BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045J07

Length=626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009772211.1|  PREDICTED: probable serine/threonine-protein...    175   4e-51   Nicotiana sylvestris
ref|XP_006359171.1|  PREDICTED: probable serine/threonine-protein...    172   5e-51   Solanum tuberosum [potatoes]
ref|XP_004229357.1|  PREDICTED: probable serine/threonine-protein...    171   2e-50   Solanum lycopersicum
ref|XP_011087141.1|  PREDICTED: AP2-associated protein kinase 1 i...    172   5e-50   Sesamum indicum [beniseed]
ref|XP_011087152.1|  PREDICTED: probable serine/threonine-protein...    172   5e-50   Sesamum indicum [beniseed]
ref|XP_011087144.1|  PREDICTED: AP2-associated protein kinase 1 i...    172   5e-50   Sesamum indicum [beniseed]
ref|XP_009607019.1|  PREDICTED: probable serine/threonine-protein...    170   9e-50   Nicotiana tomentosiformis
gb|KDP20398.1|  hypothetical protein JCGZ_05281                         168   3e-48   Jatropha curcas
gb|EYU27100.1|  hypothetical protein MIMGU_mgv1a022935mg                164   5e-48   Erythranthe guttata [common monkey flower]
emb|CDP07694.1|  unnamed protein product                                164   7e-48   Coffea canephora [robusta coffee]
ref|XP_008461768.1|  PREDICTED: probable serine/threonine-protein...    166   1e-47   Cucumis melo [Oriental melon]
ref|XP_004149621.1|  PREDICTED: uncharacterized protein LOC101211119    166   1e-47   Cucumis sativus [cucumbers]
ref|XP_010659599.1|  PREDICTED: probable serine/threonine-protein...    162   2e-47   Vitis vinifera
ref|XP_010659600.1|  PREDICTED: probable serine/threonine-protein...    162   2e-47   Vitis vinifera
ref|XP_010659601.1|  PREDICTED: probable serine/threonine-protein...    162   1e-46   Vitis vinifera
ref|XP_011468799.1|  PREDICTED: AP2-associated protein kinase 1 i...    166   1e-46   Fragaria vesca subsp. vesca
ref|XP_004306499.1|  PREDICTED: AP2-associated protein kinase 1 i...    166   1e-46   Fragaria vesca subsp. vesca
ref|XP_010257448.1|  PREDICTED: serine/threonine-protein kinase p...    166   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010257450.1|  PREDICTED: serine/threonine-protein kinase p...    166   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010257449.1|  PREDICTED: serine/threonine-protein kinase p...    166   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010265879.1|  PREDICTED: probable serine/threonine-protein...    164   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010265881.1|  PREDICTED: probable serine/threonine-protein...    164   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_008808088.1|  PREDICTED: AP2-associated protein kinase 1-like    155   4e-46   Phoenix dactylifera
ref|XP_009339572.1|  PREDICTED: AP2-associated protein kinase 1         160   5e-46   Pyrus x bretschneideri [bai li]
ref|XP_008392404.1|  PREDICTED: AP2-associated protein kinase 1         160   5e-46   Malus domestica [apple tree]
ref|XP_010678702.1|  PREDICTED: probable serine/threonine-protein...    163   5e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002512151.1|  serine/threonine protein kinase, putative          164   6e-46   Ricinus communis
emb|CBI32193.3|  unnamed protein product                                158   6e-46   Vitis vinifera
ref|XP_003531422.1|  PREDICTED: probable serine/threonine-protein...    154   8e-46   Glycine max [soybeans]
ref|XP_007052604.1|  Serine/threonine-protein kinase DDB_G0280111...    165   8e-46   
ref|XP_007052606.1|  Serine/threonine-protein kinase DDB_G0280111...    165   8e-46   
ref|XP_007052605.1|  Serine/threonine-protein kinase DDB_G0280111...    165   8e-46   
ref|XP_006369447.1|  hypothetical protein POPTR_0001s23520g             163   1e-45   
ref|XP_004513162.1|  PREDICTED: probable serine/threonine-protein...    156   1e-45   
gb|KJB22768.1|  hypothetical protein B456_004G065000                    161   2e-45   Gossypium raimondii
gb|KJB22767.1|  hypothetical protein B456_004G065000                    161   2e-45   Gossypium raimondii
gb|KJB22766.1|  hypothetical protein B456_004G065000                    161   2e-45   Gossypium raimondii
gb|KHG06229.1|  putative serine/threonine-protein kinase                161   2e-45   Gossypium arboreum [tree cotton]
ref|XP_008231319.1|  PREDICTED: AP2-associated protein kinase 1 i...    157   2e-45   Prunus mume [ume]
ref|XP_008231321.1|  PREDICTED: AP2-associated protein kinase 1 i...    157   2e-45   Prunus mume [ume]
ref|XP_008231320.1|  PREDICTED: AP2-associated protein kinase 1 i...    157   2e-45   Prunus mume [ume]
ref|XP_007149359.1|  hypothetical protein PHAVU_005G063700g             154   2e-45   Phaseolus vulgaris [French bean]
ref|XP_007149360.1|  hypothetical protein PHAVU_005G063700g             154   2e-45   Phaseolus vulgaris [French bean]
gb|KDO46086.1|  hypothetical protein CISIN_1g005558mg                   157   2e-45   Citrus sinensis [apfelsine]
ref|XP_006482821.1|  PREDICTED: probable serine/threonine-protein...    157   2e-45   Citrus sinensis [apfelsine]
ref|XP_006439043.1|  hypothetical protein CICLE_v10030862mg             157   2e-45   Citrus clementina [clementine]
gb|KDO46085.1|  hypothetical protein CISIN_1g005558mg                   157   2e-45   Citrus sinensis [apfelsine]
ref|XP_006482823.1|  PREDICTED: probable serine/threonine-protein...    157   2e-45   Citrus sinensis [apfelsine]
ref|XP_006439041.1|  hypothetical protein CICLE_v10030862mg             157   2e-45   Citrus clementina [clementine]
ref|XP_006482824.1|  PREDICTED: probable serine/threonine-protein...    157   2e-45   Citrus sinensis [apfelsine]
ref|XP_006439040.1|  hypothetical protein CICLE_v10030862mg             157   2e-45   
ref|XP_007220628.1|  hypothetical protein PRUPE_ppa002321mg             157   2e-45   
emb|CAN60313.1|  hypothetical protein VITISV_036304                     158   3e-45   Vitis vinifera
ref|XP_010943528.1|  PREDICTED: AP2-associated protein kinase 1-like    157   7e-45   Elaeis guineensis
ref|XP_010670934.1|  PREDICTED: actin-regulating kinase PRK1-like       159   1e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS73129.1|  hypothetical protein M569_01626                         159   2e-44   Genlisea aurea
ref|XP_003546865.1|  PREDICTED: probable serine/threonine-protein...    150   4e-44   Glycine max [soybeans]
ref|XP_008805476.1|  PREDICTED: AP2-associated protein kinase 1-like    157   4e-44   Phoenix dactylifera
ref|XP_010542987.1|  PREDICTED: AP2-associated protein kinase 1-l...    157   4e-44   Tarenaya hassleriana [spider flower]
ref|XP_010542991.1|  PREDICTED: AP2-associated protein kinase 1-l...    157   4e-44   Tarenaya hassleriana [spider flower]
ref|XP_010522383.1|  PREDICTED: probable serine/threonine-protein...    157   6e-44   Tarenaya hassleriana [spider flower]
ref|XP_010522378.1|  PREDICTED: probable serine/threonine-protein...    157   6e-44   Tarenaya hassleriana [spider flower]
gb|KEH33173.1|  Serine/Threonine kinase family protein                  152   7e-44   Medicago truncatula
ref|XP_010027724.1|  PREDICTED: AP2-associated protein kinase 1 i...    153   8e-44   
ref|XP_010027725.1|  PREDICTED: AP2-associated protein kinase 1 i...    153   8e-44   Eucalyptus grandis [rose gum]
ref|XP_010095876.1|  putative serine/threonine-protein kinase           165   9e-44   
ref|XP_010913910.1|  PREDICTED: probable serine/threonine-protein...    157   1e-43   Elaeis guineensis
dbj|BAD95980.1|  Ser/Thr protein kinase                                 152   1e-43   Lotus japonicus
gb|AFK44489.1|  unknown                                                 152   1e-43   Lotus japonicus
ref|XP_006647439.1|  PREDICTED: probable serine/threonine-protein...    154   2e-43   Oryza brachyantha
dbj|BAD34080.1|  cyclin G-associated kinase-like protein                154   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002881248.1|  hypothetical protein ARALYDRAFT_482227             153   7e-43   
ref|XP_008677437.1|  PREDICTED: uncharacterized protein LOC100304...    154   2e-42   
ref|XP_004952948.1|  PREDICTED: AP2-associated protein kinase 1-l...    155   2e-42   Setaria italica
ref|XP_006410418.1|  hypothetical protein EUTSA_v10016354mg             153   3e-42   Eutrema salsugineum [saltwater cress]
ref|XP_009408443.1|  PREDICTED: AP2-associated protein kinase 1 {...    148   4e-42   
ref|XP_003575255.1|  PREDICTED: probable serine/threonine-protein...    154   5e-42   Brachypodium distachyon [annual false brome]
ref|NP_850199.1|  protein kinase superfamily protein                    152   6e-42   Arabidopsis thaliana [mouse-ear cress]
gb|AAL60023.1|  putative serine/threonine protein kinase                152   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565756.1|  protein kinase superfamily protein                    152   6e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004952949.1|  PREDICTED: AP2-associated protein kinase 1-l...    153   7e-42   Setaria italica
dbj|BAD34081.1|  putative AAK1 protein                                  149   7e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006293803.1|  hypothetical protein CARUB_v10022785mg             151   7e-42   Capsella rubella
ref|XP_010413940.1|  PREDICTED: probable serine/threonine-protein...    151   7e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010469538.1|  PREDICTED: probable serine/threonine-protein...    151   8e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010469539.1|  PREDICTED: probable serine/threonine-protein...    151   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010469540.1|  PREDICTED: probable serine/threonine-protein...    151   1e-41   Camelina sativa [gold-of-pleasure]
gb|EMT28285.1|  Putative serine/threonine-protein kinase                155   1e-41   
ref|XP_009143925.1|  PREDICTED: probable serine/threonine-protein...    153   1e-41   Brassica rapa
ref|XP_006850020.1|  hypothetical protein AMTR_s00022p00186280          151   2e-41   Amborella trichopoda
ref|XP_010509956.1|  PREDICTED: probable serine/threonine-protein...    151   3e-41   Camelina sativa [gold-of-pleasure]
ref|XP_009395097.1|  PREDICTED: AP2-associated protein kinase 1 {...    149   5e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010235619.1|  PREDICTED: probable serine/threonine-protein...    150   6e-41   Brachypodium distachyon [annual false brome]
ref|XP_004956476.1|  PREDICTED: probable serine/threonine-protein...    152   6e-41   Setaria italica
ref|XP_009394517.1|  PREDICTED: AP2-associated protein kinase 1 {...    155   1e-40   
gb|AFW72091.1|  putative protein kinase superfamily protein             155   6e-40   
emb|CDY52551.1|  BnaA05g35100D                                          147   7e-40   Brassica napus [oilseed rape]
emb|CDX79504.1|  BnaC03g18400D                                          147   1e-39   
ref|XP_009132906.1|  PREDICTED: probable serine/threonine-protein...    146   1e-39   Brassica rapa
emb|CDX84704.1|  BnaA03g15260D                                          145   3e-39   
gb|AFW72092.1|  putative protein kinase superfamily protein             151   3e-39   
tpg|DAA39365.1|  TPA: putative protein kinase superfamily protein       144   2e-38   
ref|XP_011042010.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...    140   9e-38   Populus euphratica
ref|XP_008671591.1|  PREDICTED: probable serine/threonine-protein...    141   1e-37   
gb|EEE69334.1|  hypothetical protein OsJ_28650                          135   1e-35   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD26025.1|  putative AAK1 protein                                  135   1e-35   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ08411.1|  hypothetical protein OsI_30675                          135   1e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_010237997.1|  PREDICTED: AP2-associated protein kinase 1-like    142   2e-35   Brachypodium distachyon [annual false brome]
dbj|BAJ97005.1|  predicted protein                                      142   2e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT09791.1|  Putative serine/threonine-protein kinase                139   8e-35   
ref|XP_002972735.1|  hypothetical protein SELMODRAFT_98319              133   3e-34   
ref|XP_002993350.1|  hypothetical protein SELMODRAFT_187420             129   6e-33   
ref|XP_006660487.1|  PREDICTED: AP2-associated protein kinase 1-like    126   4e-32   Oryza brachyantha
ref|XP_001769351.1|  predicted protein                                  122   2e-29   
emb|CDY12158.1|  BnaC04g11880D                                          115   3e-26   Brassica napus [oilseed rape]
ref|XP_011087160.1|  PREDICTED: AP2-associated protein kinase 1 i...  92.4    5e-18   Sesamum indicum [beniseed]
gb|EKC40964.1|  Cyclin G-associated kinase                            83.2    1e-14   
ref|XP_011427792.1|  PREDICTED: cyclin-G-associated kinase-like       83.2    1e-14   Crassostrea gigas
gb|ERL88847.1|  hypothetical protein D910_06229                       79.0    2e-13   Dendroctonus ponderosae
gb|ENN75844.1|  hypothetical protein YQE_07573                        79.0    2e-13   Dendroctonus ponderosae
ref|XP_001742841.1|  hypothetical protein                             77.0    6e-13   Monosiga brevicollis MX1
ref|XP_967193.1|  PREDICTED: cyclin-G-associated kinase               77.8    6e-13   Tribolium castaneum [rust-red flour beetle]
ref|XP_004927169.1|  PREDICTED: cyclin-G-associated kinase-like       73.6    4e-12   Bombyx mori [silk moth]
ref|XP_003934667.1|  PREDICTED: cyclin-G-associated kinase isofor...  75.1    4e-12   Saimiri boliviensis boliviensis
pdb|4C59|A  Chain A, Structure Of Gak Kinase In Complex With Nano...  72.4    8e-12   Homo sapiens [man]
dbj|BAK62989.1|  cyclin G-associated kinase                           72.8    1e-11   Pan troglodytes
ref|XP_010804661.1|  PREDICTED: cyclin-G-associated kinase isofor...  73.9    1e-11   
ref|NP_001039549.1|  cyclin-G-associated kinase                       73.9    1e-11   Bos taurus [bovine]
tpg|DAA28426.1|  TPA: cyclin-G-associated kinase                      73.9    1e-11   Bos taurus [bovine]
gb|EAW82645.1|  cyclin G associated kinase, isoform CRA_b             72.8    2e-11   Homo sapiens [man]
gb|EDL20101.1|  cyclin G associated kinase, isoform CRA_c             68.6    2e-11   Mus musculus [mouse]
ref|XP_004521204.1|  PREDICTED: cyclin-G-associated kinase-like i...  72.8    2e-11   
ref|XP_005272330.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   
ref|XP_004521203.1|  PREDICTED: cyclin-G-associated kinase-like i...  72.8    2e-11   Ceratitis capitata [medfly]
ref|XP_009445459.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   
ref|XP_008961966.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Pan paniscus [bonobo]
ref|XP_008016367.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Chlorocebus sabaeus
ref|XP_005272327.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Homo sapiens [man]
ref|XP_008016366.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Chlorocebus sabaeus
ref|XP_005554310.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Macaca fascicularis [crab eating macaque]
ref|XP_005272326.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   
ref|XP_009445456.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   
ref|XP_008961964.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Pan paniscus [bonobo]
ref|XP_009445453.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   
ref|XP_008961962.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Pan paniscus [bonobo]
ref|XP_005272325.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Homo sapiens [man]
ref|XP_009445452.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   
ref|XP_010373626.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   
ref|XP_008016365.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Chlorocebus sabaeus
ref|NP_005246.2|  cyclin-G-associated kinase isoform 1                72.8    2e-11   Homo sapiens [man]
dbj|BAA22623.1|  HsGAK                                                72.8    2e-11   Homo sapiens [man]
ref|XP_005554309.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Macaca fascicularis [crab eating macaque]
ref|XP_004038357.1|  PREDICTED: cyclin-G-associated kinase isoform 1  72.8    2e-11   
ref|NP_001125100.1|  cyclin-G-associated kinase                       72.8    2e-11   Pongo abelii [orang utan]
ref|XP_003811350.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Pan paniscus [bonobo]
gb|EHH14197.1|  Cyclin-G-associated kinase                            72.8    2e-11   Macaca mulatta [rhesus macaque]
ref|XP_001140835.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   
ref|XP_009445451.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   
ref|XP_008961961.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Pan paniscus [bonobo]
ref|XP_009445450.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   
ref|XP_008961960.1|  PREDICTED: cyclin-G-associated kinase isofor...  72.8    2e-11   Pan paniscus [bonobo]
ref|XP_004993486.1|  NAK protein kinase                               72.4    3e-11   Salpingoeca rosetta
emb|CDR17154.1|  serine/threonine protein kinase, putative            72.4    3e-11   
ref|XP_536279.4|  PREDICTED: cyclin-G-associated kinase isoform X7    72.8    3e-11   Canis lupus familiaris [dogs]
ref|XP_010992219.1|  PREDICTED: cyclin-G-associated kinase            71.6    3e-11   
ref|XP_010992167.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  72.4    4e-11   
ref|XP_424873.4|  PREDICTED: cyclin-G-associated kinase               72.4    4e-11   Gallus gallus [bantam]
ref|XP_006874199.1|  PREDICTED: cyclin-G-associated kinase            72.0    4e-11   Chrysochloris asiatica
ref|XP_010787144.1|  PREDICTED: cyclin-G-associated kinase-like       69.3    5e-11   Notothenia coriiceps [yellowbelly rockcod]
ref|NP_001016350.2|  cyclin-G-associated kinase                       72.0    5e-11   Xenopus tropicalis [western clawed frog]
emb|CBY34407.1|  unnamed protein product                              71.6    5e-11   Oikopleura dioica
emb|CBY18714.1|  unnamed protein product                              71.6    5e-11   Oikopleura dioica
pdb|4O38|A  Chain A, Crystal Structure Of The Human Cyclin G Asso...  70.1    6e-11   Homo sapiens [man]
ref|XP_006747975.1|  PREDICTED: cyclin-G-associated kinase-like       71.6    6e-11   
ref|XP_004617496.1|  PREDICTED: cyclin-G-associated kinase            71.6    6e-11   Sorex araneus [Eurasian shrew]
ref|XP_004396292.1|  PREDICTED: cyclin-G-associated kinase            71.6    6e-11   Odobenus rosmarus divergens
ref|XP_008062193.1|  PREDICTED: cyclin-G-associated kinase            71.6    6e-11   Carlito syrichta
ref|XP_003801191.1|  PREDICTED: cyclin-G-associated kinase            71.6    6e-11   
ref|XP_008622630.1|  NAK protein kinase                               71.2    6e-11   Plasmodium vinckei vinckei
ref|XP_004383590.1|  PREDICTED: cyclin-G-associated kinase            71.6    6e-11   Trichechus manatus latirostris
ref|XP_003280582.1|  PREDICTED: cyclin-G-associated kinase            71.6    7e-11   
emb|CDS52482.1|  serine/threonine protein kinase, putative            71.2    7e-11   
gb|EHJ76158.1|  hypothetical protein KGM_16646                        71.2    7e-11   
ref|XP_010227060.1|  PREDICTED: cyclin-G-associated kinase            71.2    8e-11   Tinamus guttatus
ref|XP_007671018.1|  PREDICTED: cyclin-G-associated kinase isofor...  71.2    8e-11   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_007671017.1|  PREDICTED: cyclin-G-associated kinase isofor...  71.2    8e-11   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_007671016.1|  PREDICTED: cyclin-G-associated kinase isofor...  71.2    8e-11   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_007671015.1|  PREDICTED: cyclin-G-associated kinase isofor...  71.2    8e-11   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_009052187.1|  hypothetical protein LOTGIDRAFT_174596           71.2    9e-11   Lottia gigantea
gb|EDL20100.1|  cyclin G associated kinase, isoform CRA_b             66.6    9e-11   Mus musculus [mouse]
ref|XP_004432258.1|  PREDICTED: cyclin-G-associated kinase            71.2    9e-11   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_007557930.1|  PREDICTED: cyclin-G-associated kinase            71.2    9e-11   Poecilia formosa
ref|XP_008416260.1|  PREDICTED: cyclin-G-associated kinase isofor...  71.2    9e-11   Poecilia reticulata
ref|XP_008416258.1|  PREDICTED: cyclin-G-associated kinase isofor...  71.2    9e-11   Poecilia reticulata
gb|KDR23238.1|  Cyclin G-associated kinase                            71.2    9e-11   Zootermopsis nevadensis
dbj|GAM19078.1|  hypothetical protein SAMD00019534_022530             70.9    1e-10   Acytostelium subglobosum LB1
ref|XP_007181552.1|  PREDICTED: cyclin-G-associated kinase            70.9    1e-10   Balaenoptera acutorostrata scammoni
ref|XP_009562989.1|  PREDICTED: cyclin-G-associated kinase            70.9    1e-10   Cuculus canorus
ref|XP_003341497.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  70.9    1e-10   
ref|XP_006790164.1|  PREDICTED: cyclin-G-associated kinase-like       70.9    1e-10   Neolamprologus brichardi [lyretail cichlid]
ref|XP_002187781.1|  PREDICTED: cyclin-G-associated kinase            70.9    1e-10   
ref|XP_004546976.1|  PREDICTED: cyclin-G-associated kinase-like i...  70.9    1e-10   
ref|XP_004546975.1|  PREDICTED: cyclin-G-associated kinase-like i...  70.9    1e-10   
ref|XP_005738184.1|  PREDICTED: cyclin-G-associated kinase-like       70.9    1e-10   Pundamilia nyererei
ref|XP_004546974.1|  PREDICTED: cyclin-G-associated kinase-like i...  70.9    1e-10   
ref|XP_005924577.1|  PREDICTED: cyclin-G-associated kinase-like       70.9    1e-10   
ref|XP_005061068.1|  PREDICTED: cyclin-G-associated kinase            70.9    1e-10   Ficedula albicollis
ref|XP_005154929.1|  PREDICTED: cyclin-G-associated kinase            70.9    1e-10   Melopsittacus undulatus
ref|XP_005486323.1|  PREDICTED: cyclin-G-associated kinase            70.9    1e-10   Zonotrichia albicollis
ref|XP_007953955.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.9    1e-10   Orycteropus afer afer
ref|XP_006259318.1|  PREDICTED: cyclin-G-associated kinase            70.9    1e-10   Alligator mississippiensis
gb|ETW29800.1|  NAK protein kinase                                    69.7    1e-10   Plasmodium falciparum FCH/4
ref|XP_005530967.1|  PREDICTED: cyclin-G-associated kinase            70.5    1e-10   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009299490.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.5    1e-10   Danio rerio [leopard danio]
ref|XP_009299489.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.5    1e-10   Danio rerio [leopard danio]
ref|XP_009299488.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.5    1e-10   Danio rerio [leopard danio]
emb|CDU20974.1|  serine/threonine protein kinase, putative            70.1    1e-10   Plasmodium yoelii
ref|XP_005359727.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.5    1e-10   Microtus ochrogaster [prairie voles]
ref|XP_005359726.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.5    1e-10   
ref|XP_005359725.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.5    1e-10   
gb|ETB62031.1|  NAK protein kinase                                    70.1    1e-10   Plasmodium yoelii 17X
ref|XP_004319454.1|  PREDICTED: cyclin-G-associated kinase-like       70.5    1e-10   
ref|XP_005309018.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.5    1e-10   Chrysemys picta bellii
gb|ETW35160.1|  NAK protein kinase                                    69.7    2e-10   Plasmodium falciparum Tanzania (2000708)
ref|XP_004265273.1|  PREDICTED: cyclin-G-associated kinase            70.5    2e-10   
gb|EUD74684.1|  NAK protein kinase                                    70.1    2e-10   Plasmodium vinckei petteri
gb|ETW59946.1|  NAK protein kinase                                    69.7    2e-10   Plasmodium falciparum CAMP/Malaysia
gb|EMC87866.1|  Cyclin G-associated kinase                            70.5    2e-10   
ref|XP_005504640.1|  PREDICTED: cyclin-G-associated kinase            70.5    2e-10   Columba livia [carrier pigeon]
