+ D+VP+TAENFRALCTGEKGIG S GKPLHYKGC
Sbjct  14   KKNRSRCFFDITIGGKPVGRIIFELYNDIVPKTAENFRALCTGEKGIGKS-GKPLHYKGC  72

Query  439  IFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQ  618
            IFHR+IK FM QGGDF+ GNGTGGESIYG KF DENF+L H  P LLSMAN+GP TNGSQ
Sbjct  73   IFHRVIKQFMIQGGDFTAGNGTGGESIYGAKFEDENFELKHDRPFLLSMANAGPGTNGSQ  132

Query  619  FFITFKRQPHLD  654
            FFIT    PHLD
Sbjct  133  FFITTVATPHLD  144



>gb|ADV04050.1| cyclophilin [Hevea brasiliensis]
Length=172

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD+S  G P  +IVMEL+ADVVPRTAENFRALCTGEKGIG S GKPLHYKG  FH
Sbjct  3    NPKVFFDMSVGGHPAGKIVMELYADVVPRTAENFRALCTGEKGIGKS-GKPLHYKGSSFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+I GFM QGGDF+ GNGTGGESIYG KFADENF   H+ PG+LSMAN+GP TNGSQFF+
Sbjct  62   RVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFTKKHTGPGVLSMANAGPGTNGSQFFV  121

Query  628  TFKRQPHLD  654
               +   LD
Sbjct  122  CTAKTEWLD  130



>ref|XP_006892841.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Elephantulus 
edwardii]
Length=370

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG+G +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGVGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDQEGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_002459866.1| hypothetical protein SORBIDRAFT_02g012590 [Sorghum bicolor]
 gb|EER96387.1| hypothetical protein SORBIDRAFT_02g012590 [Sorghum bicolor]
Length=175

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFD+        R+VMELFAD VP+TAENFRALCTGEKG+G S+GKPLHYKG  F
Sbjct  3    KNPKVFFDILIGKSQAGRVVMELFADKVPKTAENFRALCTGEKGLG-SSGKPLHYKGSAF  61

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRII  FM QGGDF++GNGTGGESIYG KFADENFKL H+ PG+LSMAN+GPNTNGSQFF
Sbjct  62   HRIIPSFMCQGGDFTRGNGTGGESIYGAKFADENFKLHHTGPGVLSMANAGPNTNGSQFF  121

Query  625  ITFKRQPHLD  654
            I   +   LD
Sbjct  122  ICTAQTSWLD  131



>ref|XP_007609920.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase 
D-like [Cricetulus griseus]
Length=370

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC F
Sbjct  14   KNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+ PNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANADPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_005593787.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Macaca 
fascicularis]
Length=376

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTG+KGIG +TGKPLH+KGC+FH
Sbjct  21   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGQKGIGPTTGKPLHFKGCLFH  80

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  81   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDWEGLLSMANAGCNTNGSQFFI  140

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  141  TTVPTPHLD  149



>ref|XP_006657500.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X2 [Oryza brachyantha]
Length=626

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            KKNP VF D+S  G   +RI  ELF+DVVP+TAENFRALCTGE+G+G ST KPLHYKG  
Sbjct  5    KKNPHVFLDISIGGRAAERITFELFSDVVPKTAENFRALCTGERGLGISTQKPLHYKGTT  64

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
             HRI+KGFMAQGGDFS+G+G GGESIYG KF DENFKL H +PG+LSMAN+GP++NGSQF
Sbjct  65   MHRILKGFMAQGGDFSRGDGRGGESIYGAKFKDENFKLKHDQPGVLSMANAGPDSNGSQF  124

Query  622  FITFKRQPHLD  654
            FITF   PHLD
Sbjct  125  FITFLPVPHLD  135



>ref|XP_006657499.1| PREDICTED: peptidyl-prolyl cis-trans isomerase G-like isoform 
X1 [Oryza brachyantha]
Length=627