ref|XP_006534969.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.1    2e-10   
gb|ETW47992.1|  NAK protein kinase                                    69.7    2e-10   Plasmodium falciparum MaliPS096_E11
ref|XP_006534968.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.1    2e-10   Mus musculus [mouse]
gb|EDL20099.1|  cyclin G associated kinase, isoform CRA_a             70.1    2e-10   Mus musculus [mouse]
dbj|BAE27365.1|  unnamed protein product                              70.1    2e-10   Mus musculus [mouse]
ref|NP_705797.1|  cyclin-G-associated kinase isoform 1                70.1    2e-10   Mus musculus [mouse]
sp|Q99KY4.2|GAK_MOUSE  RecName: Full=Cyclin-G-associated kinase       70.1    2e-10   Mus musculus [mouse]
ref|XP_004656112.1|  PREDICTED: cyclin-G-associated kinase            70.1    2e-10   Jaculus jaculus
gb|EDL20105.1|  cyclin G associated kinase, isoform CRA_g             70.1    2e-10   Mus musculus [mouse]
ref|XP_008281749.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.1    2e-10   Stegastes partitus
ref|XP_008281748.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.1    2e-10   Stegastes partitus
ref|XP_008281747.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.1    2e-10   Stegastes partitus
ref|XP_008281746.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.1    2e-10   Stegastes partitus
ref|XP_005801068.1|  PREDICTED: cyclin-G-associated kinase-like       70.1    2e-10   
gb|AAH63606.1|  GAK protein                                           69.3    2e-10   Homo sapiens [man]
ref|XP_004847543.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   
ref|XP_006893652.1|  PREDICTED: cyclin-G-associated kinase isofor...  70.1    2e-10   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008840008.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Nannospalax galili
ref|XP_006250646.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Rattus norvegicus [brown rat]
ref|XP_008840007.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Nannospalax galili
ref|XP_006985869.1|  PREDICTED: cyclin-G-associated kinase            69.7    2e-10   Peromyscus maniculatus bairdii
ref|XP_006250645.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Rattus norvegicus [brown rat]
ref|XP_008840006.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Nannospalax galili
ref|XP_005077467.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Mesocricetus auratus [Syrian golden hamster]
ref|XP_008840005.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Nannospalax galili
ref|XP_005077466.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   
ref|NP_112292.1|  cyclin-G-associated kinase                          69.7    2e-10   Rattus norvegicus [brown rat]
ref|XP_004847542.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Heterocephalus glaber [naked mole rat]
ref|XP_004847541.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Heterocephalus glaber [naked mole rat]
ref|XP_005408741.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Chinchilla lanigera
ref|XP_004847540.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Heterocephalus glaber [naked mole rat]
ref|XP_005319114.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Ictidomys tridecemlineatus
ref|XP_005319113.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Ictidomys tridecemlineatus
ref|XP_004847539.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   
ref|XP_004847536.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Heterocephalus glaber [naked mole rat]
ref|XP_005408740.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   
ref|XP_005001604.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   
ref|XP_005408739.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Chinchilla lanigera
ref|XP_004624694.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   
ref|XP_003465097.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Cavia porcellus [guinea pig]
ref|XP_004624693.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.7    2e-10   Octodon degus
ref|XP_011210451.1|  PREDICTED: cyclin-G-associated kinase            69.7    2e-10   Bactrocera dorsalis [papaya fruit fly]
ref|XP_004579463.1|  PREDICTED: cyclin-G-associated kinase            69.7    2e-10   Ochotona princeps [southern American pika]
ref|XP_008250941.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  69.7    2e-10   
ref|XP_001659927.1|  AAEL009305-PA                                    69.3    3e-10   
gb|EUT81971.1|  NAK protein kinase                                    69.3    3e-10   Plasmodium falciparum Santa Lucia
gb|EWC87212.1|  NAK protein kinase                                    69.3    3e-10   Plasmodium falciparum NF54
gb|KGB40797.1|  Cyclin-G-associated kinase                            69.7    3e-10   Schistosoma haematobium
gb|ETW17328.1|  hypothetical protein PFFVO_03760                      69.3    3e-10   Plasmodium falciparum Vietnam Oak-Knoll (FVO)
gb|EWC75117.1|  NAK protein kinase                                    69.3    3e-10   Plasmodium falciparum UGT5.1
gb|ETW41321.1|  NAK protein kinase                                    69.3    3e-10   
gb|ETW56100.1|  hypothetical protein PFUGPA_01883                     69.3    3e-10   
gb|EUR67530.1|  NAK protein kinase                                    69.3    3e-10   
ref|XP_788316.3|  PREDICTED: cyclin-G-associated kinase-like          69.3    3e-10   
ref|XP_001350860.1|  cyclin g-associated kinase, putative             69.3    3e-10   
gb|ETN63491.1|  cyclin G-associated kinase                            69.3    3e-10   
ref|XP_005459853.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.3    3e-10   
ref|XP_005459852.1|  PREDICTED: cyclin-G-associated kinase isofor...  69.3    3e-10   
dbj|BAH70871.1|  ACYPI007546                                          64.7    4e-10   
ref|XP_008818509.1|  NAK protein kinase                               68.9    4e-10   
gb|KFO25685.1|  Cyclin-G-associated kinase                            68.9    4e-10   
ref|XP_011477121.1|  PREDICTED: cyclin-G-associated kinase isofor...  68.9    4e-10   
ref|XP_011477119.1|  PREDICTED: cyclin-G-associated kinase isofor...  68.9    4e-10   
ref|XP_005177594.2|  PREDICTED: uncharacterized protein LOC101899618  68.9    4e-10   
ref|XP_006626815.1|  PREDICTED: BMP-2-inducible protein kinase-like   68.9    5e-10   
ref|XP_011293498.1|  PREDICTED: cyclin-G-associated kinase            68.9    5e-10   
ref|XP_011178096.1|  PREDICTED: cyclin-G-associated kinase            68.9    5e-10   
emb|CAG08624.1|  unnamed protein product                              68.6    5e-10   
ref|XP_003411399.1|  PREDICTED: cyclin-G-associated kinase            68.6    6e-10   
emb|CDO65747.1|  serine/threonine protein kinase, putative            68.2    7e-10   
ref|XP_001614000.1|  cyclin g-associated kinase                       67.8    8e-10   
ref|XP_007467967.1|  PREDICTED: cyclin-G-associated kinase            67.8    9e-10   
ref|XP_008333412.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  67.8    1e-09   
gb|KFB52665.1|  AGAP003715-PA-like protein                            67.8    1e-09   
ref|XP_010900693.1|  PREDICTED: BMP-2-inducible protein kinase        67.4    1e-09   
gb|KIO24181.1|  hypothetical protein M407DRAFT_9071                   67.4    1e-09   
ref|XP_006815331.1|  PREDICTED: cyclin-G-associated kinase-like       67.4    1e-09   
ref|XP_006008247.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  67.4    1e-09   
ref|XP_007641164.1|  PREDICTED: cyclin-G-associated kinase isofor...  67.4    2e-09   
ref|XP_007641163.1|  PREDICTED: cyclin-G-associated kinase isofor...  67.4    2e-09   
ref|XP_003502409.1|  PREDICTED: cyclin-G-associated kinase isofor...  67.4    2e-09   
ref|XP_007895169.1|  PREDICTED: BMP-2-inducible protein kinase is...  67.0    2e-09   
ref|XP_007895168.1|  PREDICTED: BMP-2-inducible protein kinase is...  67.0    2e-09   
ref|XP_007895167.1|  PREDICTED: BMP-2-inducible protein kinase is...  67.0    2e-09   
ref|XP_641248.1|  hypothetical protein DDB_G0280111                   67.0    2e-09   
ref|XP_003975276.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  67.0    2e-09   
ref|XP_310244.7|  AGAP003715-PA                                       67.0    2e-09   
ref|XP_009860888.1|  PREDICTED: AP2-associated protein kinase 1-like  65.9    2e-09   
ref|XP_005965721.1|  PREDICTED: BMP-2-inducible protein kinase        66.6    2e-09   
ref|XP_008334592.1|  PREDICTED: cyclin-G-associated kinase-like i...  66.6    2e-09   
ref|XP_008334591.1|  PREDICTED: cyclin-G-associated kinase-like i...  66.6    2e-09   
ref|XP_008334590.1|  PREDICTED: cyclin-G-associated kinase-like i...  66.6    2e-09   
ref|XP_005095147.1|  PREDICTED: BMP-2-inducible protein kinase-li...  66.6    3e-09   
ref|XP_005095146.1|  PREDICTED: BMP-2-inducible protein kinase-li...  66.6    3e-09   
ref|XP_011180272.1|  PREDICTED: probable serine/threonine-protein...  66.2    4e-09   
ref|XP_001183215.2|  PREDICTED: AP2-associated protein kinase 1-like  65.9    4e-09   
emb|CCD82118.1|  serine/threonine kinase                              66.2    4e-09   
ref|XP_008187196.1|  PREDICTED: AP2-associated protein kinase 1-like  65.5    4e-09   
ref|XP_011180270.1|  PREDICTED: mucin-4-like isoform X1               66.2    4e-09   
gb|KIJ53530.1|  hypothetical protein M422DRAFT_154775                 64.7    4e-09   
ref|XP_001650843.1|  AAEL005425-PA                                    65.9    4e-09   
ref|XP_006454173.1|  hypothetical protein AGABI2DRAFT_113930          65.9    5e-09   
ref|XP_007325758.1|  hypothetical protein AGABI1DRAFT_124351          65.9    5e-09   
gb|KDQ31201.1|  hypothetical protein PLEOSDRAFT_166468                65.5    5e-09   
ref|XP_003288978.1|  hypothetical protein DICPUDRAFT_98203            65.5    5e-09   
gb|ERE68184.1|  cyclin-G-associated kinase isoform 1                  65.5    5e-09   
ref|XP_008549661.1|  PREDICTED: cyclin-G-associated kinase            65.5    6e-09   
ref|XP_003737181.1|  PREDICTED: cyclin-G-associated kinase-like       65.5    6e-09   
ref|XP_006053805.1|  PREDICTED: LOW QUALITY PROTEIN: BMP-2-induci...  65.5    6e-09   
ref|NP_001291194.1|  BMP2 inducible kinase                            65.5    6e-09   
ref|XP_010804567.1|  PREDICTED: BMP-2-inducible protein kinase is...  65.5    6e-09   
ref|XP_010844280.1|  PREDICTED: BMP-2-inducible protein kinase        65.5    6e-09   
gb|KFB52772.1|  AGAP002469-PA-like protein                            65.1    6e-09   
dbj|GAM17149.1|  hypothetical protein SAMD00019534_003240             65.1    6e-09   
ref|XP_002002050.1|  GI17169                                          65.1    7e-09   
ref|NP_995725.1|  Numb-associated kinase, isoform C                   64.7    8e-09   
gb|AAM50024.1|  SD07306p                                              64.7    8e-09   
ref|NP_001286075.1|  Numb-associated kinase, isoform E                64.7    8e-09   
ref|XP_007250558.1|  PREDICTED: BMP-2-inducible protein kinase        64.7    8e-09   
ref|XP_009512526.1|  PREDICTED: cyclin-G-associated kinase-like       62.4    8e-09   
ref|NP_001008644.2|  BMP-2-inducible protein kinase isoform 2         64.3    9e-09   
ref|XP_002039039.1|  GM17048                                          64.7    9e-09   
ref|XP_002052662.1|  GJ17674                                          64.7    1e-08   
ref|XP_002090632.1|  GE12690                                          64.7    1e-08   
ref|XP_001974326.1|  GG21669                                          64.7    1e-08   
ref|NP_477165.1|  Numb-associated kinase, isoform A                   64.7    1e-08   
gb|AAF15596.1|AF197910_1  Numb-associated kinase                      64.7    1e-08   
ref|XP_002079851.1|  GD21795                                          64.7    1e-08   
ref|XP_004681247.1|  PREDICTED: BMP-2-inducible protein kinase        64.7    1e-08   
ref|XP_005165360.1|  PREDICTED: BMP-2-inducible protein kinase is...  64.3    1e-08   
ref|NP_001180469.1|  BMP-2-inducible protein kinase isoform 1         64.3    1e-08   
ref|XP_011501176.1|  PREDICTED: probable serine/threonine-protein...  64.7    1e-08   
gb|ETN63996.1|  numb-associated kinase                                64.3    1e-08   
ref|XP_011478072.1|  PREDICTED: BMP-2-inducible protein kinase is...  64.3    1e-08   
ref|XP_011478071.1|  PREDICTED: BMP-2-inducible protein kinase is...  64.3    1e-08   
gb|EFA74620.1|  putative protein serine/threonine kinase              64.3    1e-08   
gb|AAH86712.1|  BMP2 inducible kinase                                 64.3    1e-08   
ref|XP_008291952.1|  PREDICTED: AP2-associated protein kinase 1-l...  64.3    1e-08   
ref|XP_001989216.1|  GH11600                                          64.3    1e-08   
ref|XP_011217449.1|  PREDICTED: BMP-2-inducible protein kinase        64.3    1e-08   
ref|XP_008291951.1|  PREDICTED: AP2-associated protein kinase 1-l...  64.3    1e-08   
ref|XP_006931101.1|  PREDICTED: BMP-2-inducible protein kinase        64.3    1e-08   
ref|XP_006745295.1|  PREDICTED: BMP-2-inducible protein kinase        64.3    1e-08   
ref|XP_008291950.1|  PREDICTED: AP2-associated protein kinase 1-l...  64.3    1e-08   
ref|XP_008415987.1|  PREDICTED: BMP-2-inducible protein kinase is...  64.3    1e-08   
ref|XP_007547451.1|  PREDICTED: BMP-2-inducible protein kinase is...  64.3    1e-08   
ref|XP_008415986.1|  PREDICTED: BMP-2-inducible protein kinase is...  64.3    1e-08   
ref|XP_007547450.1|  PREDICTED: BMP-2-inducible protein kinase is...  64.3    1e-08   
gb|KIH69066.1|  hypothetical protein ANCDUO_00593                     62.4    1e-08   
gb|ELU08049.1|  hypothetical protein CAPTEDRAFT_20343                 64.3    1e-08   
ref|XP_010832592.1|  PREDICTED: cyclin-G-associated kinase            63.2    1e-08   
ref|XP_002934056.2|  PREDICTED: BMP-2-inducible protein kinase        64.3    1e-08   
emb|CDS29298.1|  cyclin g associated kinase                           64.3    1e-08   
ref|XP_010887763.1|  PREDICTED: cyclin-G-associated kinase isofor...  63.9    2e-08   
ref|XP_010887761.1|  PREDICTED: cyclin-G-associated kinase isofor...  63.9    2e-08   
ref|XP_008541165.1|  PREDICTED: BMP-2-inducible protein kinase        63.9    2e-08   
ref|XP_002262548.1|  cyclin g-associated kinase                       63.9    2e-08   
ref|XP_001845705.1|  numb-associated kinase                           63.9    2e-08   
ref|XP_004280214.1|  PREDICTED: BMP-2-inducible protein kinase        63.9    2e-08   
ref|XP_001962020.1|  GF14645                                          63.9    2e-08   
gb|ENN71442.1|  hypothetical protein YQE_11861                        63.5    2e-08   
ref|XP_005639161.1|  PREDICTED: BMP-2-inducible protein kinase is...  63.9    2e-08   
ref|XP_848894.1|  PREDICTED: BMP-2-inducible protein kinase isofo...  63.9    2e-08   
ref|XP_002162944.2|  PREDICTED: cyclin-G-associated kinase-like       63.9    2e-08   
gb|ERL92584.1|  hypothetical protein D910_09897                       63.5    2e-08   
ref|XP_003394812.1|  PREDICTED: hypothetical protein LOC100649017     63.9    2e-08   
ref|XP_003485667.1|  PREDICTED: hypothetical protein LOC100743336     63.9    2e-08   
ref|XP_005808845.1|  PREDICTED: BMP-2-inducible protein kinase-like   63.5    2e-08   
ref|XP_004430926.1|  PREDICTED: BMP-2-inducible protein kinase        63.5    2e-08   
ref|XP_001607688.1|  PREDICTED: cyclin-G-associated kinase isofor...  63.5    2e-08   
ref|XP_008333860.1|  PREDICTED: BMP-2-inducible protein kinase is...  63.5    2e-08   
ref|XP_008333859.1|  PREDICTED: BMP-2-inducible protein kinase is...  63.5    2e-08   
gb|ELR60814.1|  Cyclin-G-associated kinase                            63.5    2e-08   
ref|XP_005889683.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  63.5    2e-08   
ref|XP_005730713.1|  PREDICTED: BMP-2-inducible protein kinase-like   63.5    2e-08   
ref|XP_005359676.1|  PREDICTED: BMP-2-inducible protein kinase        63.5    2e-08   
ref|XP_005709052.1|  AP2-associated kinase                            62.0    3e-08   
ref|XP_006683092.1|  hypothetical protein BATDEDRAFT_92853            63.2    3e-08   
ref|XP_006569449.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  63.5    3e-08   
ref|XP_006611765.1|  PREDICTED: uncharacterized protein LOC102671523  63.5    3e-08   
ref|XP_006907729.1|  PREDICTED: BMP-2-inducible protein kinase        63.2    3e-08   
gb|EEZ99550.1|  hypothetical protein TcasGA2_TC000132                 63.2    3e-08   
ref|XP_008199560.1|  PREDICTED: serine/threonine-protein kinase HSL1  63.2    3e-08   
ref|XP_006006887.1|  PREDICTED: BMP-2-inducible protein kinase        63.2    3e-08   
ref|XP_010967703.1|  PREDICTED: BMP-2-inducible protein kinase        63.2    3e-08   
ref|XP_008304611.1|  PREDICTED: BMP-2-inducible protein kinase is...  63.2    3e-08   
ref|XP_008304609.1|  PREDICTED: BMP-2-inducible protein kinase is...  63.2    3e-08   
ref|XP_563710.4|  AGAP002469-PA                                       63.2    3e-08   
ref|XP_006258911.1|  PREDICTED: BMP-2-inducible protein kinase        63.2    3e-08   
ref|XP_004407285.1|  PREDICTED: BMP-2-inducible protein kinase        63.2    3e-08   
ref|XP_005735412.1|  PREDICTED: AP2-associated protein kinase 1-like  62.8    3e-08   
ref|XP_005451328.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.8    3e-08   
ref|XP_004538215.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.8    3e-08   
ref|XP_006788892.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.8    3e-08   
ref|XP_005451327.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.8    3e-08   
ref|XP_006788891.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.8    3e-08   
ref|XP_007455500.1|  PREDICTED: BMP-2-inducible protein kinase-like   61.6    3e-08   
ref|XP_006788890.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.8    3e-08   
ref|XP_005934691.1|  PREDICTED: AP2-associated protein kinase 1-like  62.8    3e-08   
ref|XP_004538214.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.8    3e-08   
ref|XP_006788889.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.8    3e-08   
ref|XP_005451326.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.8    3e-08   
ref|XP_003444511.1|  PREDICTED: BMP-2-inducible protein kinase-li...  62.8    4e-08   
ref|XP_005451563.1|  PREDICTED: BMP-2-inducible protein kinase-li...  62.8    4e-08   
ref|XP_006797821.1|  PREDICTED: BMP-2-inducible protein kinase-like   62.8    4e-08   
ref|XP_003974710.1|  PREDICTED: BMP-2-inducible protein kinase-like   62.8    4e-08   
ref|XP_008141932.1|  PREDICTED: BMP-2-inducible protein kinase        62.8    4e-08   
ref|XP_001635989.1|  predicted protein                                62.4    4e-08   
ref|XP_003700806.1|  PREDICTED: uncharacterized protein LOC100882026  62.8    4e-08   
gb|EGO04436.1|  hypothetical protein SERLA73DRAFT_68122               62.8    4e-08   
ref|XP_008422368.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.4    4e-08   
ref|XP_010779907.1|  PREDICTED: BMP-2-inducible protein kinase        62.8    4e-08   
ref|XP_008422367.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.4    4e-08   
ref|XP_008422366.1|  PREDICTED: AP2-associated protein kinase 1-l...  62.4    5e-08   
ref|XP_010749157.1|  PREDICTED: BMP-2-inducible protein kinase        62.4    5e-08   
gb|KDR18287.1|  AP2-associated protein kinase 1                       62.4    5e-08   
ref|XP_005144200.1|  PREDICTED: BMP-2-inducible protein kinase        62.4    5e-08   
ref|XP_010567486.1|  PREDICTED: cyclin-G-associated kinase-like       60.5    5e-08   
gb|KIY73545.1|  hypothetical protein CYLTODRAFT_448871                62.4    5e-08   
ref|XP_007107254.1|  PREDICTED: BMP-2-inducible protein kinase-like   61.6    6e-08   
ref|XP_005963600.1|  PREDICTED: cyclin-G-associated kinase            62.4    6e-08   
ref|XP_002066824.1|  GK24682                                          62.4    6e-08   
ref|XP_004555738.1|  PREDICTED: BMP-2-inducible protein kinase-li...  62.0    6e-08   
ref|XP_005922044.1|  PREDICTED: BMP-2-inducible protein kinase-like   62.0    6e-08   
ref|XP_004555737.1|  PREDICTED: BMP-2-inducible protein kinase-li...  62.0    6e-08   
ref|XP_001356891.2|  GA10457                                          62.0    6e-08   
ref|XP_002015291.1|  GL19623                                          62.0    6e-08   
ref|XP_011499712.1|  PREDICTED: cyclin-G-associated kinase            62.0    7e-08   
gb|KFQ69535.1|  Cyclin-G-associated kinase                            62.0    8e-08   
ref|XP_006975499.1|  PREDICTED: BMP-2-inducible protein kinase        62.0    8e-08   
ref|XP_006019751.1|  PREDICTED: cyclin-G-associated kinase            62.0    8e-08   
ref|XP_005814736.1|  PREDICTED: AP2-associated protein kinase 1-like  61.6    8e-08   
gb|KFU94089.1|  Cyclin-G-associated kinase                            62.0    8e-08   
ref|XP_004643245.1|  PREDICTED: BMP-2-inducible protein kinase        61.6    8e-08   
ref|XP_004941146.1|  PREDICTED: BMP-2-inducible protein kinase is...  61.6    8e-08   
ref|XP_004941145.1|  PREDICTED: BMP-2-inducible protein kinase is...  61.6    8e-08   
ref|XP_420537.2|  PREDICTED: BMP-2-inducible protein kinase isofo...  61.6    8e-08   
ref|XP_008265910.1|  PREDICTED: BMP-2-inducible protein kinase is...  61.6    9e-08   
ref|XP_002717043.1|  PREDICTED: BMP-2-inducible protein kinase is...  61.6    9e-08   
ref|XP_007763588.1|  hypothetical protein CONPUDRAFT_134281           61.6    9e-08   
ref|XP_009028576.1|  hypothetical protein HELRODRAFT_194118           61.6    9e-08   
ref|XP_002432640.1|  Actin-regulating kinase, putative                61.6    9e-08   
ref|XP_005790007.1|  hypothetical protein EMIHUDRAFT_252051           58.9    9e-08   
ref|XP_006151543.1|  PREDICTED: BMP-2-inducible protein kinase        61.6    9e-08   
ref|XP_007948562.1|  PREDICTED: BMP-2-inducible protein kinase        61.6    9e-08   
gb|EYB87444.1|  hypothetical protein Y032_0263g606                    61.2    1e-07   
ref|XP_010735297.1|  PREDICTED: AP2-associated protein kinase 1-like  61.6    1e-07   
ref|XP_007337431.1|  hypothetical protein AURDEDRAFT_156362           61.6    1e-07   
ref|XP_008173835.1|  PREDICTED: BMP-2-inducible protein kinase        61.6    1e-07   
ref|XP_003790106.1|  PREDICTED: BMP-2-inducible protein kinase        61.6    1e-07   
gb|KIJ66181.1|  hypothetical protein HYDPIDRAFT_109176                61.6    1e-07   
ref|XP_004335935.1|  protein kinase domain containing protein         61.2    1e-07   
ref|XP_004848065.1|  PREDICTED: BMP-2-inducible protein kinase is...  61.2    1e-07   
ref|XP_008841916.1|  PREDICTED: BMP-2-inducible protein kinase        61.2    1e-07   
ref|XP_004848064.1|  PREDICTED: BMP-2-inducible protein kinase is...  61.2    1e-07   
ref|XP_003773556.1|  PREDICTED: cyclin-G-associated kinase            61.6    1e-07   
ref|XP_003414180.1|  PREDICTED: BMP-2-inducible protein kinase        61.2    1e-07   
gb|EAX05833.1|  BMP2 inducible kinase, isoform CRA_e                  61.2    1e-07   
ref|XP_007093244.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-G-ass...  61.2    1e-07   
ref|XP_006625539.1|  PREDICTED: AP2-associated protein kinase 1-like  61.2    1e-07   
emb|CAB70863.1|  hypothetical protein                                 61.2    1e-07   
ref|XP_011229602.1|  PREDICTED: cyclin-G-associated kinase            61.2    1e-07   
ref|NP_060063.2|  BMP-2-inducible protein kinase isoform b            61.2    1e-07   
gb|AAH36021.1|  BMP2 inducible kinase                                 61.2    1e-07   
gb|EAX05829.1|  BMP2 inducible kinase, isoform CRA_a                  61.2    1e-07   
gb|KHJ44106.1|  kinase domain protein                                 61.2    1e-07   
gb|KFD58715.1|  hypothetical protein M513_00408                       61.2    1e-07   
gb|EYB87445.1|  hypothetical protein Y032_0263g606                    61.2    1e-07   
gb|KIJ21989.1|  hypothetical protein PAXINDRAFT_105693                61.2    1e-07   
gb|EAX05835.1|  BMP2 inducible kinase, isoform CRA_g                  61.2    1e-07   
gb|EAX05834.1|  BMP2 inducible kinase, isoform CRA_f                  61.2    1e-07   



>ref|XP_009772211.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana sylvestris]
 ref|XP_009772212.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana sylvestris]
Length=699

 Score =   175 bits (443),  Expect(2) = 4e-51, Method: Composition-based stats.
 Identities = 85/107 (79%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN IAEGGFSCVYL RDV+HGSKQYALKHII NDEES+DLVLKEI+VMKSLKGHPN
Sbjct  27   KVHVRNAIAEGGFSCVYLARDVLHGSKQYALKHIIVNDEESLDLVLKEISVMKSLKGHPN  86

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            IVTL AH+  DMGRTKEAL+ MEYCEKSLVSVLE R    F  KQ+L
Sbjct  87   IVTLNAHTFLDMGRTKEALLVMEYCEKSLVSVLENRGAGFFEEKQVL  133


 Score = 53.9 bits (128),  Expect(2) = 4e-51, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  231  IMWRFKPFTAKEQTGLEGRTIDIGNLK  311
            +MWRFKPF  KEQ GLEGRTIDIG+LK
Sbjct  1    MMWRFKPFMPKEQAGLEGRTIDIGSLK  27



>ref|XP_006359171.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Solanum tuberosum]
Length=694

 Score =   172 bits (436),  Expect(2) = 5e-51, Method: Composition-based stats.
 Identities = 82/107 (77%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN IAEGGFSCVYL RD++HGSKQYALKH+I NDEES+DLVLKEI+VMKSLKGHPN
Sbjct  26   KVHVRNAIAEGGFSCVYLARDMLHGSKQYALKHMIVNDEESLDLVLKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ MEYCE+SLVSVLE R    F  KQ+L
Sbjct  86   VVTLHAHTILDMGRTKEALLVMEYCEQSLVSVLENRGAGFFEEKQVL  132


 Score = 56.2 bits (134),  Expect(2) = 5e-51, Method: Composition-based stats.
 Identities = 23/26 (88%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KEQTGLEGR+IDIGNLK
Sbjct  1    MWRFKPFMPKEQTGLEGRSIDIGNLK  26



>ref|XP_004229357.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Solanum lycopersicum]
Length=698

 Score =   171 bits (433),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 82/107 (77%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN IAEGGFSCVYL RD++HGSKQYALKH+I NDEES+DLVLKEI+VMKSLKGHPN
Sbjct  26   KVHVRNAIAEGGFSCVYLARDILHGSKQYALKHMIVNDEESLDLVLKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ MEYCE+SLVSVLE R    F  KQ L
Sbjct  86   VVTLHAHTILDMGRTKEALLVMEYCEQSLVSVLENRGAGFFEEKQAL  132


 Score = 55.1 bits (131),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KEQTGLEGR+IDIGN+K
Sbjct  1    MWRFKPFMPKEQTGLEGRSIDIGNIK  26



>ref|XP_011087141.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Sesamum 
indicum]
Length=695

 Score =   172 bits (436),  Expect(2) = 5e-50, Method: Composition-based stats.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQ+RN IAEGGFSCVY  RD +HGSKQYALKHIICNDEES +LV+KEI+VMK+LKGHPN
Sbjct  26   KVQIRNAIAEGGFSCVYSARDAVHGSKQYALKHIICNDEESQELVMKEISVMKTLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+IFDMGRTKEA + MEYCEKSLV+VLE R    F  KQ+L
Sbjct  86   VVTLHAHAIFDMGRTKEAFLLMEYCEKSLVNVLESRGAGFFDEKQVL  132


 Score = 52.8 bits (125),  Expect(2) = 5e-50, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MWRFKPF  KEQTGLEGR IDIGN K +
Sbjct  1    MWRFKPFMQKEQTGLEGRFIDIGNFKVQ  28



>ref|XP_011087152.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X3 [Sesamum indicum]
Length=669

 Score =   172 bits (436),  Expect(2) = 5e-50, Method: Composition-based stats.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQ+RN IAEGGFSCVY  RD +HGSKQYALKHIICNDEES +LV+KEI+VMK+LKGHPN
Sbjct  26   KVQIRNAIAEGGFSCVYSARDAVHGSKQYALKHIICNDEESQELVMKEISVMKTLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+IFDMGRTKEA + MEYCEKSLV+VLE R    F  KQ+L
Sbjct  86   VVTLHAHAIFDMGRTKEAFLLMEYCEKSLVNVLESRGAGFFDEKQVL  132


 Score = 52.8 bits (125),  Expect(2) = 5e-50, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MWRFKPF  KEQTGLEGR IDIGN K +
Sbjct  1    MWRFKPFMQKEQTGLEGRFIDIGNFKVQ  28



>ref|XP_011087144.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Sesamum 
indicum]
Length=690

 Score =   172 bits (436),  Expect(2) = 5e-50, Method: Composition-based stats.
 Identities = 80/107 (75%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQ+RN IAEGGFSCVY  RD +HGSKQYALKHIICNDEES +LV+KEI+VMK+LKGHPN
Sbjct  26   KVQIRNAIAEGGFSCVYSARDAVHGSKQYALKHIICNDEESQELVMKEISVMKTLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+IFDMGRTKEA + MEYCEKSLV+VLE R    F  KQ+L
Sbjct  86   VVTLHAHAIFDMGRTKEAFLLMEYCEKSLVNVLESRGAGFFDEKQVL  132


 Score = 52.8 bits (125),  Expect(2) = 5e-50, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MWRFKPF  KEQTGLEGR IDIGN K +
Sbjct  1    MWRFKPFMQKEQTGLEGRFIDIGNFKVQ  28



>ref|XP_009607019.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana tomentosiformis]
 ref|XP_009607020.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Nicotiana tomentosiformis]
Length=700

 Score =   170 bits (431),  Expect(2) = 9e-50, Method: Composition-based stats.
 Identities = 83/107 (78%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN IAEGGFSCVYL RDV+HGSKQYALKHII +DEE +DLVLKEI+VMKSLKGHPN
Sbjct  27   KVHVRNAIAEGGFSCVYLARDVLHGSKQYALKHIIVSDEELLDLVLKEISVMKSLKGHPN  86

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            IVTL AH+  DMGRTKEAL+ MEYCEKSLVSVLE R    F  KQ+L
Sbjct  87   IVTLNAHTFLDMGRTKEALLVMEYCEKSLVSVLENRGAGFFEEKQVL  133


 Score = 53.9 bits (128),  Expect(2) = 9e-50, Method: Composition-based stats.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  231  IMWRFKPFTAKEQTGLEGRTIDIGNLK  311
            +MWRFKPF  KEQ GLEGRTIDIG+LK
Sbjct  1    MMWRFKPFMPKEQAGLEGRTIDIGSLK  27



>gb|KDP20398.1| hypothetical protein JCGZ_05281 [Jatropha curcas]
Length=669

 Score =   168 bits (426),  Expect(2) = 3e-48, Method: Composition-based stats.
 Identities = 79/107 (74%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVYL RD +H SKQYALKH+ICNDEES++L LKEI+VMKSLKGHPN
Sbjct  26   KIHVRNVIAEGGFSCVYLARDAMHASKQYALKHMICNDEESLELALKEIDVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            IVTL A +IFDMGRTKEAL+ +E+CEKSLVSVLE R    F  KQ+L
Sbjct  86   IVTLYADAIFDMGRTKEALLVLEFCEKSLVSVLESRGAGYFEEKQVL  132


 Score = 50.4 bits (119),  Expect(2) = 3e-48, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF+ KE  GLEGR++D+GNLK
Sbjct  1    MWRFKPFSQKEPAGLEGRSLDVGNLK  26



>gb|EYU27100.1| hypothetical protein MIMGU_mgv1a022935mg [Erythranthe guttata]
Length=634

 Score =   164 bits (415),  Expect(2) = 5e-48, Method: Composition-based stats.
 Identities = 80/107 (75%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN IAEGGFSCVYL RD IHGSKQYALKHII +DEES +LV KEI VMK+LKGHPN
Sbjct  26   KVQVRNAIAEGGFSCVYLARDAIHGSKQYALKHIIYSDEESEELVKKEILVMKTLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+IFDMGRTKEAL+ +EYCEKSLV+VLE R    F  KQ++
Sbjct  86   VVTLHAHAIFDMGRTKEALLLLEYCEKSLVNVLENRGAGFFDEKQVI  132


 Score = 54.3 bits (129),  Expect(2) = 5e-48, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MWRFKPF  KEQTGLEGR IDIGN K +
Sbjct  1    MWRFKPFAHKEQTGLEGRVIDIGNFKVQ  28



>emb|CDP07694.1| unnamed protein product [Coffea canephora]
Length=301

 Score =   164 bits (414),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++QVRN IAEGGFSCVYL RD IHG+KQYALKHIICNDEES++LV++EI+VMK LKGHPN
Sbjct  26   KIQVRNAIAEGGFSCVYLARDAIHGTKQYALKHIICNDEESLELVMREISVMKLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH+IFDMGRTKEAL+ M+YCEKSLV++L+ R
Sbjct  86   VVPLSAHTIFDMGRTKEALLVMDYCEKSLVTMLDNR  121


 Score = 54.3 bits (129),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MWRFKPF  KEQ GLEGRTIDIGNLK +
Sbjct  1    MWRFKPFMPKEQAGLEGRTIDIGNLKIQ  28



>ref|XP_008461768.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Cucumis melo]
Length=665

 Score =   166 bits (420),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 72/96 (75%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVYL +D +H SKQYALKHIICNDEES++LV+KE++VMKSL+GHPN
Sbjct  26   KIHVRNVIAEGGFSCVYLAKDAVHISKQYALKHIICNDEESLELVMKEVSVMKSLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE R
Sbjct  86   VVTLYAHTIIDMGRTKEALLAMEFCEKSLVNVLESR  121


 Score = 50.8 bits (120),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE +GLEGR+ID+GNLK
Sbjct  1    MWRFKPFMHKEPSGLEGRSIDVGNLK  26



>ref|XP_004149621.1| PREDICTED: uncharacterized protein LOC101211119 [Cucumis sativus]
 ref|XP_004170535.1| PREDICTED: uncharacterized LOC101211119 [Cucumis sativus]
 gb|KGN58620.1| hypothetical protein Csa_3G702580 [Cucumis sativus]
Length=676

 Score =   166 bits (419),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 72/96 (75%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVYL +D +H SKQYALKHIICNDEES++LV+KE++VMKSL+GHPN
Sbjct  26   KIHVRNVIAEGGFSCVYLAKDAVHISKQYALKHIICNDEESLELVMKEVSVMKSLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE R
Sbjct  86   VVTLYAHTIIDMGRTKEALLVMEFCEKSLVNVLESR  121


 Score = 51.2 bits (121),  Expect(2) = 1e-47, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE +GLEGR+ID+GNLK
Sbjct  1    MWRFKPFMHKEPSGLEGRSIDVGNLK  26



>ref|XP_010659599.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Vitis vinifera]
Length=711

 Score =   162 bits (409),  Expect(2) = 2e-47, Method: Composition-based stats.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN IAEGGFSCVYL RD I+ SKQYALKHIICNDEES+DLV KEI VMK L+GHPN
Sbjct  39   KVYVRNAIAEGGFSCVYLARDAINSSKQYALKHIICNDEESLDLVKKEILVMKVLRGHPN  98

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE R    F  KQ+L
Sbjct  99   VVTLHAHTILDMGRTKEALLVMEFCEKSLVNVLESRGAGYFEEKQVL  145


 Score = 54.3 bits (129),  Expect(2) = 2e-47, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = +3

Query  204  KCIVYSELQIMWRFKPFTAKEQTGLEGRTIDIGNLK  311
            KC+    + IMWRFKPF  KEQ GLEGR+ID+GN+K
Sbjct  5    KCVFIVPI-IMWRFKPFMPKEQAGLEGRSIDVGNVK  39



>ref|XP_010659600.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Vitis vinifera]
Length=710

 Score =   162 bits (409),  Expect(2) = 2e-47, Method: Composition-based stats.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN IAEGGFSCVYL RD I+ SKQYALKHIICNDEES+DLV KEI VMK L+GHPN
Sbjct  39   KVYVRNAIAEGGFSCVYLARDAINSSKQYALKHIICNDEESLDLVKKEILVMKVLRGHPN  98

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE R    F  KQ+L
Sbjct  99   VVTLHAHTILDMGRTKEALLVMEFCEKSLVNVLESRGAGYFEEKQVL  145


 Score = 54.3 bits (129),  Expect(2) = 2e-47, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = +3

Query  204  KCIVYSELQIMWRFKPFTAKEQTGLEGRTIDIGNLK  311
            KC+    + IMWRFKPF  KEQ GLEGR+ID+GN+K
Sbjct  5    KCVFIVPI-IMWRFKPFMPKEQAGLEGRSIDVGNVK  39



>ref|XP_010659601.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X3 [Vitis vinifera]
Length=698

 Score =   162 bits (409),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN IAEGGFSCVYL RD I+ SKQYALKHIICNDEES+DLV KEI VMK L+GHPN
Sbjct  26   KVYVRNAIAEGGFSCVYLARDAINSSKQYALKHIICNDEESLDLVKKEILVMKVLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE R    F  KQ+L
Sbjct  86   VVTLHAHTILDMGRTKEALLVMEFCEKSLVNVLESRGAGYFEEKQVL  132


 Score = 52.0 bits (123),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KEQ GLEGR+ID+GN+K
Sbjct  1    MWRFKPFMPKEQAGLEGRSIDVGNVK  26



>ref|XP_011468799.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=681

 Score =   166 bits (421),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVYL RD++H SKQYALKHIICNDEE +DLV+KEINVMK L+GHPN
Sbjct  26   KIHVRNVIAEGGFSCVYLARDLVHTSKQYALKHIICNDEELLDLVMKEINVMKLLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I D+GRTKEAL+ MEYC+KSLV+VL+ R    F  KQ+L
Sbjct  86   VVTLYAHAIMDLGRTKEALLVMEYCDKSLVTVLDSRGAGFFDEKQLL  132


 Score = 47.4 bits (111),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE  GLEGR++D+G LK
Sbjct  1    MWRFKPFMHKEPAGLEGRSLDVGTLK  26



>ref|XP_004306499.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468798.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=682

 Score =   166 bits (421),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVYL RD++H SKQYALKHIICNDEE +DLV+KEINVMK L+GHPN
Sbjct  26   KIHVRNVIAEGGFSCVYLARDLVHTSKQYALKHIICNDEELLDLVMKEINVMKLLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I D+GRTKEAL+ MEYC+KSLV+VL+ R    F  KQ+L
Sbjct  86   VVTLYAHAIMDLGRTKEALLVMEYCDKSLVTVLDSRGAGFFDEKQLL  132


 Score = 47.4 bits (111),  Expect(2) = 1e-46, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE  GLEGR++D+G LK
Sbjct  1    MWRFKPFMHKEPAGLEGRSLDVGTLK  26



>ref|XP_010257448.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X1 [Nelumbo nucifera]
Length=709

 Score =   166 bits (419),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 73/96 (76%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQ+RN IAEGGFSCVYL RD IH SKQYALKHIICND+ES++LV+KEI+VMKSL+GHPN
Sbjct  26   KVQIRNAIAEGGFSCVYLARDAIHSSKQYALKHIICNDDESIELVMKEISVMKSLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH+I DMGRTKEA + ME+CEKSLV+VLE R
Sbjct  86   VVALLAHTILDMGRTKEAFLVMEFCEKSLVNVLESR  121


 Score = 47.0 bits (110),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MWRFK F  +E TGLEGR ID+GN+K +
Sbjct  1    MWRFKQFMPREHTGLEGRAIDVGNIKVQ  28



>ref|XP_010257450.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X3 [Nelumbo nucifera]
Length=707

 Score =   166 bits (419),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 73/96 (76%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQ+RN IAEGGFSCVYL RD IH SKQYALKHIICND+ES++LV+KEI+VMKSL+GHPN
Sbjct  26   KVQIRNAIAEGGFSCVYLARDAIHSSKQYALKHIICNDDESIELVMKEISVMKSLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH+I DMGRTKEA + ME+CEKSLV+VLE R
Sbjct  86   VVALLAHTILDMGRTKEAFLVMEFCEKSLVNVLESR  121


 Score = 47.0 bits (110),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MWRFK F  +E TGLEGR ID+GN+K +
Sbjct  1    MWRFKQFMPREHTGLEGRAIDVGNIKVQ  28



>ref|XP_010257449.1| PREDICTED: serine/threonine-protein kinase ppk30-like isoform 
X2 [Nelumbo nucifera]
Length=708

 Score =   166 bits (419),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 73/96 (76%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQ+RN IAEGGFSCVYL RD IH SKQYALKHIICND+ES++LV+KEI+VMKSL+GHPN
Sbjct  26   KVQIRNAIAEGGFSCVYLARDAIHSSKQYALKHIICNDDESIELVMKEISVMKSLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH+I DMGRTKEA + ME+CEKSLV+VLE R
Sbjct  86   VVALLAHTILDMGRTKEAFLVMEFCEKSLVNVLESR  121