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            KKNP VF D+S  G   +RI  ELF+DVVP+TAENFRALCTGE+G+G ST KPLHYKG  
Sbjct  5    KKNPHVFLDISIGGRAAERITFELFSDVVPKTAENFRALCTGERGLGISTQKPLHYKGTT  64

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
             HRI+KGFMAQGGDFS+G+G GGESIYG KF DENFKL H +PG+LSMAN+GP++NGSQF
Sbjct  65   MHRILKGFMAQGGDFSRGDGRGGESIYGAKFKDENFKLKHDQPGVLSMANAGPDSNGSQF  124

Query  622  FITFKRQPHLD  654
            FITF   PHLD
Sbjct  125  FITFLPVPHLD  135



>ref|XP_010746147.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Larimichthys 
crocea]
Length=370

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 104/130 (80%), Gaps = 0/130 (0%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            +NP VFFDV   G    RIV+ELFAD+ P+TAENFRALCTGEKGIG STGKPLH+KGC F
Sbjct  14   ENPRVFFDVDVGGERAGRIVLELFADITPKTAENFRALCTGEKGIGKSTGKPLHFKGCPF  73

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HRIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPNTNGSQFF
Sbjct  74   HRIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYMHDKVGLLSMANAGPNTNGSQFF  133

Query  625  ITFKRQPHLD  654
            IT    PHLD
Sbjct  134  ITTVPTPHLD  143



>ref|XP_007530443.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Erinaceus europaeus]
Length=370

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_003984955.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Felis catus]
 ref|XP_007084279.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Panthera tigris 
altaica]
 dbj|BAK96183.1| cyclophilin D [Felis catus]
Length=370

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_001145793.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Pan troglodytes]
 ref|XP_003822586.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Pan paniscus]
Length=370

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_002745353.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Callithrix 
jacchus]
Length=370

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_007998308.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Chlorocebus 
sabaeus]
Length=370

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_003899367.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Papio anubis]
Length=370

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|NP_001252763.1| peptidylprolyl isomerase D [Macaca mulatta]
Length=370

 Score =   199 bits (505),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|NP_001271664.1| uncharacterized protein LOC101867179 [Macaca fascicularis]
 dbj|BAE89174.1| unnamed protein product [Macaca fascicularis]
Length=370

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_010898283.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Esox lucius]
Length=371

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +1

Query  262  KKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCI  441
            K+NP VFFDV   G    RIV ELFAD+VP+TAENFRALCTGEKG G +TGKPLH+KGC 
Sbjct  13   KENPRVFFDVDIGGERAGRIVFELFADIVPKTAENFRALCTGEKGTGKTTGKPLHFKGCP  72

Query  442  FHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQF  621
            FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMANSGP TNGSQF
Sbjct  73   FHRIIKQFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANSGPATNGSQF  132

Query  622  FITFKRQPHLD  654
            FIT    PHLD
Sbjct  133  FITTVPTPHLD  143



>ref|XP_002921709.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X2 [Ailuropoda 
melanoleuca]
Length=370

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>gb|AAX36352.1| peptidylprolyl isomerase D [synthetic construct]
Length=370

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_007692567.1| hypothetical protein COCMIDRAFT_30232 [Bipolaris oryzae ATCC 
44560]
 gb|EUC40922.1| hypothetical protein COCMIDRAFT_30232 [Bipolaris oryzae ATCC 
44560]
Length=171

 Score =   192 bits (488),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDVS  G P  RIVMELFAD VP+TAENFRALCTGEKG G S GKPLHY+G +FH
Sbjct  3    NPRVFFDVSIGGQPAGRIVMELFADQVPKTAENFRALCTGEKGTGKS-GKPLHYQGSVFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+I  FM QGGDF++GNGTGGESIYG KF DENFKL H+ PG+LSMAN+GP TNGSQFFI
Sbjct  62   RVIPQFMLQGGDFTRGNGTGGESIYGDKFEDENFKLSHTGPGILSMANAGPGTNGSQFFI  121

Query  628  TFKRQPHLD  654
               +   LD
Sbjct  122  CTVKTSWLD  130



>ref|XP_010090292.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
 gb|EXB39262.1| Peptidyl-prolyl cis-trans isomerase [Morus notabilis]
Length=173