 Score = 47.0 bits (110),  Expect(2) = 2e-46, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MWRFK F  +E TGLEGR ID+GN+K +
Sbjct  1    MWRFKQFMPREHTGLEGRAIDVGNIKVQ  28



>ref|XP_010265879.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X1 [Nelumbo nucifera]
 ref|XP_010265880.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X1 [Nelumbo nucifera]
Length=701

 Score =   164 bits (415),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V +RN+IAEGGFSCVYL RD +H SKQYALKHIICND ES++LV KEI+VMK L+GHPN
Sbjct  26   KVHIRNVIAEGGFSCVYLARDAVHTSKQYALKHIICNDGESLELVTKEISVMKMLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +V L AH+I DMGRTKEAL+ ME+CEKSLV+VLE R +  F  KQIL
Sbjct  86   VVALLAHTILDMGRTKEALLVMEFCEKSLVNVLESRGVGYFEEKQIL  132


 Score = 47.8 bits (112),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFK F  KE  GLEGRTID+GN+K
Sbjct  1    MWRFKQFMPKEHAGLEGRTIDVGNIK  26



>ref|XP_010265881.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
isoform X2 [Nelumbo nucifera]
Length=700

 Score =   164 bits (415),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V +RN+IAEGGFSCVYL RD +H SKQYALKHIICND ES++LV KEI+VMK L+GHPN
Sbjct  26   KVHIRNVIAEGGFSCVYLARDAVHTSKQYALKHIICNDGESLELVTKEISVMKMLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +V L AH+I DMGRTKEAL+ ME+CEKSLV+VLE R +  F  KQIL
Sbjct  86   VVALLAHTILDMGRTKEALLVMEFCEKSLVNVLESRGVGYFEEKQIL  132


 Score = 47.8 bits (112),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFK F  KE  GLEGRTID+GN+K
Sbjct  1    MWRFKQFMPKEHAGLEGRTIDVGNIK  26



>ref|XP_008808088.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008808089.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
Length=698

 Score =   155 bits (391),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 68/96 (71%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN +AEGGFSCVYL RD +H SKQYALKH+ICND ES+DL +KEI+VM+ LKGHPN
Sbjct  26   KVHVRNAMAEGGFSCVYLARDALHASKQYALKHMICNDGESLDLAMKEISVMRLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH+I DMGR KE LI ME+CEKSLV+VL+ R
Sbjct  86   VVALVAHTILDMGRMKEVLIVMEFCEKSLVAVLDNR  121


 Score = 57.0 bits (136),  Expect(2) = 4e-46, Method: Composition-based stats.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPFTAKE TGLEGRTID+GN+K
Sbjct  1    MWRFKPFTAKEPTGLEGRTIDVGNVK  26



>ref|XP_009339572.1| PREDICTED: AP2-associated protein kinase 1 [Pyrus x bretschneideri]
Length=688

 Score =   160 bits (406),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V+N IAEGGFSCVYL RD +H SKQYALKHII NDEE ++LV+KEI+VMK L+GHPN
Sbjct  26   KIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHIIINDEELLELVMKEISVMKLLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTLCAH+I DMGRTKEAL+ M++CEKSLV+VLE R    F  KQ+L
Sbjct  86   VVTLCAHTILDMGRTKEALLVMDFCEKSLVNVLESRGAGFFEEKQVL  132


 Score = 51.2 bits (121),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+ID+GN+K
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDVGNVK  26



>ref|XP_008392404.1| PREDICTED: AP2-associated protein kinase 1 [Malus domestica]
Length=681

 Score =   160 bits (406),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 74/107 (69%), Positives = 90/107 (84%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V+N IAEGGFSCVYL RD +H SKQYALKHII NDEE ++LV+KEI+VMK L+GHPN
Sbjct  26   KIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHIIINDEELLELVMKEISVMKLLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTLCAH+I DMGRTKEAL+ M++CEKSLV+VLE R    F  KQ+L
Sbjct  86   VVTLCAHTILDMGRTKEALLVMDFCEKSLVNVLESRGAGFFEEKQVL  132


 Score = 51.2 bits (121),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+ID+GN+K
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDVGNVK  26



>ref|XP_010678702.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Beta vulgaris subsp. vulgaris]
Length=664

 Score =   163 bits (412),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V ++N+IAEGGFSCVYL RD ++ SKQYALKHIICND+ES+DLV+KEI VMKSLKGHPN
Sbjct  26   KVHIKNVIAEGGFSCVYLARDALNASKQYALKHIICNDQESLDLVMKEIQVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL +H+I D+GRTKEAL+ ME CEKSLV+VLE R    F  KQIL
Sbjct  86   VVTLYSHTILDLGRTKEALLVMECCEKSLVNVLESRGAGYFDEKQIL  132


 Score = 48.5 bits (114),  Expect(2) = 5e-46, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MW+FKPF  KE TGLEGR IDIG++K
Sbjct  1    MWKFKPFAQKEPTGLEGRNIDIGDIK  26



>ref|XP_002512151.1| serine/threonine protein kinase, putative [Ricinus communis]
 gb|EEF50185.1| serine/threonine protein kinase, putative [Ricinus communis]
Length=622

 Score =   164 bits (415),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/107 (71%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IAEGGFSCVYL  D +H SKQYALKH+ICNDEES++L LKEINVMKS +GHPN
Sbjct  26   KIHVRNAIAEGGFSCVYLALDAMHASKQYALKHMICNDEESLELALKEINVMKSFQGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            IV LCAH+I D GRTKEAL+ ME+CEKSLVSVL+ R    F  KQ+L
Sbjct  86   IVALCAHAILDKGRTKEALLVMEFCEKSLVSVLDSRGAGYFEEKQVL  132


 Score = 47.4 bits (111),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFK FT KE  GLEGR ID+GNLK 
Sbjct  1    MWRFKSFTQKEPVGLEGRYIDVGNLKI  27



>emb|CBI32193.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   158 bits (399),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN IAEGGFSCVYL RD I+ SKQYALKHIICNDEES+DLV KEI VMK L+GHPN
Sbjct  116  KVYVRNAIAEGGFSCVYLARDAINSSKQYALKHIICNDEESLDLVKKEILVMKVLRGHPN  175

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE R    F  KQ+L
Sbjct  176  VVTLHAHTILDMGRTKEALLVMEFCEKSLVNVLESRGAGYFEEKQVL  222


 Score = 53.5 bits (127),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = +3

Query  198  TDKCIVYSELQIMWRFKPFTAKEQTGLEGRTIDIGNLK  311
            +++C+    + IMWRFKPF  KEQ GLEGR+ID+GN+K
Sbjct  80   SEQCVFIVPI-IMWRFKPFMPKEQAGLEGRSIDVGNVK  116



>ref|XP_003531422.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Glycine max]
 gb|KHN29185.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=662

 Score =   154 bits (388),  Expect(2) = 8e-46, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V   IAEGGFSCVYL RD +H SKQYALKH+ICNDEES+ LV KEI+VMK L GHPN
Sbjct  26   KIHVIKAIAEGGFSCVYLARDAVHMSKQYALKHMICNDEESLGLVKKEISVMKVLAGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+IFDMGRTKEA + ME+CE+SLV+VLE R    F  KQ+L
Sbjct  86   VVTLHAHAIFDMGRTKEAFLVMEFCERSLVNVLESRGAGYFDEKQVL  132


 Score = 57.4 bits (137),  Expect(2) = 8e-46, Method: Composition-based stats.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF+ KEQTGLEGRTID+GNLK
Sbjct  1    MWRFKPFSHKEQTGLEGRTIDVGNLK  26



>ref|XP_007052604.1| Serine/threonine-protein kinase DDB_G0280111 isoform 1 [Theobroma 
cacao]
 gb|EOX96761.1| Serine/threonine-protein kinase DDB_G0280111 isoform 1 [Theobroma 
cacao]
Length=688

 Score =   165 bits (417),  Expect(2) = 8e-46, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IAEGGFSCVYL +D +H SKQYALKHIICND+ES+DLV+KEI+VMKSL+GHPN
Sbjct  26   KLHVRNAIAEGGFSCVYLAKDALHASKQYALKHIICNDQESLDLVMKEISVMKSLQGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ ME+C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDMGRTKEALLVMEFCDKSLVNVLETRGAAYFEEKQVL  132


 Score = 45.8 bits (107),  Expect(2) = 8e-46, Method: Composition-based stats.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFKPF  KE  GLEG+++D+ NLK 
Sbjct  1    MWRFKPFMQKEPAGLEGKSLDVSNLKL  27



>ref|XP_007052606.1| Serine/threonine-protein kinase DDB_G0280111 isoform 3 [Theobroma 
cacao]
 gb|EOX96763.1| Serine/threonine-protein kinase DDB_G0280111 isoform 3 [Theobroma 
cacao]
Length=679

 Score =   165 bits (417),  Expect(2) = 8e-46, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IAEGGFSCVYL +D +H SKQYALKHIICND+ES+DLV+KEI+VMKSL+GHPN
Sbjct  26   KLHVRNAIAEGGFSCVYLAKDALHASKQYALKHIICNDQESLDLVMKEISVMKSLQGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ ME+C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDMGRTKEALLVMEFCDKSLVNVLETRGAAYFEEKQVL  132


 Score = 45.8 bits (107),  Expect(2) = 8e-46, Method: Composition-based stats.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFKPF  KE  GLEG+++D+ NLK 
Sbjct  1    MWRFKPFMQKEPAGLEGKSLDVSNLKL  27



>ref|XP_007052605.1| Serine/threonine-protein kinase DDB_G0280111 isoform 2 [Theobroma 
cacao]
 gb|EOX96762.1| Serine/threonine-protein kinase DDB_G0280111 isoform 2 [Theobroma 
cacao]
Length=678

 Score =   165 bits (417),  Expect(2) = 8e-46, Method: Composition-based stats.
 Identities = 76/107 (71%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IAEGGFSCVYL +D +H SKQYALKHIICND+ES+DLV+KEI+VMKSL+GHPN
Sbjct  26   KLHVRNAIAEGGFSCVYLAKDALHASKQYALKHIICNDQESLDLVMKEISVMKSLQGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ ME+C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDMGRTKEALLVMEFCDKSLVNVLETRGAAYFEEKQVL  132


 Score = 45.8 bits (107),  Expect(2) = 8e-46, Method: Composition-based stats.
 Identities = 17/27 (63%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFKPF  KE  GLEG+++D+ NLK 
Sbjct  1    MWRFKPFMQKEPAGLEGKSLDVSNLKL  27



>ref|XP_006369447.1| hypothetical protein POPTR_0001s23520g [Populus trichocarpa]
 gb|ERP66016.1| hypothetical protein POPTR_0001s23520g [Populus trichocarpa]
Length=666

 Score =   163 bits (413),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 77/107 (72%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IAEGGFSCVYL RD +H SKQYALKH+I NDEE  DLV+KEINVMK+LKGHPN
Sbjct  26   KIHVRNAIAEGGFSCVYLARDAVHASKQYALKHMIYNDEELSDLVMKEINVMKALKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDMGRTKEALLVMEFCEKSLVNVLESRGAAYFEEKQVL  132


 Score = 47.4 bits (111),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFK FT KE  GLEGR +D+GNLK
Sbjct  1    MWRFKHFTQKEPAGLEGRYVDVGNLK  26



>ref|XP_004513162.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X1 [Cicer arietinum]
 ref|XP_004513163.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X2 [Cicer arietinum]
 ref|XP_004513164.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X3 [Cicer arietinum]
 ref|XP_004513165.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X4 [Cicer arietinum]
 ref|XP_004513166.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X5 [Cicer arietinum]
 ref|XP_004513167.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X6 [Cicer arietinum]
 ref|XP_004513168.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X7 [Cicer arietinum]
 ref|XP_004513169.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X8 [Cicer arietinum]
Length=681

 Score =   156 bits (395),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 74/107 (69%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V  +IAEGGFSCVYL RD +H SKQYALKHIICNDEES+ LV KEI+VMK L GHPN
Sbjct  26   KINVHKVIAEGGFSCVYLARDAVHMSKQYALKHIICNDEESLGLVKKEISVMKLLVGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I+DMGRTKEA + ME+CEKSLVSVLE R    F  +Q+L
Sbjct  86   VVTLHAHAIYDMGRTKEAFLVMEFCEKSLVSVLESRGAGYFDERQVL  132


 Score = 53.9 bits (128),  Expect(2) = 1e-45, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KEQ+GLEGR+ID+GNLK
Sbjct  1    MWRFKPFMHKEQSGLEGRSIDVGNLK  26



>gb|KJB22768.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=662

 Score =   161 bits (408),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVYL +D +H SKQYALKHIICND+ES++LV+KEI+V+KSL+GHPN
Sbjct  26   KLHVRNVIAEGGFSCVYLAKDALHASKQYALKHIICNDQESLELVVKEISVLKSLQGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            ++TL AH+I DMGRTKEAL+ ME+C+KSLV+ LE R    F  KQIL
Sbjct  86   VITLYAHTILDMGRTKEALLVMEFCDKSLVNCLETRGTAYFEEKQIL  132


 Score = 48.5 bits (114),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFKPF  KE  GLEGRT+D+ NLK 
Sbjct  1    MWRFKPFLQKEPAGLEGRTLDVANLKL  27



>gb|KJB22767.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
 gb|KJB22769.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=661

 Score =   161 bits (408),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVYL +D +H SKQYALKHIICND+ES++LV+KEI+V+KSL+GHPN
Sbjct  26   KLHVRNVIAEGGFSCVYLAKDALHASKQYALKHIICNDQESLELVVKEISVLKSLQGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            ++TL AH+I DMGRTKEAL+ ME+C+KSLV+ LE R    F  KQIL
Sbjct  86   VITLYAHTILDMGRTKEALLVMEFCDKSLVNCLETRGTAYFEEKQIL  132


 Score = 48.5 bits (114),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFKPF  KE  GLEGRT+D+ NLK 
Sbjct  1    MWRFKPFLQKEPAGLEGRTLDVANLKL  27



>gb|KJB22766.1| hypothetical protein B456_004G065000 [Gossypium raimondii]
Length=658

 Score =   161 bits (408),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVYL +D +H SKQYALKHIICND+ES++LV+KEI+V+KSL+GHPN
Sbjct  26   KLHVRNVIAEGGFSCVYLAKDALHASKQYALKHIICNDQESLELVVKEISVLKSLQGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            ++TL AH+I DMGRTKEAL+ ME+C+KSLV+ LE R    F  KQIL
Sbjct  86   VITLYAHTILDMGRTKEALLVMEFCDKSLVNCLETRGTAYFEEKQIL  132


 Score = 48.5 bits (114),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFKPF  KE  GLEGRT+D+ NLK 
Sbjct  1    MWRFKPFLQKEPAGLEGRTLDVANLKL  27



>gb|KHG06229.1| putative serine/threonine-protein kinase [Gossypium arboreum]
Length=653

 Score =   161 bits (408),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVYL +D +H SKQYALKHIICND+ES++LV+KEI+V+KSL+GHPN
Sbjct  26   KLHVRNVIAEGGFSCVYLAKDALHASKQYALKHIICNDQESLELVVKEISVLKSLQGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            ++TL AH+I DMGRTKEAL+ ME+C+KSLV+ LE R    F  KQIL
Sbjct  86   VITLYAHTILDMGRTKEALLVMEFCDKSLVNFLETRGTAYFEEKQIL  132


 Score = 48.5 bits (114),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFKPF  KE  GLEGRT+D+ NLK 
Sbjct  1    MWRFKPFLQKEPAGLEGRTLDVANLKL  27



>ref|XP_008231319.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Prunus 
mume]
Length=699

 Score =   157 bits (396),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V+N IAEGGFSCVYL RD +H SKQYALKHIICNDEE ++LV+KEI+VMK L+GHPN
Sbjct  26   KIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHIICNDEEMLELVMKEISVMKLLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+  DMGRTKEAL+ ME+C+KSLV+VLE R    F  KQ L
Sbjct  86   VVTLHAHTFLDMGRTKEALLVMEFCDKSLVNVLESRGAGFFDEKQAL  132


 Score = 52.8 bits (125),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+IDIGNLK
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDIGNLK  26



>ref|XP_008231321.1| PREDICTED: AP2-associated protein kinase 1 isoform X3 [Prunus 
mume]
Length=697

 Score =   157 bits (396),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V+N IAEGGFSCVYL RD +H SKQYALKHIICNDEE ++LV+KEI+VMK L+GHPN
Sbjct  26   KIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHIICNDEEMLELVMKEISVMKLLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+  DMGRTKEAL+ ME+C+KSLV+VLE R    F  KQ L
Sbjct  86   VVTLHAHTFLDMGRTKEALLVMEFCDKSLVNVLESRGAGFFDEKQAL  132


 Score = 52.8 bits (125),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+IDIGNLK
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDIGNLK  26



>ref|XP_008231320.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Prunus 
mume]
Length=698

 Score =   157 bits (396),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V+N IAEGGFSCVYL RD +H SKQYALKHIICNDEE ++LV+KEI+VMK L+GHPN
Sbjct  26   KIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHIICNDEEMLELVMKEISVMKLLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+  DMGRTKEAL+ ME+C+KSLV+VLE R    F  KQ L
Sbjct  86   VVTLHAHTFLDMGRTKEALLVMEFCDKSLVNVLESRGAGFFDEKQAL  132


 Score = 52.8 bits (125),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+IDIGNLK
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDIGNLK  26



>ref|XP_007149359.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
 gb|ESW21353.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
Length=673

 Score =   154 bits (390),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ +   IAEGGFSCVY+ RD +H SKQYALKH+ICNDEES+ LV KEI+VMK L GHPN
Sbjct  26   KINIVKAIAEGGFSCVYVARDAVHMSKQYALKHMICNDEESLGLVKKEISVMKMLVGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AHSIFDMGRTKEA + ME+CE+SLVSVLE R    F  KQ+L
Sbjct  86   VVTLLAHSIFDMGRTKEAFLVMEFCERSLVSVLESRGAGYFDEKQVL  132


 Score = 55.1 bits (131),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KEQTGLEGRT+D+GNLK
Sbjct  1    MWRFKPFGHKEQTGLEGRTVDVGNLK  26



>ref|XP_007149360.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
 gb|ESW21354.1| hypothetical protein PHAVU_005G063700g [Phaseolus vulgaris]
Length=674

 Score =   154 bits (390),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ +   IAEGGFSCVY+ RD +H SKQYALKH+ICNDEES+ LV KEI+VMK L GHPN
Sbjct  26   KINIVKAIAEGGFSCVYVARDAVHMSKQYALKHMICNDEESLGLVKKEISVMKMLVGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AHSIFDMGRTKEA + ME+CE+SLVSVLE R    F  KQ+L
Sbjct  86   VVTLLAHSIFDMGRTKEAFLVMEFCERSLVSVLESRGAGYFDEKQVL  132


 Score = 55.1 bits (131),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KEQTGLEGRT+D+GNLK
Sbjct  1    MWRFKPFGHKEQTGLEGRTVDVGNLK  26



>gb|KDO46086.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=691

 Score =   157 bits (397),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVY  RD IH SKQYA+KH+ICNDEES++  +KEI+VMKSLKGHPN
Sbjct  26   KIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMICNDEESLESAMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDLGRTKEALLVMECCDKSLVNVLENRGAGYFEEKQVL  132


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+ID+GNLK
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLK  26



>ref|XP_006482821.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X1 [Citrus sinensis]
 ref|XP_006482822.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X2 [Citrus sinensis]
Length=693

 Score =   157 bits (397),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVY  RD IH SKQYA+KH+ICNDEES++  +KEI+VMKSLKGHPN
Sbjct  26   KIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMICNDEESLESAMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDLGRTKEALLVMECCDKSLVNVLENRGAGYFEEKQVL  132


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+ID+GNLK
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLK  26



>ref|XP_006439043.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52283.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=693

 Score =   157 bits (397),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVY  RD IH SKQYA+KH+ICNDEES++  +KEI+VMKSLKGHPN
Sbjct  26   KIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMICNDEESLESAMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDLGRTKEALLVMECCDKSLVNVLENRGAGYFEEKQVL  132


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+ID+GNLK
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLK  26



>gb|KDO46085.1| hypothetical protein CISIN_1g005558mg [Citrus sinensis]
Length=690

 Score =   157 bits (397),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVY  RD IH SKQYA+KH+ICNDEES++  +KEI+VMKSLKGHPN
Sbjct  26   KIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMICNDEESLESAMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDLGRTKEALLVMECCDKSLVNVLENRGAGYFEEKQVL  132


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+ID+GNLK
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLK  26



>ref|XP_006482823.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X3 [Citrus sinensis]
Length=692

 Score =   157 bits (397),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVY  RD IH SKQYA+KH+ICNDEES++  +KEI+VMKSLKGHPN
Sbjct  26   KIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMICNDEESLESAMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDLGRTKEALLVMECCDKSLVNVLENRGAGYFEEKQVL  132


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+ID+GNLK
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLK  26



>ref|XP_006439041.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 ref|XP_006439042.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52281.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52282.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=692

 Score =   157 bits (397),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVY  RD IH SKQYA+KH+ICNDEES++  +KEI+VMKSLKGHPN
Sbjct  26   KIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMICNDEESLESAMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDLGRTKEALLVMECCDKSLVNVLENRGAGYFEEKQVL  132


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+ID+GNLK
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLK  26



>ref|XP_006482824.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
isoform X4 [Citrus sinensis]
Length=691

 Score =   157 bits (397),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVY  RD IH SKQYA+KH+ICNDEES++  +KEI+VMKSLKGHPN
Sbjct  26   KIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMICNDEESLESAMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDLGRTKEALLVMECCDKSLVNVLENRGAGYFEEKQVL  132


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+ID+GNLK
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLK  26



>ref|XP_006439040.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 ref|XP_006439044.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52280.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
 gb|ESR52284.1| hypothetical protein CICLE_v10030862mg [Citrus clementina]
Length=690

 Score =   157 bits (397),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IAEGGFSCVY  RD IH SKQYA+KH+ICNDEES++  +KEI+VMKSLKGHPN
Sbjct  26   KIHVRNVIAEGGFSCVYSARDAIHMSKQYAMKHMICNDEESLESAMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I D+GRTKEAL+ ME C+KSLV+VLE R    F  KQ+L
Sbjct  86   VVTLYAHTILDLGRTKEALLVMECCDKSLVNVLENRGAGYFEEKQVL  132