 Score =   192 bits (488),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD++  G PV RIV+EL+ADV PRTAENFRALCTGEKGIG S GKPLHYKG  FH
Sbjct  4    NPKVFFDIAIGGQPVGRIVIELYADVTPRTAENFRALCTGEKGIGRS-GKPLHYKGSSFH  62

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+I GFM QGGDF+ GNGTGGESIYG KFADENF   H+ PG+LSMAN+GP TNGSQFFI
Sbjct  63   RVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIKKHTGPGILSMANAGPGTNGSQFFI  122

Query  628  TFKRQPHLD  654
               +   LD
Sbjct  123  CTAKTEWLD  131



>ref|NP_001063993.1| Os09g0571400 [Oryza sativa Japonica Group]
 gb|AAA57044.1| cyclophilin 1 [Oryza sativa]
 dbj|BAD46607.1| peptidylprolyl isomerase [Oryza sativa Japonica Group]
 dbj|BAF25907.1| Os09g0571400 [Oryza sativa Japonica Group]
 gb|EAZ10159.1| hypothetical protein OsI_32475 [Oryza sativa Indica Group]
 gb|EAZ45747.1| hypothetical protein OsJ_30428 [Oryza sativa Japonica Group]
 dbj|BAG95895.1| unnamed protein product [Oryza sativa Japonica Group]
Length=179

 Score =   192 bits (489),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 105/133 (79%), Gaps = 1/133 (1%)
 Frame = +1

Query  256  MKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKG  435
            M  KNP VFFD+        R+VMELFAD VP+TAENFR LCTGEKG+G ++GKPLHYKG
Sbjct  1    MASKNPKVFFDILIGKARAGRVVMELFADTVPKTAENFRCLCTGEKGLG-ASGKPLHYKG  59

Query  436  CIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGS  615
              FHRII  FM QGGDF++GNGTGGESIYG +FADENFKL H+ PG+LSMAN+GPNTNGS
Sbjct  60   SAFHRIIPNFMCQGGDFTRGNGTGGESIYGDRFADENFKLRHTGPGVLSMANAGPNTNGS  119

Query  616  QFFITFKRQPHLD  654
            QFFI   R   LD
Sbjct  120  QFFICTTRTTWLD  132



>ref|XP_005666719.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X1 [Sus 
scrofa]
Length=370

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_004777378.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform X3 [Mustela 
putorius furo]
 ref|XP_004788930.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Mustela putorius 
furo]
Length=370

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>gb|EHH54044.1| hypothetical protein EGM_14781 [Macaca fascicularis]
Length=370

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Musa 
acuminata subsp. malaccensis]
Length=832

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +1

Query  253  VMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYK  432
            + KK NP+VF DV+ DG    R+V ELFAD+VP+TAENFRALCTGE GIG +T KPLHYK
Sbjct  1    MAKKNNPIVFLDVAIDGKAAGRMVFELFADIVPKTAENFRALCTGEMGIGPTTKKPLHYK  60

Query  433  GCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNG  612
            G +FHRIIKGFMAQGGDFS+ +GTGGESIYGGKF+DENF L+H   GLLSMAN+G + NG
Sbjct  61   GSVFHRIIKGFMAQGGDFSRRDGTGGESIYGGKFSDENFVLNHDGRGLLSMANAGRDANG  120

Query  613  SQFFITFKRQPHLD  654
            SQFFITF   PHL+
Sbjct  121  SQFFITFNSAPHLN  134



>gb|ADP90618.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90632.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90635.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
Length=370

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|NP_001231315.1| peptidyl-prolyl cis-trans isomerase D [Sus scrofa]
Length=370

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDKEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_006442714.1| hypothetical protein CICLE_v10022535mg [Citrus clementina]
 gb|ESR55954.1| hypothetical protein CICLE_v10022535mg [Citrus clementina]
Length=174

 Score =   192 bits (488),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD+        R+VMELFADV P+TAENFRALCTGEKGIG S GKPLHYKG  FH
Sbjct  3    NPRVFFDILIGKMNKGRVVMELFADVTPKTAENFRALCTGEKGIGTS-GKPLHYKGSTFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RII  FM QGGDF++GNGTGGESIYG KFADENFK+ H+ PG+LSMAN+GPNTNGSQFFI
Sbjct  62   RIIPNFMCQGGDFTRGNGTGGESIYGMKFADENFKMKHTGPGILSMANAGPNTNGSQFFI  121

Query  628  TFKRQPHLD  654
              ++ P LD
Sbjct  122  CTQKTPWLD  130



>gb|AAX43155.1| peptidylprolyl isomerase D [synthetic construct]
Length=371

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_001094929.2| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like [Macaca 
mulatta]
Length=376

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTG+KGIG +TGKPLH+KGC+FH
Sbjct  21   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGQKGIGPTTGKPLHFKGCLFH  80

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  81   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDWEGLLSMANAGCNTNGSQFFI  140

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  141  TTVPTPHLD  149



>emb|CDQ62287.1| unnamed protein product [Oncorhynchus mykiss]
Length=371

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 109/149 (73%), Gaps = 7/149 (5%)
 Frame = +1

Query  208  SDRVPVTPVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTG  387
            S+  PVT       K   K+NP VFFDV   G  V RIV ELFADVVP+TAENFRALCTG
Sbjct  2    SNATPVT-------KPSNKENPRVFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTG  54

Query  388  EKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSE  567
            EKG G +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H +
Sbjct  55   EKGTGKTTGKPLHFKGCPFHRIIKQFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDK  114

Query  568  PGLLSMANSGPNTNGSQFFITFKRQPHLD  654
             GLLSMANSGP TNGSQFFIT     HLD
Sbjct  115  EGLLSMANSGPATNGSQFFITTVPTAHLD  143



>ref|NP_005029.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 sp|Q08752.3|PPID_HUMAN RecName: Full=Peptidyl-prolyl cis-trans isomerase D; Short=PPIase 
D; AltName: Full=40 kDa peptidyl-prolyl cis-trans isomerase; 
AltName: Full=Cyclophilin-40; Short=CYP-40; AltName: Full=Cyclophilin-related 
protein; AltName: Full=Rotamase D [Homo 
sapiens]
 gb|AAA35731.1| cyclophilin-40 [Homo sapiens]
 dbj|BAA09923.1| cyclophilin 40 [Homo sapiens]
 gb|AAH30707.1| Peptidylprolyl isomerase D [Homo sapiens]
 gb|AAT97986.1| peptidylprolyl isomerase D (cyclophilin D) [Homo sapiens]
 gb|EAX04853.1| peptidylprolyl isomerase D (cyclophilin D) [Homo sapiens]
 gb|ABM82488.1| peptidylprolyl isomerase D (cyclophilin D) [synthetic construct]
 gb|ABM85675.1| peptidylprolyl isomerase D (cyclophilin D) [synthetic construct]
 dbj|BAG36649.1| unnamed protein product [Homo sapiens]
 dbj|BAI46609.1| peptidylprolyl isomerase D [synthetic construct]
 gb|ADP90614.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90615.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90616.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90617.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90619.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90620.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90621.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90622.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90623.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90624.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90625.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90626.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90627.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90628.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90629.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90630.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90631.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90633.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90634.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90636.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90637.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90638.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90639.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90640.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90641.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90642.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90643.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90644.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90645.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90646.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90647.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90648.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90649.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90650.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90651.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90652.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|ADP90653.1| peptidyl-prolyl cis-trans isomerase D [Homo sapiens]
 gb|AIC49446.1| PPID, partial [synthetic construct]
Length=370

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|NP_001149489.1| peptidyl-prolyl cis-trans isomerase CYP19-3 [Zea mays]
 gb|ACG27430.1| peptidyl-prolyl cis-trans isomerase CYP19-3 [Zea mays]
 gb|ACN35255.1| unknown [Zea mays]
 tpg|DAA59697.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein 
isoform 1 [Zea mays]
 tpg|DAA59698.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein 
isoform 2 [Zea mays]
 tpg|DAA59699.1| TPA: putative peptidyl-prolyl cis-trans isomerase family protein 
isoform 3 [Zea mays]
Length=175