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR+ID+GNLK
Sbjct  1    MWRFKPFMQKEPTGLEGRSIDVGNLK  26



>ref|XP_007220628.1| hypothetical protein PRUPE_ppa002321mg [Prunus persica]
 gb|EMJ21827.1| hypothetical protein PRUPE_ppa002321mg [Prunus persica]
Length=687

 Score =   157 bits (396),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V+N IAEGGFSCVYL RD +H SKQYALKHIICNDEE ++LV+KEI+VMK L+GHPN
Sbjct  26   KIHVKNAIAEGGFSCVYLARDAVHVSKQYALKHIICNDEEMLELVMKEISVMKLLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+  DMGRTKEAL+ ME+C+KSLV+VLE R    F  KQ L
Sbjct  86   VVTLHAHTFLDMGRTKEALLVMEFCDKSLVNVLESRGAGFFDEKQAL  132


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KE TGLEGR++DIGNLK
Sbjct  1    MWRFKPFMHKEPTGLEGRSVDIGNLK  26



>emb|CAN60313.1| hypothetical protein VITISV_036304 [Vitis vinifera]
Length=303

 Score =   158 bits (399),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/107 (74%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN IAEGGFSCVYL RD I+ SKQYALKHIICNDEES+DLV KEI VMK L+GHPN
Sbjct  26   KVYVRNAIAEGGFSCVYLARDAINSSKQYALKHIICNDEESLDLVKKEILVMKVLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEAL+ ME+CEKSLV+VLE R    F  KQ+L
Sbjct  86   VVTLHAHTILDMGRTKEALLVMEFCEKSLVNVLESRGAGYFEEKQVL  132


 Score = 51.2 bits (121),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KEQ GLEGR+ID+GN+K
Sbjct  1    MWRFKPFMPKEQAGLEGRSIDVGNVK  26



>ref|XP_010943528.1| PREDICTED: AP2-associated protein kinase 1-like [Elaeis guineensis]
Length=698

 Score =   157 bits (397),  Expect(2) = 7e-45, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN +AEGGFSCVYL RD +H SKQYALKH+ICND ES+DL  KEI+VM+ LKGHPN
Sbjct  26   KVHVRNAMAEGGFSCVYLARDAVHASKQYALKHMICNDGESLDLATKEISVMRLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +V L AH+I DMGRTKE LI ME+CEKSLV+VL+ R    F  KQ+L
Sbjct  86   VVALVAHTILDMGRTKEVLIVMEFCEKSLVAVLDNRGAGYFEEKQVL  132


 Score = 50.4 bits (119),  Expect(2) = 7e-45, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRF PF  KE TGLEGRTID+GN+K
Sbjct  1    MWRFNPFMLKEPTGLEGRTIDVGNVK  26



>ref|XP_010670934.1| PREDICTED: actin-regulating kinase PRK1-like [Beta vulgaris subsp. 
vulgaris]
Length=656

 Score =   159 bits (402),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 89/107 (83%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V V+N+IAEGGFSCVYL +  ++ SKQYALKHIICND+ES+DL++KEI VMK LKGHPN
Sbjct  26   KVHVKNVIAEGGFSCVYLAKGALNASKQYALKHIICNDQESLDLIMKEIQVMKFLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGRIR-LF*RKQIL  625
            +VTL +H+I DMGRTKEAL+ MEYCEK LV +LEGR    F  KQ+L
Sbjct  86   VVTLHSHTILDMGRTKEALLLMEYCEKCLVHILEGRGSGYFDEKQVL  132


 Score = 48.1 bits (113),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MW+FKPFT KE TGLEGR IDIG++K 
Sbjct  1    MWKFKPFTHKEPTGLEGRYIDIGDIKV  27



>gb|EPS73129.1| hypothetical protein M569_01626, partial [Genlisea aurea]
Length=321

 Score =   159 bits (402),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQV+N+IAEGGFSCVY  RDV+H SKQYALKHI+CND ES++LV+KEI+VMK L+GHPN
Sbjct  26   KVQVKNVIAEGGFSCVYSARDVLHASKQYALKHIVCNDAESLELVMKEISVMKKLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +V+L AH+I DMGRTKEAL+ MEYCEKSLV+VL+ R
Sbjct  86   VVSLQAHTIIDMGRTKEALLLMEYCEKSLVNVLDSR  121


 Score = 47.0 bits (110),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KEQ GLEGR IDIG+ K +
Sbjct  1    MWKFKPFAQKEQIGLEGRLIDIGSFKVQ  28



>ref|XP_003546865.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X1 [Glycine max]
 ref|XP_006598247.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
isoform X2 [Glycine max]
Length=660

 Score =   150 bits (380),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ +   IAEGGFSCVYL RD +H SKQYALKH+ICNDEES+ LV KEI+VMK L GHPN
Sbjct  26   KINIIKAIAEGGFSCVYLARDAVHMSKQYALKHMICNDEESLGLVKKEISVMKMLAGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMGRTKEA + ME+CE+SLV+VLE R    F  KQ+L
Sbjct  86   VVTLHAHAIVDMGRTKEAFVVMEFCERSLVNVLESRGAGYFDEKQVL  132


 Score = 54.7 bits (130),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF+ KEQTGLEGRTID+ NLK
Sbjct  1    MWRFKPFSHKEQTGLEGRTIDVSNLK  26



>ref|XP_008805476.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
 ref|XP_008805477.1| PREDICTED: AP2-associated protein kinase 1-like [Phoenix dactylifera]
Length=702

 Score =   157 bits (396),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 69/96 (72%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN+IAEGGFSCVYL RD ++ SKQYALKH+IC D ES+DLV+KEI+VMK LKGHPN
Sbjct  26   KVHVRNVIAEGGFSCVYLARDAVNSSKQYALKHVICQDGESLDLVMKEISVMKLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH+I DMGRT EA++ ME+CEKSLV+VLE R
Sbjct  86   VVMLVAHAILDMGRTMEAMLVMEFCEKSLVTVLENR  121


 Score = 48.5 bits (114),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFK F  KEQ GLEGRT+D+G+LK
Sbjct  1    MWRFKQFMPKEQAGLEGRTVDVGSLK  26



>ref|XP_010542987.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542988.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542989.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Tarenaya 
hassleriana]
Length=633

 Score =   157 bits (398),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++QVRNIIAEGGFS VYL +D  H SKQYALKHIICND ES++LV+KEI+VMKSLKGHPN
Sbjct  26   KIQVRNIIAEGGFSSVYLAQDATHASKQYALKHIICNDGESLELVMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL +H I DMGR KEAL+ ME+C KSLVSVLE R
Sbjct  86   VVTLYSHGILDMGRKKEALLVMEFCGKSLVSVLESR  121


 Score = 47.8 bits (112),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR +D+GNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRYLDVGNLKIQ  28



>ref|XP_010542991.1| PREDICTED: AP2-associated protein kinase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=632

 Score =   157 bits (398),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 72/96 (75%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++QVRNIIAEGGFS VYL +D  H SKQYALKHIICND ES++LV+KEI+VMKSLKGHPN
Sbjct  26   KIQVRNIIAEGGFSSVYLAQDATHASKQYALKHIICNDGESLELVMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL +H I DMGR KEAL+ ME+C KSLVSVLE R
Sbjct  86   VVTLYSHGILDMGRKKEALLVMEFCGKSLVSVLESR  121


 Score = 47.8 bits (112),  Expect(2) = 4e-44, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR +D+GNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRYLDVGNLKIQ  28



>ref|XP_010522383.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Tarenaya hassleriana]
Length=648

 Score =   157 bits (397),  Expect(2) = 6e-44, Method: Composition-based stats.
 Identities = 73/96 (76%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++QVRNIIAEGGFS VYL +D  + SKQYALKHIICNDEES++LV+KEI+VMKSLKGHPN
Sbjct  26   KIQVRNIIAEGGFSSVYLAQDATNLSKQYALKHIICNDEESLELVMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            IVTL AH + DMGR KEAL+ ME+C KSLVSVLE R
Sbjct  86   IVTLYAHGVLDMGRKKEALLVMEFCGKSLVSVLESR  121


 Score = 47.8 bits (112),  Expect(2) = 6e-44, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR +D+GNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRYLDVGNLKIQ  28



>ref|XP_010522378.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522379.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522380.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522382.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Tarenaya hassleriana]
Length=649

 Score =   157 bits (397),  Expect(2) = 6e-44, Method: Composition-based stats.
 Identities = 73/96 (76%), Positives = 84/96 (88%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++QVRNIIAEGGFS VYL +D  + SKQYALKHIICNDEES++LV+KEI+VMKSLKGHPN
Sbjct  26   KIQVRNIIAEGGFSSVYLAQDATNLSKQYALKHIICNDEESLELVMKEISVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            IVTL AH + DMGR KEAL+ ME+C KSLVSVLE R
Sbjct  86   IVTLYAHGVLDMGRKKEALLVMEFCGKSLVSVLESR  121


 Score = 47.8 bits (112),  Expect(2) = 6e-44, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR +D+GNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRYLDVGNLKIQ  28



>gb|KEH33173.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=678

 Score =   152 bits (385),  Expect(2) = 7e-44, Method: Composition-based stats.
 Identities = 73/107 (68%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V  +IAEGGFSCVYL RD +H SKQYALKHIICNDEES+ LV KEI+VMK L GHPN
Sbjct  26   KLHVHKLIAEGGFSCVYLARDAVHMSKQYALKHIICNDEESLGLVKKEISVMKLLIGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL A++I+DMGRTKEA + ME+CEKSLVSVLE R    F  +Q+L
Sbjct  86   VVTLHANAIYDMGRTKEAFLVMEFCEKSLVSVLESRGAGYFEERQVL  132


 Score = 52.0 bits (123),  Expect(2) = 7e-44, Method: Composition-based stats.
 Identities = 20/27 (74%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MW+FKPF  KEQ GLEGR+ID+GNLK 
Sbjct  1    MWKFKPFAHKEQNGLEGRSIDVGNLKL  27



>ref|XP_010027724.1| PREDICTED: AP2-associated protein kinase 1 isoform X1 [Eucalyptus 
grandis]
Length=703

 Score =   153 bits (386),  Expect(2) = 8e-44, Method: Composition-based stats.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN+IAEGGFSCVYL RD +H S+Q+ALKHIICNDEES+ + +KEI VMKSL GHPN
Sbjct  26   KVHVRNVIAEGGFSCVYLARDALHVSRQFALKHIICNDEESLGVAMKEIAVMKSLAGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH++ DMGRTKE L+ M++CEKSLV VLE R
Sbjct  86   VVALQAHTVLDMGRTKEVLLLMDFCEKSLVHVLESR  121


 Score = 51.2 bits (121),  Expect(2) = 8e-44, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KEQ GLEGR IDIGN+K
Sbjct  1    MWRFKPFGQKEQAGLEGRAIDIGNVK  26



>ref|XP_010027725.1| PREDICTED: AP2-associated protein kinase 1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW54314.1| hypothetical protein EUGRSUZ_I00278 [Eucalyptus grandis]
Length=697

 Score =   153 bits (386),  Expect(2) = 8e-44, Method: Composition-based stats.
 Identities = 67/96 (70%), Positives = 81/96 (84%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN+IAEGGFSCVYL RD +H S+Q+ALKHIICNDEES+ + +KEI VMKSL GHPN
Sbjct  26   KVHVRNVIAEGGFSCVYLARDALHVSRQFALKHIICNDEESLGVAMKEIAVMKSLAGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH++ DMGRTKE L+ M++CEKSLV VLE R
Sbjct  86   VVALQAHTVLDMGRTKEVLLLMDFCEKSLVHVLESR  121


 Score = 51.2 bits (121),  Expect(2) = 8e-44, Method: Composition-based stats.
 Identities = 21/26 (81%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFKPF  KEQ GLEGR IDIGN+K
Sbjct  1    MWRFKPFGQKEQAGLEGRAIDIGNVK  26



>ref|XP_010095876.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXC42162.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=652

 Score =   165 bits (417),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 75/107 (70%), Positives = 94/107 (88%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V+N+IAEGGFSCVYL RD +H SKQYALKHIICND+ES++LV+KEI+VMK+L+GHPN
Sbjct  19   KLHVKNVIAEGGFSCVYLARDAVHLSKQYALKHIICNDDESLELVVKEISVMKALRGHPN  78

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGRIRL-F*RKQIL  625
            +VTL AH+I DMGRTKEAL+ ME+CE+SLVSVLE R  + F  KQ+L
Sbjct  79   VVTLHAHTILDMGRTKEALVVMEFCERSLVSVLESRGSVYFDEKQVL  125



>ref|XP_010913910.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Elaeis guineensis]
Length=702

 Score =   157 bits (397),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 70/96 (73%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN+IAEGGFSCVYL RD ++  KQYALKH+IC D ES+DLV+KEI+VMK LKGHPN
Sbjct  26   KVHVRNVIAEGGFSCVYLARDAVNSFKQYALKHVICQDGESLDLVMKEISVMKLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH+I DMGRTKEAL+ ME+CEKSLV+VLE R
Sbjct  86   VVILVAHTILDMGRTKEALLVMEFCEKSLVTVLENR  121


 Score = 46.6 bits (109),  Expect(2) = 1e-43, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRFK F  KEQ GLEGRT+++G+LK
Sbjct  1    MWRFKQFMPKEQAGLEGRTVEVGSLK  26



>dbj|BAD95980.1| Ser/Thr protein kinase [Lotus japonicus]
Length=307

 Score =   152 bits (385),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V+  IAEGGFSCVYL RD +H SKQYALKHIICNDEES+ LV KEI+V+KSL GHPN
Sbjct  26   KINVQKAIAEGGFSCVYLARDAVHMSKQYALKHIICNDEESLGLVKKEISVIKSLVGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH+IFDMGRTKEA + ME+CEKSLV+VLE R
Sbjct  86   VVTLLAHTIFDMGRTKEAFLVMEFCEKSLVNVLESR  121


 Score = 51.2 bits (121),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFKPF  KE TGLEGR+IDIGNLK 
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDIGNLKI  27



>gb|AFK44489.1| unknown [Lotus japonicus]
Length=147

 Score =   152 bits (383),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V+  IAEGGFSCVYL RD +H SKQYALKHIICNDEES+ LV KEI+V+KSL GHPN
Sbjct  26   KINVQKAIAEGGFSCVYLARDAVHMSKQYALKHIICNDEESLGLVKKEISVIKSLVGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH+IFDMGRTKEA + ME+CEKSLV+VLE R
Sbjct  86   VVTLLAHTIFDMGRTKEAFLVMEFCEKSLVNVLESR  121


 Score = 51.6 bits (122),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFKPF  KE TGLEGR+IDIGNLK 
Sbjct  1    MWRFKPFMHKEPTGLEGRSIDIGNLKI  27



>ref|XP_006647439.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461-like 
[Oryza brachyantha]
Length=666

 Score =   154 bits (389),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IA+GGFSCVYL  D +H SKQYA+KHIICND E +DLV+KEI VM  LKGHPN
Sbjct  26   KITVRNAIAQGGFSCVYLACDTLHPSKQYAMKHIICNDSELLDLVMKEIQVMNLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  86   VVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMESR  121


 Score = 48.5 bits (114),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRF PF  K Q GLEGRTID+GN+K
Sbjct  1    MWRFNPFGGKVQNGLEGRTIDVGNVK  26



>dbj|BAD34080.1| cyclin G-associated kinase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAG93141.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73506.1| hypothetical protein OsI_07872 [Oryza sativa Indica Group]
 gb|EEE57282.1| hypothetical protein OsJ_07336 [Oryza sativa Japonica Group]
Length=667

 Score =   154 bits (388),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IA+GGFSCVYL  D +H SKQYA+KHIICND E +DLV++EI VM  LKGHPN
Sbjct  26   KITVRNAIAQGGFSCVYLASDAMHPSKQYAMKHIICNDSELLDLVMEEIQVMNLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  86   VVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMESR  121


 Score = 49.3 bits (116),  Expect(2) = 2e-43, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWRF PF  K Q GLEGRTID+GN+K
Sbjct  1    MWRFNPFGGKVQNGLEGRTIDVGNIK  26



>ref|XP_002881248.1| hypothetical protein ARALYDRAFT_482227 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57507.1| hypothetical protein ARALYDRAFT_482227 [Arabidopsis lyrata subsp. 
lyrata]
Length=660

 Score =   153 bits (387),  Expect(2) = 7e-43, Method: Composition-based stats.
 Identities = 72/97 (74%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +DV H SKQYALKHIICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDVNHASKQYALKHIICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ M++C KSLV VLE R
Sbjct  86   VVTLYAHGILDMGRNKKEALLAMDFCGKSLVDVLENR  122


 Score = 47.8 bits (112),  Expect(2) = 7e-43, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 23/28 (82%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPFT KE  GLEGR ++IGNLK +
Sbjct  1    MWKFKPFTQKEPAGLEGRFLEIGNLKVQ  28



>ref|XP_008677437.1| PREDICTED: uncharacterized protein LOC100304212 isoform X1 [Zea 
mays]
 gb|AFW62790.1| putative protein kinase superfamily protein [Zea mays]
Length=666

 Score =   154 bits (388),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ V+N IA+GGFSCVYL  D +H SK YALKHIICND ES+DLV+KEI VM  LKGHPN
Sbjct  26   KITVQNAIAQGGFSCVYLACDTVHPSKMYALKHIICNDSESLDLVMKEIQVMNLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  86   VVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMESR  121


 Score = 45.8 bits (107),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 17/26 (65%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MW+  PF  K Q+GL+GRTID+GNLK
Sbjct  1    MWKLNPFGGKAQSGLDGRTIDVGNLK  26



>ref|XP_004952948.1| PREDICTED: AP2-associated protein kinase 1-like isoform X1 [Setaria 
italica]
Length=670

 Score =   155 bits (391),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IA+GGFSCVYL  D +H SK YALKHIICND ES+DLV+KEI VM  LKGHPN
Sbjct  26   KITVRNAIAQGGFSCVYLACDTVHPSKLYALKHIICNDSESLDLVMKEIQVMNLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  86   VVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMESR  121


 Score = 44.7 bits (104),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MWR  PF  K Q+GLEGRT+D+G++K
Sbjct  1    MWRLNPFGGKAQSGLEGRTVDVGSVK  26



>ref|XP_006410418.1| hypothetical protein EUTSA_v10016354mg [Eutrema salsugineum]
 gb|ESQ51871.1| hypothetical protein EUTSA_v10016354mg [Eutrema salsugineum]
Length=674

 Score =   153 bits (387),  Expect(2) = 3e-42, Method: Composition-based stats.
 Identities = 72/97 (74%), Positives = 83/97 (86%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +D  H SKQYALKHIICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDTNHASKQYALKHIICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ ME+C KSLV VLE R
Sbjct  86   VVTLYAHGILDMGRNKKEALLAMEFCGKSLVEVLENR  122


 Score = 45.8 bits (107),  Expect(2) = 3e-42, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR ++IGNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQ  28



>ref|XP_009408443.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like, 
partial [Musa acuminata subsp. malaccensis]
Length=632

 Score =   148 bits (374),  Expect(2) = 4e-42, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN+IA+GGFSCVY+  D    SKQYALKH+ICND ES DLV+KEI+VMK L+GHPN
Sbjct  26   KVHVRNVIAQGGFSCVYIALDPAQSSKQYALKHMICNDAESSDLVMKEISVMKLLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL AH+I DMG  KEAL+ MEYCEKSLV+VL  R    F  KQIL
Sbjct  86   VVTLIAHTILDMGWRKEALLVMEYCEKSLVTVLGNRGAGYFEEKQIL  132


 Score = 50.4 bits (119),  Expect(2) = 4e-42, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MW FKPFT KE  GLEGRTID+GN+K
Sbjct  1    MWMFKPFTGKEPVGLEGRTIDVGNVK  26



>ref|XP_003575255.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
 ref|XP_010235617.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
 ref|XP_010235618.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Brachypodium distachyon]
Length=672

 Score =   154 bits (389),  Expect(2) = 5e-42, Method: Composition-based stats.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IA+GGFSCVYL  D +H SKQYALKHIICND ES+DLV+KEI VM  LKGH N
Sbjct  26   KITVRNAIAQGGFSCVYLACDTLHSSKQYALKHIICNDLESLDLVMKEIQVMNVLKGHAN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  86   VVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMESR  121


 Score = 43.9 bits (102),  Expect(2) = 5e-42, Method: Composition-based stats.
 Identities = 19/26 (73%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            M RF PF  K Q GLEGRTIDIGN+K
Sbjct  1    MRRFNPFGGKVQNGLEGRTIDIGNVK  26



>ref|NP_850199.1| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAN64167.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AEC08752.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=670

 Score =   152 bits (384),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +DV H SKQYALKH+ICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDVNHASKQYALKHMICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ M++C KSLV VLE R
Sbjct  86   VVTLYAHGILDMGRNKKEALLAMDFCGKSLVDVLENR  122


 Score = 45.8 bits (107),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR ++IGNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRFLEIGNLKVQ  28



>gb|AAL60023.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=650

 Score =   152 bits (384),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +DV H SKQYALKH+ICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDVNHASKQYALKHMICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ M++C KSLV VLE R
Sbjct  86   VVTLYAHGILDMGRNKKEALLAMDFCGKSLVDVLENR  122


 Score = 45.8 bits (107),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR ++IGNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRFLEIGNLKVQ  28



>ref|NP_565756.1| protein kinase superfamily protein [Arabidopsis thaliana]
 gb|AAB91980.2| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAM14904.1| putative serine threonine protein kinase [Arabidopsis thaliana]
 gb|AAM67308.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAN12961.1| putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AEC08751.1| protein kinase superfamily protein [Arabidopsis thaliana]
Length=650

 Score =   152 bits (384),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 71/97 (73%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +DV H SKQYALKH+ICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDVNHASKQYALKHMICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ M++C KSLV VLE R
Sbjct  86   VVTLYAHGILDMGRNKKEALLAMDFCGKSLVDVLENR  122


 Score = 45.8 bits (107),  Expect(2) = 6e-42, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR ++IGNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRFLEIGNLKVQ  28