 Score =   192 bits (488),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFD+        R+VMELFAD VP+TAENFR LCTGEKG+G S GKPLHYKG  F
Sbjct  3    KNPKVFFDILIGKSKAGRVVMELFADKVPKTAENFRCLCTGEKGLG-SAGKPLHYKGSAF  61

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HR+I GFM QGGDF++GNGTGGESIYG +FADENFKL H+ PG+LSMAN+GP+TNGSQFF
Sbjct  62   HRVIPGFMCQGGDFTRGNGTGGESIYGARFADENFKLRHTGPGVLSMANAGPDTNGSQFF  121

Query  625  ITFKRQPHLD  654
            I   + P LD
Sbjct  122  ICTAQTPWLD  131



>gb|ACG35589.1| peptidyl-prolyl cis-trans isomerase CYP19-3 [Zea mays]
Length=175

 Score =   192 bits (488),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 105/130 (81%), Gaps = 1/130 (1%)
 Frame = +1

Query  265  KNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIF  444
            KNP VFFD+        R+VMELFAD VP+TAENFR LCTGEKG+G S GKPLHYKG  F
Sbjct  3    KNPKVFFDILIGKSKAGRVVMELFADKVPKTAENFRCLCTGEKGLG-SAGKPLHYKGSAF  61

Query  445  HRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFF  624
            HR+I GFM QGGDF++GNGTGGESIYG +FADENFKL H+ PG+LSMAN+GP+TNGSQFF
Sbjct  62   HRVIPGFMCQGGDFTRGNGTGGESIYGARFADENFKLRHTGPGVLSMANAGPDTNGSQFF  121

Query  625  ITFKRQPHLD  654
            I   + P LD
Sbjct  122  ICTAQTPWLD  131



>emb|CAG46878.1| PPID [Homo sapiens]
 gb|AAX36351.1| peptidylprolyl isomerase D [synthetic construct]
Length=370

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_010268679.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Nelumbo nucifera]
Length=173

 Score =   192 bits (488),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD+S  G P  RIVMEL++DV PRTAENFRALCTGEKG+G S GKPLHYKG  FH
Sbjct  4    NPKVFFDMSIGGAPAGRIVMELYSDVTPRTAENFRALCTGEKGVGRS-GKPLHYKGSSFH  62

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RII GFM QGGDF+ GNGTGGESIYG KFADENF   H+ PG+LSMAN+GP TNGSQFFI
Sbjct  63   RIIPGFMCQGGDFTAGNGTGGESIYGSKFADENFIRKHTGPGVLSMANAGPGTNGSQFFI  122

Query  628  TFKRQPHLD  654
               +   LD
Sbjct  123  CTAKTEWLD  131



>ref|XP_001500384.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Equus caballus]
 ref|XP_008520910.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D [Equus przewalskii]
Length=370

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGRNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>gb|ACI66097.1| 40 kDa peptidyl-prolyl cis-trans isomerase [Salmo salar]
 gb|ACI66324.1| 40 kDa peptidyl-prolyl cis-trans isomerase [Salmo salar]
Length=371

 Score =   198 bits (504),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 109/149 (73%), Gaps = 7/149 (5%)
 Frame = +1

Query  208  SDRVPVTPVGLFEWKVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTG  387
            S+  PVT       K   K+NP VFFDV   G  V RIV ELFADVVP+TAENFRALCTG
Sbjct  2    SNATPVT-------KPSNKENPRVFFDVDIGGERVGRIVFELFADVVPKTAENFRALCTG  54

Query  388  EKGIGDSTGKPLHYKGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSE  567
            EKG G +TGKPLH+KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H +
Sbjct  55   EKGTGKTTGKPLHFKGCPFHRIIKQFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDK  114