>ref|XP_004952949.1| PREDICTED: AP2-associated protein kinase 1-like isoform X2 [Setaria 
italica]
Length=609

 Score =   153 bits (387),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IA+GGFSCVYL  D +H SK YALKHIICND ES+DLV+KEI VM  LKGHPN
Sbjct  26   KITVRNAIAQGGFSCVYLACDTVHPSKLYALKHIICNDSESLDLVMKEIQVMNLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  86   VVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMESR  121


 Score = 44.3 bits (103),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWR  PF  K Q+GLEGRT+D+G++K 
Sbjct  1    MWRLNPFGGKAQSGLEGRTVDVGSVKI  27



>dbj|BAD34081.1| putative AAK1 protein [Oryza sativa Japonica Group]
Length=308

 Score =   149 bits (377),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IA+GGFSCVYL  D +H SKQYA+KHIICND E +DLV++EI VM  LKGHPN
Sbjct  26   KITVRNAIAQGGFSCVYLASDAMHPSKQYAMKHIICNDSELLDLVMEEIQVMNLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  86   VVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMESR  121


 Score = 48.1 bits (113),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRF PF  K Q GLEGRTID+GN+K 
Sbjct  1    MWRFNPFGGKVQNGLEGRTIDVGNIKI  27



>ref|XP_006293803.1| hypothetical protein CARUB_v10022785mg [Capsella rubella]
 gb|EOA26701.1| hypothetical protein CARUB_v10022785mg [Capsella rubella]
Length=672

 Score =   151 bits (382),  Expect(2) = 7e-42, Method: Composition-based stats.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +D  H SKQYALKHIICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDANHASKQYALKHIICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ ME C KSLV VLE R
Sbjct  86   VVTLFAHGILDMGRNKKEALLAMELCGKSLVDVLENR  122


 Score = 46.2 bits (108),  Expect(2) = 7e-42, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR ++IGNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQ  28



>ref|XP_010413940.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
Length=671

 Score =   151 bits (382),  Expect(2) = 7e-42, Method: Composition-based stats.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +D  H SKQYALKHIICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDANHASKQYALKHIICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ ME C KSLV VLE R
Sbjct  86   VVTLYAHGILDMGRNKKEALLAMELCGKSLVDVLENR  122


 Score = 46.2 bits (108),  Expect(2) = 7e-42, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR ++IGNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQ  28



>ref|XP_010469538.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X1 [Camelina sativa]
Length=672

 Score =   151 bits (382),  Expect(2) = 8e-42, Method: Composition-based stats.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +D  H SKQYALKHIICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDANHASKQYALKHIICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ ME C KSLV VLE R
Sbjct  86   VVTLYAHGILDMGRNKKEALLAMELCGKSLVDVLENR  122


 Score = 46.2 bits (108),  Expect(2) = 8e-42, Method: Composition-based stats.
 Identities = 18/28 (64%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR ++IGNLK +
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQ  28



>ref|XP_010469539.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Camelina sativa]
Length=598

 Score =   151 bits (382),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +D  H SKQYALKHIICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDANHASKQYALKHIICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ ME C KSLV VLE R
Sbjct  86   VVTLYAHGILDMGRNKKEALLAMELCGKSLVDVLENR  122


 Score = 45.8 bits (107),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFKF  320
            MW+FKPF  KE  GLEGR ++IGNLK + 
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQV  29



>ref|XP_010469540.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X3 [Camelina sativa]
Length=550

 Score =   151 bits (381),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +D  H SKQYALKHIICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDANHASKQYALKHIICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ ME C KSLV VLE R
Sbjct  86   VVTLYAHGILDMGRNKKEALLAMELCGKSLVDVLENR  122


 Score = 46.2 bits (108),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFKF  320
            MW+FKPF  KE  GLEGR ++IGNLK + 
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGNLKVQV  29



>gb|EMT28285.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=668

 Score =   155 bits (391),  Expect(2) = 1e-41, Method: Composition-based stats.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IA+GGFSCVYL  D +H SKQYALKHIICND ES+DLV+KEI VM  LKGH N
Sbjct  26   KITVRNAIAQGGFSCVYLACDALHSSKQYALKHIICNDSESLDLVMKEIQVMNLLKGHAN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  86   VVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMESR  121


 Score = 42.0 bits (97),  Expect(2) = 1e-41, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            M RF PF  K QTGLEGRTID+ N+K
Sbjct  1    MRRFNPFGGKVQTGLEGRTIDVRNVK  26



>ref|XP_009143925.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Brassica rapa]
Length=583

 Score =   153 bits (387),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 4/110 (4%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +D  H SKQYALKH+ICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDTTHPSKQYALKHMICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGR-TKEALICMEYCEKSLVSVLEGR---IRLF*RKQIL  625
            +VTL AH I DMGR  KEAL+ ME+C KSLV VLE R      F  KQ+L
Sbjct  86   VVTLYAHGILDMGRGKKEALLAMEFCGKSLVEVLESRGGGAGYFEEKQVL  135


 Score = 43.5 bits (101),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR ++IG+LK +
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGSLKVQ  28



>ref|XP_006850020.1| hypothetical protein AMTR_s00022p00186280 [Amborella trichopoda]
 gb|ERN11601.1| hypothetical protein AMTR_s00022p00186280 [Amborella trichopoda]
Length=706

 Score =   151 bits (382),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 74/107 (69%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN IAEGGFS VYL RDV    KQ+A+KHI CNDEE++DLV KE +VMKSLKGHPN
Sbjct  26   KVQVRNTIAEGGFSSVYLVRDVGPSGKQFAMKHIFCNDEETLDLVKKEFSVMKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +V L AH+I DMGRTKEA + ME+CEKSLV+VLE R    F  KQIL
Sbjct  86   VVALQAHTILDMGRTKEAFLVMEFCEKSLVTVLENRGAAYFEEKQIL  132


 Score = 45.1 bits (105),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MWR K F  KE  GLEGR+IDIGNLK +
Sbjct  1    MWRLKQFMPKEPLGLEGRSIDIGNLKVQ  28



>ref|XP_010509956.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
 ref|XP_010509957.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Camelina sativa]
Length=673

 Score =   151 bits (382),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 72/97 (74%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQVRN+IAEGGFS VYL +D  H SKQYALKHIICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQVRNVIAEGGFSSVYLAQDANHASKQYALKHIICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR  595
            +VTL AH I DMGR  KEAL+ ME C KSLV VLE R
Sbjct  86   VVTLYAHGILDMGRNKKEALLAMELCGKSLVDVLENR  122


 Score = 44.3 bits (103),  Expect(2) = 3e-41, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+FKPF  KE  GLEGR ++IG+LK +
Sbjct  1    MWKFKPFAQKEPAGLEGRYLEIGSLKVQ  28



>ref|XP_009395097.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877461}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009395098.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877461}-like 
[Musa acuminata subsp. malaccensis]
Length=670

 Score =   149 bits (375),  Expect(2) = 5e-41, Method: Composition-based stats.
 Identities = 67/107 (63%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN IAEGGFSC+Y+  DV+  SKQYALKH+ICND++ +DL++KEI+VMK L+GHPN
Sbjct  26   KVHVRNAIAEGGFSCIYVATDVVQPSKQYALKHVICNDDDLLDLIMKEISVMKLLRGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGRIR-LF*RKQIL  625
            +V L AH+I DMGR KEAL+ ME+CEKSL ++LE R    F  KQ+L
Sbjct  86   VVALVAHTILDMGRRKEALLVMEFCEKSLATLLENRGSGYFEEKQVL  132


 Score = 46.2 bits (108),  Expect(2) = 5e-41, Method: Composition-based stats.
 Identities = 18/26 (69%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLK  311
            MW FKPF  KE   LEGRTID+GN+K
Sbjct  1    MWMFKPFAGKEPASLEGRTIDVGNVK  26



>ref|XP_010235619.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
isoform X2 [Brachypodium distachyon]
Length=612

 Score =   150 bits (380),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IA+GGFSCVYL  D +H SKQYALKHIICND ES+DLV+KEI VM  LKGH N
Sbjct  26   KITVRNAIAQGGFSCVYLACDTLHSSKQYALKHIICNDLESLDLVMKEIQVMNVLKGHAN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH +FDMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  86   VVTLVAHDVFDMGRTKEALLVMEFCEKSLVSAMESR  121


 Score = 44.3 bits (103),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            M RF PF  K Q GLEGRTIDIGN+K 
Sbjct  1    MRRFNPFGGKVQNGLEGRTIDIGNVKI  27



>ref|XP_004956476.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111-like 
[Setaria italica]
Length=699

 Score =   152 bits (384),  Expect(2) = 6e-41, Method: Composition-based stats.
 Identities = 68/96 (71%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VR  IAEGGFSCVY  RD+++ ++QYALKH+I  DEES++LV KEI VM+SLKGHPN
Sbjct  27   KVHVREAIAEGGFSCVYAARDMVNPARQYALKHVIIQDEESLELVRKEITVMRSLKGHPN  86

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH+I DMGRT+EAL+ ME+CEKSLVSVLEGR
Sbjct  87   VVTLIAHTILDMGRTREALLVMEFCEKSLVSVLEGR  122


 Score = 42.4 bits (98),  Expect(2) = 6e-41, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 1/27 (4%)
 Frame = +3

Query  234  MWRFKPFTAKEQTG-LEGRTIDIGNLK  311
            MWR K F  KEQ G LEGRT+D+GN+K
Sbjct  1    MWRLKQFIPKEQPGGLEGRTVDVGNVK  27



>ref|XP_009394517.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009394519.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009394520.1| PREDICTED: AP2-associated protein kinase 1 {ECO:0000303|PubMed:11877457}-like 
[Musa acuminata subsp. malaccensis]
Length=704

 Score =   155 bits (392),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 1/107 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++QVRN+IAEGGFSCVYL RD ++ SKQYALKH+IC DEES+ L +KEI+VMK LKGHPN
Sbjct  26   KLQVRNVIAEGGFSCVYLARDAVNPSKQYALKHMICQDEESLGLAMKEISVMKMLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +V L AH+I DMGR KE L+ ME+CEKSLV+VLE R    F  KQ+L
Sbjct  86   VVVLIAHTILDMGRVKEVLLVMEFCEKSLVAVLENRGAGYFEEKQVL  132


 Score = 38.5 bits (88),  Expect(2) = 1e-40, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFK  317
            MW+ K F  KE   LEGR +++GNLK +
Sbjct  1    MWKLKQFMPKEPNSLEGRMVEVGNLKLQ  28



>gb|AFW72091.1| putative protein kinase superfamily protein [Zea mays]
Length=735

 Score =   155 bits (391),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IA+GGFSCVYL  D +H SK YALKHIICND ES+DLV+KEI VM  LKGHPN
Sbjct  245  KISVRNVIAQGGFSCVYLACDTVHPSKMYALKHIICNDSESLDLVMKEIQVMNLLKGHPN  304

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH + DMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  305  VVTLVAHDVVDMGRTKEALLVMEFCEKSLVSAMESR  340



>emb|CDY52551.1| BnaA05g35100D [Brassica napus]
Length=241

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 87/110 (79%), Gaps = 4/110 (4%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +VQ RN+IAEGGFS VYL +D  H SKQYALKH+ICNDEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVQARNVIAEGGFSSVYLAQDTTHPSKQYALKHMICNDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGR-TKEALICMEYCEKSLVSVLEGR---IRLF*RKQIL  625
            +VTL AH I DMGR  KEAL+ ME+C KSLV VLE R      F  KQ+L
Sbjct  86   VVTLYAHGILDMGRGKKEALLAMEFCGKSLVEVLESRGGGAGYFEEKQVL  135



>emb|CDX79504.1| BnaC03g18400D [Brassica napus]
Length=607

 Score =   147 bits (370),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN+IAEGGFS VYL +D  H SKQYALKHIIC+DEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVHVRNLIAEGGFSSVYLAQDTNHASKQYALKHIICHDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +V L AH I DMGR  KEAL+ MEYC KSLV V+E R    F  KQ L
Sbjct  86   VVALYAHGILDMGRNKKEALLAMEYCGKSLVEVIENRGAGYFEEKQAL  133


 Score = 43.5 bits (101),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MW+FKPF  KE +GLEGR ++IG+LK 
Sbjct  1    MWKFKPFAQKEPSGLEGRYLEIGSLKV  27



>ref|XP_009132906.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0280111 
[Brassica rapa]
Length=612

 Score =   146 bits (369),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN+IAEGGFS VYL +D  H SKQYALKHIIC+DEES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVHVRNLIAEGGFSSVYLAQDTNHASKQYALKHIICHDEESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +V L AH I DMGR  KEAL+ MEYC KSLV V+E R    F  KQ L
Sbjct  86   VVALHAHGILDMGRNKKEALLAMEYCGKSLVEVIENRGAGYFEEKQAL  133


 Score = 43.5 bits (101),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MW+FKPF  KE +GLEGR ++IG+LK 
Sbjct  1    MWKFKPFAQKEPSGLEGRYLEIGSLKV  27



>emb|CDX84704.1| BnaA03g15260D [Brassica napus]
Length=612

 Score =   145 bits (367),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VRN+IAEGGFS VYL +D  H SKQYALKHIIC+D+ES++LV+KEI+V+KSLKGHPN
Sbjct  26   KVHVRNLIAEGGFSSVYLAQDTSHASKQYALKHIICHDDESLELVMKEISVLKSLKGHPN  85

Query  488  IVTLCAHSIFDMGRT-KEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +V L AH I DMGR  KEAL+ MEYC KSLV V+E R    F  KQ L
Sbjct  86   VVALHAHGILDMGRNKKEALLAMEYCGKSLVEVIENRGAGYFEEKQAL  133


 Score = 43.5 bits (101),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MW+FKPF  KE +GLEGR ++IG+LK 
Sbjct  1    MWKFKPFAQKEPSGLEGRYLEIGSLKV  27



>gb|AFW72092.1| putative protein kinase superfamily protein [Zea mays]
Length=516

 Score =   151 bits (382),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN+IA+GGFSCVYL  D +H SK YALKHIICND ES+DLV+KEI VM  LKGHPN
Sbjct  26   KISVRNVIAQGGFSCVYLACDTVHPSKMYALKHIICNDSESLDLVMKEIQVMNLLKGHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH + DMGRTKEAL+ ME+CEKSLVS +E R
Sbjct  86   VVTLVAHDVVDMGRTKEALLVMEFCEKSLVSAMESR  121



>tpg|DAA39365.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=603

 Score =   144 bits (362),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VR  IAEGGFS VY  RD+++ +KQYALK +I  DEES++LV KEI VM+SLKGHPN
Sbjct  29   KVHVREAIAEGGFSSVYAARDLVNPAKQYALKRVIVQDEESLNLVQKEITVMRSLKGHPN  88

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH+I DMGR +EAL+ ME+C KSLVSVLEGR
Sbjct  89   VVTLVAHAILDMGRMREALLLMEFCGKSLVSVLEGR  124


 Score = 42.7 bits (99),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 3/30 (10%)
 Frame = +3

Query  234  MWRFKPFTAKEQ---TGLEGRTIDIGNLKF  314
            MWR K F  KEQ   +GLEGRT+D+GN+K 
Sbjct  1    MWRLKQFIPKEQPSPSGLEGRTVDVGNVKV  30



>ref|XP_011042010.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase DDB_G0276461 [Populus euphratica]
Length=428

 Score =   140 bits (353),  Expect(3) = 9e-38, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 78/94 (83%), Gaps = 5/94 (5%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++ VRN IAEGGFSCVYL RD +H +KQYALKH+ICNDEES++LV+K+INVMK+LK HPN
Sbjct  26   KIHVRNAIAEGGFSCVYLARDAVHAAKQYALKHMICNDEESLELVVKDINVMKALKRHPN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLE  589
            +VTL AH+I DMGR K      E+CEKSL SVLE
Sbjct  86   VVTLYAHTILDMGRAK-----XEFCEKSLFSVLE  114


 Score = 43.1 bits (100),  Expect(3) = 9e-38, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKF  314
            MWRFK FT KE  GLEGR++D+G LK 
Sbjct  1    MWRFKHFTQKEPAGLEGRSLDVGILKI  27


 Score = 21.2 bits (43),  Expect(3) = 9e-38, Method: Compositional matrix adjust.
 Identities = 8/19 (42%), Positives = 14/19 (74%), Gaps = 0/19 (0%)
 Frame = +3

Query  564  RNLWLVYWRAGSGYFEENR  620
            ++L+ V   +G+GYFEE +
Sbjct  107  KSLFSVLESSGAGYFEEEQ  125



>ref|XP_008671591.1| PREDICTED: probable serine/threonine-protein kinase DDB_G0276461 
[Zea mays]
Length=640

 Score =   141 bits (355),  Expect(2) = 1e-37, Method: Composition-based stats.
 Identities = 65/96 (68%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VR  IAEGGFS VY  RD+++ +KQYALK +I  DEES++LV KEI VM+SLKGHPN
Sbjct  29   KVHVREAIAEGGFSSVYAARDLVNPAKQYALKRVIVQDEESLNLVQKEITVMRSLKGHPN  88

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH+I DMGR +EAL+ ME+C KSLVSVLEGR
Sbjct  89   VVTLVAHAILDMGRMREALLLMEFCGKSLVSVLEGR  124


 Score = 42.4 bits (98),  Expect(2) = 1e-37, Method: Composition-based stats.
 Identities = 18/29 (62%), Positives = 22/29 (76%), Gaps = 3/29 (10%)
 Frame = +3

Query  234  MWRFKPFTAKEQ---TGLEGRTIDIGNLK  311
            MWR K F  KEQ   +GLEGRT+D+GN+K
Sbjct  1    MWRLKQFIPKEQPSPSGLEGRTVDVGNVK  29



>gb|EEE69334.1| hypothetical protein OsJ_28650 [Oryza sativa Japonica Group]
Length=1010

 Score =   135 bits (341),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VR  +AEGGFSCVYL RD  + +KQYALKH++  DEES+DLV KEI VM+SLKGHPN
Sbjct  27   RVHVREPVAEGGFSCVYLARDAANPAKQYALKHVVIQDEESLDLVRKEIMVMRSLKGHPN  86

Query  488  IVTLCAHSIFDM-GRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH++ D  GR +EAL+ ME+CEKSLV+ LE R
Sbjct  87   VVALVAHAVLDTGGRAREALLVMEFCEKSLVAALESR  123


 Score = 41.2 bits (95),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 22/27 (81%), Gaps = 1/27 (4%)
 Frame = +3

Query  234  MWRFKPFTAKEQ-TGLEGRTIDIGNLK  311
            MWR K F  +EQ +GLEGRT+D+GN++
Sbjct  1    MWRLKQFMPREQPSGLEGRTVDVGNVR  27



>dbj|BAD26025.1| putative AAK1 protein [Oryza sativa Japonica Group]
Length=703

 Score =   135 bits (341),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VR  +AEGGFSCVYL RD  + +KQYALKH++  DEES+DLV KEI VM+SLKGHPN
Sbjct  27   RVHVREPVAEGGFSCVYLARDAANPAKQYALKHVVIQDEESLDLVRKEIMVMRSLKGHPN  86

Query  488  IVTLCAHSIFDM-GRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH++ D  GR +EAL+ ME+CEKSLV+ LE R
Sbjct  87   VVALVAHAVLDTGGRAREALLVMEFCEKSLVAALESR  123


 Score = 41.2 bits (95),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 22/27 (81%), Gaps = 1/27 (4%)
 Frame = +3

Query  234  MWRFKPFTAKEQ-TGLEGRTIDIGNLK  311
            MWR K F  +EQ +GLEGRT+D+GN++
Sbjct  1    MWRLKQFMPREQPSGLEGRTVDVGNVR  27



>gb|EAZ08411.1| hypothetical protein OsI_30675 [Oryza sativa Indica Group]
Length=703

 Score =   135 bits (341),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VR  +AEGGFSCVYL RD  + +KQYALKH++  DEES+DLV KEI VM+SLKGHPN
Sbjct  27   RVHVREPVAEGGFSCVYLARDAANPAKQYALKHVVIQDEESLDLVRKEIMVMRSLKGHPN  86

Query  488  IVTLCAHSIFDM-GRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH++ D  GR +EAL+ ME+CEKSLV+ LE R
Sbjct  87   VVALVAHAVLDTGGRAREALLVMEFCEKSLVAALESR  123


 Score = 41.2 bits (95),  Expect(2) = 1e-35, Method: Composition-based stats.
 Identities = 16/27 (59%), Positives = 22/27 (81%), Gaps = 1/27 (4%)
 Frame = +3

Query  234  MWRFKPFTAKEQ-TGLEGRTIDIGNLK  311
            MWR K F  +EQ +GLEGRT+D+GN++
Sbjct  1    MWRLKQFMPREQPSGLEGRTVDVGNVR  27



>ref|XP_010237997.1| PREDICTED: AP2-associated protein kinase 1-like [Brachypodium 
distachyon]
Length=697

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 64/96 (67%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VR  IAEGGFS VYL RD+++ ++QYALKH+I  D ES+DLV KEI VM+SLKGHPN
Sbjct  31   KVHVREAIAEGGFSFVYLARDLMNPARQYALKHVIVQDRESLDLVQKEITVMRSLKGHPN  90

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH+I DMGR +EAL+ ME+CE+SLVS LE R
Sbjct  91   VVTLVAHAILDMGRAREALLLMEFCERSLVSTLESR  126



>dbj|BAJ97005.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=693

 Score =   142 bits (358),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 63/96 (66%), Positives = 79/96 (82%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VR  IAEGGFSCVYL RD+ + +K YALKH+I  D+ES+DLV KEI VM++LKGHPN
Sbjct  31   KVHVREAIAEGGFSCVYLARDLTNPAKHYALKHVIVQDKESLDLVHKEITVMRALKGHPN  90

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH+I DMGR +EAL+ ME+CE+SLVS L+ R
Sbjct  91   VVTLVAHTILDMGRGREALLLMEFCERSLVSALDAR  126



>gb|EMT09791.1| Putative serine/threonine-protein kinase [Aegilops tauschii]
Length=685

 Score =   139 bits (350),  Expect(2) = 8e-35, Method: Composition-based stats.
 Identities = 62/96 (65%), Positives = 78/96 (81%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VR  IAEGGFSCVYL RD+ + +KQYALKH+I  D+E +DLV KEI VM++LKGHPN
Sbjct  31   KVHVREAIAEGGFSCVYLARDLTNPAKQYALKHVIVQDKELLDLVQKEITVMRALKGHPN  90