Query  568  PGLLSMANSGPNTNGSQFFITFKRQPHLD  654
             GLLSMANSGP TNGSQFFIT     HLD
Sbjct  115  EGLLSMANSGPATNGSQFFITTVPTAHLD  143



>ref|XP_003970715.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D-like, partial 
[Takifugu rubripes]
Length=174

 Score =   192 bits (488),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = +1

Query  250  KVMKKKNPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHY  429
            K    +NP VF DV   G    R+V+ELFADV P+TAENFRALCTGEKG G STGKPLH+
Sbjct  9    KPTNPENPRVFLDVDIGGERAGRLVLELFADVAPKTAENFRALCTGEKGTGKSTGKPLHF  68

Query  430  KGCIFHRIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTN  609
            KGC FHRIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+GPNTN
Sbjct  69   KGCPFHRIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYMHDKVGLLSMANAGPNTN  128

Query  610  GSQFFITFKRQPHLD  654
            GSQFFIT    PHLD
Sbjct  129  GSQFFITTVPTPHLD  143



>ref|XP_010233732.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Brachypodium 
distachyon]
Length=172

 Score =   192 bits (488),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD+S  G P  RIVMEL+AD VPRTAENFRALCTGEKG+G   GKPLHYKG  FH
Sbjct  3    NPKVFFDMSVGGAPAGRIVMELYADTVPRTAENFRALCTGEKGVG-KCGKPLHYKGSSFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+I  FM QGGDF+KGNGTGGESIYG KFADE F   H+ PG+LSMAN+GPNTNGSQFFI
Sbjct  62   RVITDFMCQGGDFTKGNGTGGESIYGEKFADEKFVHKHTGPGVLSMANAGPNTNGSQFFI  121

Query  628  TFKRQPHLD  654
               + P LD
Sbjct  122  CTVKTPWLD  130



>gb|EFB29938.1| hypothetical protein PANDA_010618 [Ailuropoda melanoleuca]
Length=341

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RIV+ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGPTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H + GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



>ref|XP_006487422.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like [Citrus 
sinensis]
 gb|KDO38753.1| hypothetical protein CISIN_1g030245mg [Citrus sinensis]
Length=180

 Score =   192 bits (488),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFD++  G P  RIVMELFADV PRTAENFRALCTGEKGIG S GKPLHYKG  FH
Sbjct  3    NPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFRALCTGEKGIGKS-GKPLHYKGSSFH  61

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            R+I GFM QGGDF+ GNGTGGESIYG KFADENF   H+ PG+LSMAN+GP TNGSQFFI
Sbjct  62   RVIPGFMCQGGDFTAGNGTGGESIYGSKFADENFVKKHTGPGILSMANAGPGTNGSQFFI  121

Query  628  TFKRQPHLD  654
            +  +   LD
Sbjct  122  SAGKTEWLD  130



>ref|XP_004450852.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform 1 [Dasypus 
novemcinctus]
 ref|XP_004450853.1| PREDICTED: peptidyl-prolyl cis-trans isomerase D isoform 2 [Dasypus 
novemcinctus]
Length=370

 Score =   198 bits (504),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = +1

Query  268  NPLVFFDVSFDGGPVQRIVMELFADVVPRTAENFRALCTGEKGIGDSTGKPLHYKGCIFH  447
            NP VFFDV   G  V RI++ELFAD+VP+TAENFRALCTGEKGIG +TGKPLH+KGC FH
Sbjct  15   NPRVFFDVDIGGERVGRIILELFADIVPKTAENFRALCTGEKGIGSTTGKPLHFKGCPFH  74

Query  448  RIIKGFMAQGGDFSKGNGTGGESIYGGKFADENFKLDHSEPGLLSMANSGPNTNGSQFFI  627
            RIIK FM QGGDFS  NGTGGESIYG KF DENF   H   GLLSMAN+G NTNGSQFFI
Sbjct  75   RIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDHEGLLSMANAGCNTNGSQFFI  134

Query  628  TFKRQPHLD  654
            T    PHLD
Sbjct  135  TTVPTPHLD  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875