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR  595
            +VTL AH+I D GR +EAL+ ME+CE+SLVS L+ R
Sbjct  91   VVTLVAHAILDTGRGREALLLMEFCERSLVSALDAR  126


 Score = 35.0 bits (79),  Expect(2) = 8e-35, Method: Composition-based stats.
 Identities = 17/31 (55%), Positives = 21/31 (68%), Gaps = 5/31 (16%)
 Frame = +3

Query  234  MWR-FKPFTAKEQTG----LEGRTIDIGNLK  311
            MWR F+    KE +G    LEGRTID+GN+K
Sbjct  1    MWRPFRQLMPKEHSGPSGGLEGRTIDVGNVK  31



>ref|XP_002972735.1| hypothetical protein SELMODRAFT_98319 [Selaginella moellendorffii]
 gb|EFJ25956.1| hypothetical protein SELMODRAFT_98319 [Selaginella moellendorffii]
Length=543

 Score =   133 bits (335),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++QVR+++AEGGFS VYL RD   G K YALKH+ICND+ES+ LV KE+ VMK+L+GHPN
Sbjct  26   KLQVRSVVAEGGFSSVYLARDAQSG-KNYALKHLICNDDESLHLVRKEVAVMKALRGHPN  84

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            IVTL AH++   GRTKE  + M+YCEK+LV+VL+ R    F  +Q+L
Sbjct  85   IVTLHAHAVLANGRTKECFLVMDYCEKTLVAVLDARGAGFFEERQLL  131


 Score = 38.9 bits (89),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFKF  320
            MWR K    K+Q GLEG+++++G LK + 
Sbjct  1    MWRLKQLMPKDQAGLEGKSVEVGTLKLQV  29



>ref|XP_002993350.1| hypothetical protein SELMODRAFT_187420 [Selaginella moellendorffii]
 gb|EFJ05535.1| hypothetical protein SELMODRAFT_187420 [Selaginella moellendorffii]
Length=319

 Score =   129 bits (325),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 83/107 (78%), Gaps = 2/107 (2%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++QVR+++AEGGFS VYL RD   G K YALKH+ICND+ES+ LV KE+ VMK+L+GHPN
Sbjct  26   KLQVRSVVAEGGFSSVYLARDAQSG-KNYALKHLICNDDESLHLVRKEVAVMKALRGHPN  84

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            IVTL AH++   GRTKE  + M+YCEK+LV+VL+ R    F  +Q+L
Sbjct  85   IVTLHAHAVLANGRTKECFLVMDYCEKTLVAVLDARGAGFFEERQLL  131


 Score = 38.1 bits (87),  Expect(2) = 6e-33, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 20/29 (69%), Gaps = 0/29 (0%)
 Frame = +3

Query  234  MWRFKPFTAKEQTGLEGRTIDIGNLKFKF  320
            MWR K    K+Q GLEG+++++G LK + 
Sbjct  1    MWRLKQLMPKDQAGLEGKSVEVGALKLQV  29



>ref|XP_006660487.1| PREDICTED: AP2-associated protein kinase 1-like [Oryza brachyantha]
Length=710

 Score =   126 bits (316),  Expect(2) = 4e-32, Method: Composition-based stats.
 Identities = 56/97 (58%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +V VR  IAEGGFSCVYL RD    ++QYALKH++  DE+S+ LV +EI  M+SL+GHPN
Sbjct  27   RVHVREPIAEGGFSCVYLARDAASPARQYALKHVVVQDEDSLGLVRREITAMRSLRGHPN  86

Query  488  IVTLCAHSIFDM-GRTKEALICMEYCEKSLVSVLEGR  595
            +V L AH++ D  GR +EAL+ ME+C+KSLV+ LE R
Sbjct  87   VVALVAHAVLDAGGRAREALLVMEFCDKSLVAALESR  123


 Score = 38.9 bits (89),  Expect(2) = 4e-32, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 21/27 (78%), Gaps = 1/27 (4%)
 Frame = +3

Query  234  MWRFKPFTAKEQ-TGLEGRTIDIGNLK  311
            MWR K    +EQ +GLEGRT+D+GN++
Sbjct  1    MWRLKQLMPREQPSGLEGRTVDVGNVR  27



>ref|XP_001769351.1| predicted protein [Physcomitrella patens]
 gb|EDQ65720.1| predicted protein [Physcomitrella patens]
Length=666

 Score =   122 bits (307),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 2/107 (2%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++QVR++IA+GGFS VYL ++   G K YALKHIICND ES++LV KE+ VMK+L+GHPN
Sbjct  28   KLQVRSVIAQGGFSSVYLAKESSTG-KTYALKHIICNDVESVELVKKEVAVMKALRGHPN  86

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQIL  625
            +VTL    ++D GRTKE  + MEYC K L  VLE R    +  KQIL
Sbjct  87   VVTLHGQVVYDCGRTKECFLVMEYCHKMLAHVLENRGAGYYDEKQIL  133


 Score = 33.1 bits (74),  Expect(2) = 2e-29, Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 20/30 (67%), Gaps = 2/30 (7%)
 Frame = +3

Query  234  MWRFKPFTAKEQTG--LEGRTIDIGNLKFK  317
            MWR K F   ++ G  LEG+ +D+G+LK +
Sbjct  1    MWRLKQFMPNKEAGGTLEGKHVDVGDLKLQ  30



>emb|CDY12158.1| BnaC04g11880D [Brassica napus]
Length=577

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +2

Query  362  GRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAHSIFDMGR-TKE  538
             +D  H SKQYALKH++CND+ES++LV+KEI+V+KSL+GHPN+VTL AH I DMGR  KE
Sbjct  49   AQDTSHPSKQYALKHMVCNDDESLELVMKEISVLKSLRGHPNVVTLYAHGILDMGRGKKE  108

Query  539  ALICMEYCEKSLVSVLEGR  595
            AL+ ME+C KSLV VLE R
Sbjct  109  ALLAMEFCGKSLVEVLESR  127



>ref|XP_011087160.1| PREDICTED: AP2-associated protein kinase 1 isoform X4 [Sesamum 
indicum]
 ref|XP_011087168.1| PREDICTED: AP2-associated protein kinase 1 isoform X4 [Sesamum 
indicum]
Length=626

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 1/62 (2%)
 Frame = +2

Query  443  LKEINVMKSLKGHPNIVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLEGR-IRLF*RKQ  619
            +KEI+VMK+LKGHPN+VTL AH+IFDMGRTKEA + MEYCEKSLV+VLE R    F  KQ
Sbjct  1    MKEISVMKTLKGHPNVVTLHAHAIFDMGRTKEAFLLMEYCEKSLVNVLESRGAGFFDEKQ  60

Query  620  IL  625
            +L
Sbjct  61   VL  62



>gb|EKC40964.1| Cyclin G-associated kinase [Crassostrea gigas]
Length=1383

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +2

Query  302  QSQVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGH  481
            Q +++VR +IAEGGF+ VY+ +DV  G K YALK ++ +D+E  ++V+ EI  +K L GH
Sbjct  32   QQKLRVRRVIAEGGFAFVYVAQDVTTG-KDYALKRLLAHDKEKNEMVMNEIKYLKKLSGH  90

Query  482  PNIVT-LCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  592
            PNIV  + A S  D G+  E L+  E C   L+SVL G
Sbjct  91   PNIVEFIAAASDSDKGQC-EYLLLTELCTGQLISVLNG  127



>ref|XP_011427792.1| PREDICTED: cyclin-G-associated kinase-like [Crassostrea gigas]
Length=1471

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 45/98 (46%), Positives = 64/98 (65%), Gaps = 3/98 (3%)
 Frame = +2

Query  302  QSQVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGH  481
            Q +++VR +IAEGGF+ VY+ +DV  G K YALK ++ +D+E  ++V+ EI  +K L GH
Sbjct  32   QQKLRVRRVIAEGGFAFVYVAQDVTTG-KDYALKRLLAHDKEKNEMVMNEIKYLKKLSGH  90

Query  482  PNIVT-LCAHSIFDMGRTKEALICMEYCEKSLVSVLEG  592
            PNIV  + A S  D G+  E L+  E C   L+SVL G
Sbjct  91   PNIVEFIAAASDSDKGQC-EYLLLTELCTGQLISVLNG  127



>gb|ERL88847.1| hypothetical protein D910_06229 [Dendroctonus ponderosae]
Length=1135

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++++R +IAEGGF+ V++ +D   G K YALK ++  DEE+   +L+EINV+K + GHPN
Sbjct  35   KLKIREVIAEGGFAVVFIAQDTATG-KDYALKRLLAADEEAKKNILQEINVLKRISGHPN  93

Query  488  IVTLCAHSIFDMGRT----KEALICMEYCE-KSLVSVLEGRIRLF  607
            I+   + S  D  +T     E L+  E C   SLV +L+ R   F
Sbjct  94   IIQYLSASFIDKSQTDHGQSEFLLVTELCPGGSLVDLLKSRTTAF  138



>gb|ENN75844.1| hypothetical protein YQE_07573, partial [Dendroctonus ponderosae]
Length=1146

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 64/105 (61%), Gaps = 6/105 (6%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++++R +IAEGGF+ V++ +D   G K YALK ++  DEE+   +L+EINV+K + GHPN
Sbjct  35   KLKIREVIAEGGFAVVFIAQDTATG-KDYALKRLLAADEEAKKNILQEINVLKRISGHPN  93

Query  488  IVTLCAHSIFDMGRT----KEALICMEYCE-KSLVSVLEGRIRLF  607
            I+   + S  D  +T     E L+  E C   SLV +L+ R   F
Sbjct  94   IIQYLSASFIDKSQTDHGQSEFLLVTELCPGGSLVDLLKSRTTAF  138



>ref|XP_001742841.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ93079.1| predicted protein [Monosiga brevicollis MX1]
Length=445

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 66/108 (61%), Gaps = 5/108 (5%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
             V + ++IAEGGF  VYL   V  G+K+YALK ++ +D+E++D   +EI  MK L  H N
Sbjct  29   HVTIESLIAEGGFGSVYL---VTDGAKKYALKKVMVHDQETLDATTREIEFMKQLPFHHN  85

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKS-LVSVLEGRI-RLF*RKQIL  625
            IVT+ A  +   G+  E +I ME+C    +V ++  R+ R F  +++L
Sbjct  86   IVTIHASDLKPAGKHAEVVILMEHCPGGHVVDIMNRRLTRPFTEREVL  133



>ref|XP_967193.1| PREDICTED: cyclin-G-associated kinase [Tribolium castaneum]
 gb|EFA09916.1| hypothetical protein TcasGA2_TC012067 [Tribolium castaneum]
Length=1123

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 39/101 (39%), Positives = 64/101 (63%), Gaps = 6/101 (6%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ V++ +DV  G K YALK ++  DEE+ + +++EIN++K L GHPN
Sbjct  35   KLRIKKVIAEGGFAVVFVAQDVATG-KDYALKRLLAADEEAKNNIMQEINILKKLAGHPN  93

Query  488  IVTLCAHSIFDMGRTK----EALICMEYCE-KSLVSVLEGR  595
            I+   + S  D  +T     E L+  E C   SL  +L+ R
Sbjct  94   IIQYLSASFIDKSQTTHGKAEFLLVTELCTGGSLAEILQAR  134



>ref|XP_004927169.1| PREDICTED: cyclin-G-associated kinase-like [Bombyx mori]
Length=354

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 68/111 (61%), Gaps = 6/111 (5%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++V+ +IAEGGF+ V++ +DV  G+ +YALK ++  DE++   +++EI+++K L GHPN
Sbjct  35   KLRVKKVIAEGGFAFVFVAQDVTTGT-EYALKRLMAADEQANKNIIQEISILKKLSGHPN  93

Query  488  IVTLCAHSIFDMGRTK----EALICMEYCE-KSLVSVLEGRIRLF*RKQIL  625
            I+   A S  D  +T     E L+  + C   SL+  L+ R + F    IL
Sbjct  94   IIKYIAASFIDKTKTSHGMGEYLLLTDLCSGGSLMEALQNRGQAFPLPTIL  144



>ref|XP_003934667.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Saimiri boliviensis 
boliviensis]
Length=1311

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 62/99 (63%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKRLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+ ME C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLMELCKGQLVEFLK  135



>pdb|4C59|A Chain A, Structure Of Gak Kinase In Complex With Nanobody (nbgak_4)
 pdb|4C58|A Chain A, Structure Of Gak Kinase In Complex With Nanobody (nbgak_4)
 pdb|4C57|A Chain A, Structure Of Gak Kinase In Complex With A Nanobody
 pdb|4C57|B Chain B, Structure Of Gak Kinase In Complex With A Nanobody
Length=340

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  28   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  86

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  87   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  124



>dbj|BAK62989.1| cyclin G-associated kinase [Pan troglodytes]
Length=402

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_010804661.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Bos taurus]
Length=1138

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>ref|NP_001039549.1| cyclin-G-associated kinase [Bos taurus]
 gb|AAI05344.1| Cyclin G associated kinase [Bos taurus]
Length=1268

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>tpg|DAA28426.1| TPA: cyclin-G-associated kinase [Bos taurus]
Length=1268

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>gb|EAW82645.1| cyclin G associated kinase, isoform CRA_b [Homo sapiens]
Length=747

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|EDL20101.1| cyclin G associated kinase, isoform CRA_c [Mus musculus]
Length=135

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 59/96 (61%), Gaps = 7/96 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVS  580
            IV  C+ +       D G+  E L+  E C+   VS
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKAGGVS  132



>ref|XP_004521204.1| PREDICTED: cyclin-G-associated kinase-like isoform X2 [Ceratitis 
capitata]
Length=1237

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/100 (40%), Positives = 60/100 (60%), Gaps = 6/100 (6%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++V+ +IAEGGF+ VY+ +DV  G K+YALK +I  D+++ + ++ EIN  K L GHPN
Sbjct  53   KLRVKRVIAEGGFAFVYVAQDVQTG-KEYALKRLIGTDKQACNAIINEINTHKQLSGHPN  111

Query  488  IVTLCAHSIFDMG----RTKEALICMEYCE-KSLVSVLEG  592
            IVT    +  D      +  E L+  E C   SL+  L G
Sbjct  112  IVTFVGAAFIDKTTGPQQRAEYLLLTELCNGGSLIDCLNG  151



>ref|XP_005272330.1| PREDICTED: cyclin-G-associated kinase isoform X6 [Homo sapiens]
Length=1140

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_004521203.1| PREDICTED: cyclin-G-associated kinase-like isoform X1 [Ceratitis 
capitata]
Length=1278

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 40/100 (40%), Positives = 60/100 (60%), Gaps = 6/100 (6%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++V+ +IAEGGF+ VY+ +DV  G K+YALK +I  D+++ + ++ EIN  K L GHPN
Sbjct  53   KLRVKRVIAEGGFAFVYVAQDVQTG-KEYALKRLIGTDKQACNAIINEINTHKQLSGHPN  111

Query  488  IVTLCAHSIFDMG----RTKEALICMEYCE-KSLVSVLEG  592
            IVT    +  D      +  E L+  E C   SL+  L G
Sbjct  112  IVTFVGAAFIDKTTGPQQRAEYLLLTELCNGGSLIDCLNG  151



>ref|XP_009445459.1| PREDICTED: cyclin-G-associated kinase isoform X10 [Pan troglodytes]
Length=1197

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008961966.1| PREDICTED: cyclin-G-associated kinase isoform X9 [Pan paniscus]
Length=1197

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008016367.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Chlorocebus 
sabaeus]
Length=1236

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005272327.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Homo sapiens]
Length=1236

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008016366.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Chlorocebus 
sabaeus]
Length=1262

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005554310.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Macaca fascicularis]
Length=1262

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005272326.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Homo sapiens]
Length=1262

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009445456.1| PREDICTED: cyclin-G-associated kinase isoform X7 [Pan troglodytes]
Length=1272

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008961964.1| PREDICTED: cyclin-G-associated kinase isoform X6 [Pan paniscus]
Length=1272

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009445453.1| PREDICTED: cyclin-G-associated kinase isoform X5 [Pan troglodytes]
Length=1300

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008961962.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Pan paniscus]
Length=1300

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005272325.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Homo sapiens]
Length=1300

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009445452.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Pan troglodytes]
Length=1306

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_010373626.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Rhinopithecus 
roxellana]
Length=1311

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008016365.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Chlorocebus 
sabaeus]
Length=1311

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|NP_005246.2| cyclin-G-associated kinase isoform 1 [Homo sapiens]
 sp|O14976.2|GAK_HUMAN RecName: Full=Cyclin-G-associated kinase [Homo sapiens]
Length=1311

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>dbj|BAA22623.1| HsGAK [Homo sapiens]
Length=1311

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_005554309.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Macaca fascicularis]
Length=1311

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_004038357.1| PREDICTED: cyclin-G-associated kinase isoform 1 [Gorilla gorilla 
gorilla]
Length=1311

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|NP_001125100.1| cyclin-G-associated kinase [Pongo abelii]
 emb|CAH90237.1| hypothetical protein [Pongo abelii]
Length=1311

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_003811350.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Pan paniscus]
Length=1311

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|EHH14197.1| Cyclin-G-associated kinase [Macaca mulatta]
Length=1311

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_001140835.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Pan troglodytes]
Length=1311

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009445451.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Pan troglodytes]
Length=1344

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008961961.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Pan paniscus]
Length=1344

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009445450.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Pan troglodytes]
Length=1355

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008961960.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Pan paniscus]
Length=1355

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_004993486.1| NAK protein kinase [Salpingoeca rosetta]
 gb|EGD73923.1| NAK protein kinase [Salpingoeca rosetta]
Length=909

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 37/98 (38%), Positives = 59/98 (60%), Gaps = 3/98 (3%)
 Frame = +2

Query  311  VQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNI  490
            V + + +AEGGF  V++  D  H  ++YALK ++  D+ES++   +E+ +MK L GH NI
Sbjct  39   VHITSKLAEGGFGSVFVAEDDQH--QRYALKKMLVLDQESLEATTREVELMKRLPGHSNI  96

Query  491  VTLCAHSIFDMGRTKEALICMEYCEKS-LVSVLEGRIR  601
            V L A  +   GR  E L+ MEYC    +V ++  R++
Sbjct  97   VQLLASEVKPNGRHAEVLLLMEYCPGGHVVDIMNRRLK  134



>emb|CDR17154.1| serine/threonine protein kinase, putative [Plasmodium chabaudi 
chabaudi]
Length=707

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  326  IIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCA  505
            +I+EG +S VYL  D ++ +K Y +K  IC ++E +++  KEIN++KSL  H NIV    
Sbjct  29   LISEGAYSFVYLAND-LNTNKTYTIKKTICQNKEKLEMAKKEINILKSLPPHKNIVQYFG  87

Query  506  HSIFDMGRTKEALICMEYCEK-SLVSVLE  589
             +I D    K  ++ MEYCEK +L+++ E
Sbjct  88   STIIDENNYKIVIMLMEYCEKGNLLNIYE  116



>ref|XP_536279.4| PREDICTED: cyclin-G-associated kinase isoform X7 [Canis lupus 
familiaris]
Length=1304

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLASG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFLK  135



>ref|XP_010992219.1| PREDICTED: cyclin-G-associated kinase, partial [Camelus dromedarius]
Length=516

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 62/99 (63%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ ++EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSDEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+ ME C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLMELCKGQLVEFLK  135



>ref|XP_010992167.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-G-associated kinase-like 
[Camelus dromedarius]
Length=1233

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 62/99 (63%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ ++EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSDEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+ ME C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLMELCKGQLVEFLK  135



>ref|XP_424873.4| PREDICTED: cyclin-G-associated kinase [Gallus gallus]
Length=1318

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 39/101 (39%), Positives = 61/101 (60%), Gaps = 7/101 (7%)
 Frame = +2

Query  302  QSQVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGH  481
            + ++++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GH
Sbjct  36   EMKLRIRRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGH  94

Query  482  PNIVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            PNIV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  95   PNIVQFCSAASIGKEESDTGQ-GEFLLLTELCKGQLVEFLK  134



>ref|XP_006874199.1| PREDICTED: cyclin-G-associated kinase [Chrysochloris asiatica]
Length=1362

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G K+YALK ++ N+EE    V++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-KEYALKRLLSNEEEKSRAVIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  ++
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFVK  135



>ref|XP_010787144.1| PREDICTED: cyclin-G-associated kinase-like, partial [Notothenia 
coriiceps]
Length=264

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   MVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|NP_001016350.2| cyclin-G-associated kinase [Xenopus (Silurana) tropicalis]
 gb|AAI55676.1| gak protein [Xenopus (Silurana) tropicalis]
Length=1322

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 58/98 (59%), Gaps = 7/98 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++V+ +IAEGGF+ VY  +DV  G K YALK ++ N+EE    +++EI  MK L GHPN
Sbjct  38   KMRVKRVIAEGGFAFVYEAQDVGSG-KDYALKRLLSNEEEKNKSIIQEICFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  586
            IV  C+ +       D G+  E L+  E C   LV  L
Sbjct  97   IVQFCSAASIGKEESDTGQ-GEFLLLTELCRGQLVEFL  133



>emb|CBY34407.1| unnamed protein product [Oikopleura dioica]
Length=727

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = +2

Query  311  VQVRNIIAEGGFSCVYLGRDVIHGSK--QYALKHIICNDEESMDLVLKEINVMKSLKGHP  484
            V + +++AEGGFS VYL    I  +K  + ALK +  NDEE+++    EI VM+ L GH 
Sbjct  24   VHIESVLAEGGFSIVYLANAKIQNAKSSKAALKRMFVNDEETLNGCKNEIQVMRKLTGHK  83

Query  485  NIVTLCAHSIFDMGR-TKEALICMEYCEKSLV  577
            NIV   AH I  +   T E L+ +EYC +  V
Sbjct  84   NIVRYMAHKITCLKNGTHEVLVLIEYCSRGHV  115



>emb|CBY18714.1| unnamed protein product [Oikopleura dioica]
Length=727

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 54/92 (59%), Gaps = 3/92 (3%)
 Frame = +2

Query  311  VQVRNIIAEGGFSCVYLGRDVIHGSK--QYALKHIICNDEESMDLVLKEINVMKSLKGHP  484
            V + +++AEGGFS VYL    I  +K  + ALK +  NDEE+++    EI VM+ L GH 
Sbjct  24   VHIESVLAEGGFSIVYLANAKIQNAKSSKAALKRMFVNDEETLNGCKNEIQVMRKLTGHK  83

Query  485  NIVTLCAHSIFDMGR-TKEALICMEYCEKSLV  577
            NIV   AH I  +   T E L+ +EYC +  V
Sbjct  84   NIVRYMAHKITCLKNGTHEVLVLIEYCSRGHV  115



>pdb|4O38|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase 
(gak)
 pdb|4O38|B Chain B, Crystal Structure Of The Human Cyclin G Associated Kinase 
(gak)
Length=338

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+   K L GHPN
Sbjct  30   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFXKKLSGHPN  88

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  89   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  126



>ref|XP_006747975.1| PREDICTED: cyclin-G-associated kinase-like [Leptonychotes weddellii]
Length=1151

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_004617496.1| PREDICTED: cyclin-G-associated kinase [Sorex araneus]
Length=1283

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_004396292.1| PREDICTED: cyclin-G-associated kinase [Odobenus rosmarus divergens]
Length=1309

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008062193.1| PREDICTED: cyclin-G-associated kinase [Tarsius syrichta]
Length=1310

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_003801191.1| PREDICTED: cyclin-G-associated kinase [Otolemur garnettii]
Length=1341

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_008622630.1| NAK protein kinase [Plasmodium vinckei vinckei]
 gb|KEG03824.1| NAK protein kinase [Plasmodium vinckei vinckei]
Length=716

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  326  IIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCA  505
            +I+EG +S VYL  D ++ +K Y +K  IC ++E +++  KEIN++KSL  H NIV    
Sbjct  29   LISEGAYSFVYLAND-LNTNKTYTIKKTICQNKEKLEMAKKEINILKSLPPHKNIVQYFG  87

Query  506  HSIFDMGRTKEALICMEYCEK-SLVSVLE  589
             +I D    K  ++ MEYCE+ +L+++ E
Sbjct  88   STIIDENNYKIVIMLMEYCERGNLLNIYE  116



>ref|XP_004383590.1| PREDICTED: cyclin-G-associated kinase [Trichechus manatus latirostris]
Length=1324

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G K+YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-KEYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  ++
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFIK  135



>ref|XP_003280582.1| PREDICTED: cyclin-G-associated kinase [Nomascus leucogenys]
Length=1466

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDMGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>emb|CDS52482.1| serine/threonine protein kinase, putative [Plasmodium berghei 
ANKA]
Length=710

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +2

Query  311  VQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNI  490
            ++  N+I+EG +S VYL  D ++ +K Y +K  IC ++E +++  KEIN++KSL  H NI
Sbjct  24   IKEDNLISEGAYSFVYLAND-LNTNKIYTIKKTICQNKEKLEMAKKEINILKSLPPHKNI  82

Query  491  VTLCAHSIFDMGRTKEALICMEYCEK-SLVSVLE  589
            V     +I +    K  ++ MEYCE+ +L+++ E
Sbjct  83   VQYYGSTIINENNYKIVIMLMEYCERGNLLNIFE  116



>gb|EHJ76158.1| hypothetical protein KGM_16646 [Danaus plexippus]
Length=1097

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 6/111 (5%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++V+ +IAEGGF+ V++ +DV  G+ ++ALK ++  DE++   +++EI+++K L GHPN
Sbjct  2    KLRVKKVIAEGGFAFVFVAQDVSSGT-EFALKRLMAADEQANKNIIQEISILKKLSGHPN  60

Query  488  IVTLCAHSIFDMGRTK----EALICMEYCE-KSLVSVLEGRIRLF*RKQIL  625
            I+   A S  D  +T     E L+  + C   SL+  L+ R + F    IL
Sbjct  61   IIKYIAASFLDKTKTTHGMGEYLLLTDLCSGGSLMEALQNRGQAFPLSTIL  111



>ref|XP_010227060.1| PREDICTED: cyclin-G-associated kinase [Tinamus guttatus]
Length=1321

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++V+ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRVKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  97   IVQFCSAASIGKEESDTGQ-GEFLLLTELCKGQLVEFLK  134



>ref|XP_007671018.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Ornithorhynchus 
anatinus]
Length=1276

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_007671017.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Ornithorhynchus 
anatinus]
Length=1280

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_007671016.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Ornithorhynchus 
anatinus]
Length=1331

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_007671015.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Ornithorhynchus 
anatinus]
Length=1333

 Score = 71.2 bits (173),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_009052187.1| hypothetical protein LOTGIDRAFT_174596 [Lottia gigantea]
 gb|ESO97114.1| hypothetical protein LOTGIDRAFT_174596 [Lottia gigantea]
Length=1209

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 39/98 (40%), Positives = 60/98 (61%), Gaps = 6/98 (6%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++V+ +IAEGGF+ V++ +DV  G K+YALK ++ NDEE  + V+ EI  +K L GHPN
Sbjct  34   KLRVKKVIAEGGFAFVFIAQDVSSG-KEYALKRLLANDEEKNNAVMNEIRFLKKLTGHPN  92

Query  488  IVTLCAHSIFDMGRT----KEALICMEYCE-KSLVSVL  586
            I+   + +  +  ++     E LI  E C    LVS L
Sbjct  93   IIQFISAAAINKDQSDHGQSEYLILTELCPGGELVSYL  130



>gb|EDL20100.1| cyclin G associated kinase, isoform CRA_b [Mus musculus]
Length=129

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 57/91 (63%), Gaps = 7/91 (8%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCE  565
            IV  C+ +       D G+  E L+  E C+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCK  127



>ref|XP_004432258.1| PREDICTED: cyclin-G-associated kinase [Ceratotherium simum simum]
Length=1301

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 59/98 (60%), Gaps = 7/98 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLESG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  586
            IV  C+ +       D G+  E L+  E C   LV  L
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFL  134



>ref|XP_007557930.1| PREDICTED: cyclin-G-associated kinase [Poecilia formosa]
Length=1308

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D + G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQD-MSGGKDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   MVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_008416260.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Poecilia reticulata]
Length=1309

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D + G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQD-MSGGKDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   MVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_008416258.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Poecilia reticulata]
Length=1312

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D + G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQD-MSGGKDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   MVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>gb|KDR23238.1| Cyclin G-associated kinase [Zootermopsis nevadensis]
Length=1311

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 62/98 (63%), Gaps = 6/98 (6%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++V+ +IAEGGF+ V++ +D   G K YALK +I  DE++ +++ +EIN+++ L GHPN
Sbjct  35   KLRVKKVIAEGGFAFVFMAQDPNTG-KDYALKRLIAADEDANNIIKQEINILRKLSGHPN  93

Query  488  IVTLCAHSIFDMGRT----KEALICMEYCE-KSLVSVL  586
            I+   A +  D  ++     E L+  E C   SLV VL
Sbjct  94   IIQYLAAAYIDRSKSGHGCGEYLLVTELCTGGSLVDVL  131



>dbj|GAM19078.1| hypothetical protein SAMD00019534_022530 [Acytostelium subglobosum 
LB1]
Length=936

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 3/78 (4%)
 Frame = +2

Query  329  IAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCAH  508
            IAEGGFS VYL +D    SKQYALK I+  DEE ++  + EI++M+ L+ H NIV    H
Sbjct  29   IAEGGFSYVYLVKDN-QSSKQYALKRILVRDEEDLEFTMHEIHIMERLRNHKNIVRYIDH  87

Query  509  SIFDMGRTKEALICMEYC  562
                   T E  I ME+C
Sbjct  88   Q--HSSSTNEVFILMEFC  103



>ref|XP_007181552.1| PREDICTED: cyclin-G-associated kinase, partial [Balaenoptera 
acutorostrata scammoni]
Length=1221

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 12/94 (13%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  3    RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  61

Query  488  IVTLCAHSIFDMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+            L+ ME C   LV  L+
Sbjct  62   IVQFCSF-----------LLLMELCRGQLVEFLK  84



>ref|XP_009562989.1| PREDICTED: cyclin-G-associated kinase [Cuculus canorus]
Length=1231

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  5    KLRIRRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  63

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  L+  L+
Sbjct  64   IVQFCSAASIGKEESDTGQ-GEFLLLTELCKGQLMEFLK  101



>ref|XP_003341497.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-G-associated kinase [Monodelphis 
domestica]
Length=1339

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_006790164.1| PREDICTED: cyclin-G-associated kinase-like [Neolamprologus brichardi]
Length=1235

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIRRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
             V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   TVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_002187781.1| PREDICTED: cyclin-G-associated kinase [Taeniopygia guttata]
Length=1259

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  97   IVQFCSAASIGKEESDTGQ-GEFLLLTELCKGQLVEFLK  134



>ref|XP_004546976.1| PREDICTED: cyclin-G-associated kinase-like isoform X3 [Maylandia 
zebra]
Length=1313

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIRRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
             V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   TVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_004546975.1| PREDICTED: cyclin-G-associated kinase-like isoform X2 [Maylandia 
zebra]
Length=1314

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIRRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
             V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   TVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_005738184.1| PREDICTED: cyclin-G-associated kinase-like [Pundamilia nyererei]
Length=1317

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIRRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
             V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   TVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_004546974.1| PREDICTED: cyclin-G-associated kinase-like isoform X1 [Maylandia 
zebra]
Length=1317

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIRRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
             V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   TVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_005924577.1| PREDICTED: cyclin-G-associated kinase-like [Haplochromis burtoni]
Length=1319

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            ++++R +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIRRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
             V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   TVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>ref|XP_005061068.1| PREDICTED: cyclin-G-associated kinase [Ficedula albicollis]
Length=1316

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  97   IVQFCSAASIGKEESDTGQ-GEFLLLTELCKGQLVEFLK  134



>ref|XP_005154929.1| PREDICTED: cyclin-G-associated kinase [Melopsittacus undulatus]
Length=1317

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  97   IVQFCSAASIGKEESDTGQ-GEFLLLTELCKGQLVEFLK  134



>ref|XP_005486323.1| PREDICTED: cyclin-G-associated kinase [Zonotrichia albicollis]
Length=1318

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  97   IVQFCSAASIGKEESDTGQ-GEFLLLTELCKGQLVEFLK  134



>ref|XP_007953955.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Orycteropus 
afer afer]
Length=1321

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  ++
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFIK  135



>ref|XP_006259318.1| PREDICTED: cyclin-G-associated kinase [Alligator mississippiensis]
Length=1325

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  97   VVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFLK  134



>gb|ETW29800.1| NAK protein kinase [Plasmodium falciparum FCH/4]
Length=426

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  326  IIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCA  505
            +I+EG +S VY+ +D ++ ++ Y +K  IC D+E +D+  KEIN++KSL  H NIV    
Sbjct  29   LISEGAYSFVYMAKD-LNTNRAYTIKKTICQDKEKIDMAHKEINILKSLPPHKNIVQYYG  87

Query  506  HSIFDMGRTKEALICMEYCEK-SLVSVLE  589
             +I      K  ++ MEYCE+ +L+++ +
Sbjct  88   STIISENNYKIVIMLMEYCERGNLLNIFQ  116



>ref|XP_005530967.1| PREDICTED: cyclin-G-associated kinase [Pseudopodoces humilis]
Length=1318

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  97   IVQFCSAASIGKEESDTGQ-GEFLLLTELCKGQLVGFLK  134



>ref|XP_009299490.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Danio rerio]
Length=1264

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D +  SK YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   KLRIKRVIAEGGFAFVYEAQD-LGSSKDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C   LV  ++
Sbjct  98   VVQFCSAASISKEESDTGQA-EFLILTELCRGQLVDFVK  135



>ref|XP_009299489.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Danio rerio]
Length=1278

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D +  SK YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   KLRIKRVIAEGGFAFVYEAQD-LGSSKDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C   LV  ++
Sbjct  98   VVQFCSAASISKEESDTGQA-EFLILTELCRGQLVDFVK  135



>ref|XP_009299488.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Danio rerio]
Length=1280

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D +  SK YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   KLRIKRVIAEGGFAFVYEAQD-LGSSKDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C   LV  ++
Sbjct  98   VVQFCSAASISKEESDTGQA-EFLILTELCRGQLVDFVK  135



>emb|CDU20974.1| serine/threonine protein kinase, putative [Plasmodium yoelii]
 emb|CDZ14603.1| serine/threonine protein kinase, putative [Plasmodium yoelii]
Length=728

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  326  IIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCA  505
            +I+EG +S VYL  D ++ +K Y +K  IC ++E +++  KEIN++KSL  H NIV    
Sbjct  29   LISEGAYSFVYLAND-LNTNKTYTIKKTICQNKEKLEMAKKEINILKSLPPHKNIVQYYG  87

Query  506  HSIFDMGRTKEALICMEYCEK-SLVSVLE  589
             +I +    K  ++ MEYCE+ +L+++ E
Sbjct  88   STIINENNYKIVIMLMEYCERGNLLNIFE  116



>ref|XP_005359727.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Microtus ochrogaster]
Length=1280

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 60/98 (61%), Gaps = 7/98 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR I+AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRILAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  586
            IV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_005359726.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Microtus ochrogaster]
Length=1302

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 60/98 (61%), Gaps = 7/98 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR I+AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRILAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  586
            IV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_005359725.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Microtus ochrogaster]
Length=1304

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/98 (39%), Positives = 60/98 (61%), Gaps = 7/98 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR I+AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRILAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  586
            IV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>gb|ETB62031.1| NAK protein kinase [Plasmodium yoelii 17X]
Length=743

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  326  IIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCA  505
            +I+EG +S VYL  D ++ +K Y +K  IC ++E +++  KEIN++KSL  H NIV    
Sbjct  29   LISEGAYSFVYLAND-LNTNKTYTIKKTICQNKEKLEMAKKEINILKSLPPHKNIVQYYG  87

Query  506  HSIFDMGRTKEALICMEYCEK-SLVSVLE  589
             +I +    K  ++ MEYCE+ +L+++ E
Sbjct  88   STIINENNYKIVIMLMEYCERGNLLNIFE  116



>ref|XP_004319454.1| PREDICTED: cyclin-G-associated kinase-like, partial [Tursiops 
truncatus]
Length=1052

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GH N
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHAN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>ref|XP_005309018.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Chrysemys picta 
bellii]
Length=1039

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  97   IVQFCSAASIGKEESDTGQ-GEFLLLTELCKGQLVEFLK  134



>gb|ETW35160.1| NAK protein kinase [Plasmodium falciparum Tanzania (2000708)]
Length=559

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  326  IIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCA  505
            +I+EG +S VY+ +D ++ ++ Y +K  IC D+E +D+  KEIN++KSL  H NIV    
Sbjct  29   LISEGAYSFVYMAKD-LNTNRAYTIKKTICQDKEKIDMANKEINILKSLPPHKNIVQYYG  87

Query  506  HSIFDMGRTKEALICMEYCEK-SLVSVLE  589
             +I      K  ++ MEYCE+ +L+++ +
Sbjct  88   STIISENNYKIVIMLMEYCERGNLLNIFQ  116



>ref|XP_004265273.1| PREDICTED: cyclin-G-associated kinase [Orcinus orca]
Length=1278

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  MK L GH N
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHAN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+ ME C   LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLMELCRGQLVEFLK  135



>gb|EUD74684.1| NAK protein kinase [Plasmodium vinckei petteri]
Length=708

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  326  IIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCA  505
            +I+EG +S VYL  D ++ +K Y +K  IC ++E +++  KEIN++KSL  H NIV    
Sbjct  29   LISEGAYSFVYLAVD-LNTNKTYTIKKTICQNKEKLEMAKKEINILKSLPPHKNIVQYFG  87

Query  506  HSIFDMGRTKEALICMEYCEK-SLVSVLE  589
             +I D    K  ++ MEYCE+ +L+++ E
Sbjct  88   STIIDENNYKIVIMLMEYCERGNLLNIYE  116



>gb|ETW59946.1| NAK protein kinase [Plasmodium falciparum CAMP/Malaysia]
Length=585

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  326  IIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCA  505
            +I+EG +S VY+ +D ++ ++ Y +K  IC D+E +D+  KEIN++KSL  H NIV    
Sbjct  29   LISEGAYSFVYMAKD-LNTNRAYTIKKTICQDKEKIDMANKEINILKSLPPHKNIVQYYG  87

Query  506  HSIFDMGRTKEALICMEYCEK-SLVSVLE  589
             +I      K  ++ MEYCE+ +L+++ +
Sbjct  88   STIISENNYKIVIMLMEYCERGNLLNIFQ  116



>gb|EMC87866.1| Cyclin G-associated kinase [Columba livia]
Length=1289

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  97   IVQFCSAASIGKEESDTGQ-GEFLLLTELCRGQLVEFLK  134



>ref|XP_005504640.1| PREDICTED: cyclin-G-associated kinase [Columba livia]
Length=1316

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 59/99 (60%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDLGSG-KDYALKRLLSNEEEKNKAIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  97   IVQFCSAASIGKEESDTGQ-GEFLLLTELCRGQLVEFLK  134



>ref|XP_006534969.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Mus musculus]
Length=1221

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|ETW47992.1| NAK protein kinase [Plasmodium falciparum MaliPS096_E11]
Length=495

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = +2

Query  326  IIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPNIVTLCA  505
            +I+EG +S VY+ +D ++ ++ Y +K  IC D+E +D+  KEIN++KSL  H NIV    
Sbjct  29   LISEGAYSFVYMAKD-LNTNRAYTIKKTICQDKEKIDMANKEINILKSLPPHKNIVQYYG  87

Query  506  HSIFDMGRTKEALICMEYCEK-SLVSVLE  589
             +I      K  ++ MEYCE+ +L+++ +
Sbjct  88   STIISENNYKIVIMLMEYCERGNLLNIFQ  116



>ref|XP_006534968.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Mus musculus]
Length=1256

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|EDL20099.1| cyclin G associated kinase, isoform CRA_a [Mus musculus]
Length=1297

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>dbj|BAE27365.1| unnamed protein product [Mus musculus]
Length=1305

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|NP_705797.1| cyclin-G-associated kinase isoform 1 [Mus musculus]
 gb|AAH65052.1| Cyclin G associated kinase [Mus musculus]
 dbj|BAE38941.1| unnamed protein product [Mus musculus]
Length=1305

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>sp|Q99KY4.2|GAK_MOUSE RecName: Full=Cyclin-G-associated kinase [Mus musculus]
 gb|AAH60622.1| Cyclin G associated kinase [Mus musculus]
Length=1305

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>ref|XP_004656112.1| PREDICTED: cyclin-G-associated kinase [Jaculus jaculus]
Length=1311

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  135



>gb|EDL20105.1| cyclin G associated kinase, isoform CRA_g [Mus musculus]
Length=1323

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  57   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  115

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  L+
Sbjct  116  IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFLK  153



>ref|XP_008281749.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Stegastes partitus]
Length=1311

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   MVQFCSAASISKEESDTGQA-EFLILTELCKGQLVEFIK  134



>ref|XP_008281748.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Stegastes partitus]
Length=1314

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   MVQFCSAASISKEESDTGQA-EFLILTELCKGQLVEFIK  134



>ref|XP_008281747.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Stegastes partitus]
Length=1315

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   MVQFCSAASISKEESDTGQA-EFLILTELCKGQLVEFIK  134



>ref|XP_008281746.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Stegastes partitus]
Length=1318

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   MVQFCSAASISKEESDTGQA-EFLILTELCKGQLVEFIK  134



>ref|XP_005801068.1| PREDICTED: cyclin-G-associated kinase-like [Xiphophorus maculatus]
Length=1308

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++++ +IAEGGF+ VY  +D+  G K YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  38   KLRIKRVIAEGGFAFVYEAQDMSSG-KDYALKRLLSNEEEKNKEIIQEVCFMKKLSGHPN  96

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            +V  C+ +       D G+  E LI  E C+  LV  ++
Sbjct  97   MVQFCSAASISKEESDTGQA-EFLILTELCKGQLVDFIK  134



>gb|AAH63606.1| GAK protein [Homo sapiens]
Length=587

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +DV  G ++YALK ++ N+EE    +++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDVGSG-REYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPN  97

Query  488  IVTLCA  505
            IV  C+
Sbjct  98   IVQFCS  103



>ref|XP_004847543.1| PREDICTED: cyclin-G-associated kinase isoform X8 [Heterocephalus 
glaber]
Length=1089

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 60/99 (61%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C   LV  L+
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCRGQLVEFLK  135



>ref|XP_006893652.1| PREDICTED: cyclin-G-associated kinase isoform X1 [Elephantulus 
edwardii]
Length=1320

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G K YALK ++ ++EE   ++++E+  MK L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-KAYALKRLLSDEEEQSRVIIQEVCFMKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVLE  589
            IV  C+ +       D G+  E L+  E C+  LV  ++
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVDFIK  135



>ref|XP_008840008.1| PREDICTED: cyclin-G-associated kinase isoform X4 [Nannospalax 
galili]
Length=1251

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/98 (38%), Positives = 60/98 (61%), Gaps = 7/98 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  586
            IV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_006250646.1| PREDICTED: cyclin-G-associated kinase isoform X2 [Rattus norvegicus]
Length=1256

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/98 (38%), Positives = 60/98 (61%), Gaps = 7/98 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  586
            IV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_008840007.1| PREDICTED: cyclin-G-associated kinase isoform X3 [Nannospalax 
galili]
Length=1258

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/98 (38%), Positives = 60/98 (61%), Gaps = 7/98 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  586
            IV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



>ref|XP_006985869.1| PREDICTED: cyclin-G-associated kinase [Peromyscus maniculatus 
bairdii]
Length=1278

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 37/98 (38%), Positives = 60/98 (61%), Gaps = 7/98 (7%)
 Frame = +2

Query  308  QVQVRNIIAEGGFSCVYLGRDVIHGSKQYALKHIICNDEESMDLVLKEINVMKSLKGHPN  487
            +++VR ++AEGGF+ VY  +D+  G ++YALK ++ N+EE    +++E+  +K L GHPN
Sbjct  39   RLRVRRVLAEGGFAFVYEAQDLGSG-REYALKRLLSNEEEKNRAIIQEVCFLKKLSGHPN  97

Query  488  IVTLCAHSIF-----DMGRTKEALICMEYCEKSLVSVL  586
            IV  C+ +       D G+  E L+  E C+  LV  L
Sbjct  98   IVQFCSAASIGKEESDTGQA-EFLLLTELCKGQLVEFL  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897347644380