BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045I24

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB40104.1|  hypothetical protein B456_007G047000                  76.3    9e-13   Gossypium raimondii
gb|KJB40103.1|  hypothetical protein B456_007G047000                  76.3    1e-12   Gossypium raimondii
gb|KHG00890.1|  DEAD-box ATP-dependent RNA helicase 30                74.7    3e-12   Gossypium arboreum [tree cotton]
ref|XP_009769444.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  73.6    9e-12   Nicotiana sylvestris
ref|XP_002512773.1|  dead box ATP-dependent RNA helicase, putative    72.4    2e-11   
ref|XP_010102487.1|  DEAD-box ATP-dependent RNA helicase 20           72.0    3e-11   Morus notabilis
ref|XP_008464518.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  71.2    4e-11   Cucumis melo [Oriental melon]
ref|XP_008365657.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  71.6    4e-11   
ref|XP_008464517.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  71.2    6e-11   Cucumis melo [Oriental melon]
ref|XP_009594348.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  70.9    7e-11   Nicotiana tomentosiformis
emb|CDP12744.1|  unnamed protein product                              70.9    9e-11   Coffea canephora [robusta coffee]
gb|AHZ57095.1|  cold responsive DEAD-box RNA helicase                 69.7    1e-10   Chorispora bungeana
gb|AFW97645.1|  cold responsive DEAD-box RNA helicase                 69.7    2e-10   Chorispora bungeana
ref|XP_009345779.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  69.7    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_009363040.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  69.3    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_010484039.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010444192.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010459859.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006280217.1|  hypothetical protein CARUB_v10026128mg           68.9    3e-10   
ref|XP_002866536.1|  hypothetical protein ARALYDRAFT_496494           68.9    3e-10   
ref|XP_006439906.1|  hypothetical protein CICLE_v10019394mg           68.9    3e-10   
ref|XP_010484038.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010444189.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006280218.1|  hypothetical protein CARUB_v10026128mg           68.9    3e-10   Capsella rubella
ref|XP_006476871.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.6    3e-10   
ref|XP_010459851.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    3e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006439909.1|  hypothetical protein CICLE_v10019394mg           68.9    3e-10   Citrus clementina [clementine]
ref|XP_011047813.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    3e-10   Populus euphratica
ref|XP_006476870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  68.9    3e-10   Citrus sinensis [apfelsine]
ref|NP_568964.1|  DEAD-box ATP-dependent RNA helicase 30              68.6    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002318665.2|  ethylene-responsive DEAD box RNA helicase fa...  68.6    4e-10   
dbj|BAB10554.1|  ATP-dependent RNA helicase-like protein              68.2    5e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974985.1|  DEAD-box ATP-dependent RNA helicase 30              68.2    5e-10   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25761.1|  hypothetical protein AALP_AA8G156100                  68.2    6e-10   Arabis alpina [alpine rockcress]
ref|XP_006394312.1|  hypothetical protein EUTSA_v10003871mg           68.2    6e-10   Eutrema salsugineum [saltwater cress]
ref|XP_010663104.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.8    8e-10   Vitis vinifera
emb|CBI14965.3|  unnamed protein product                              67.8    8e-10   Vitis vinifera
emb|CAN78903.1|  hypothetical protein VITISV_026451                   67.8    9e-10   Vitis vinifera
ref|XP_010550696.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.4    9e-10   Tarenaya hassleriana [spider flower]
ref|XP_004299135.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.4    1e-09   Fragaria vesca subsp. vesca
ref|XP_009112064.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.0    1e-09   Brassica rapa
ref|XP_009112063.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  67.0    1e-09   Brassica rapa
emb|CDY16735.1|  BnaA09g06470D                                        67.0    1e-09   Brassica napus [oilseed rape]
emb|CDY48128.1|  BnaCnng15700D                                        66.2    2e-09   Brassica napus [oilseed rape]
ref|XP_010251083.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  65.1    5e-09   Nelumbo nucifera [Indian lotus]
ref|XP_007036326.1|  P-loop containing nucleoside triphosphate hy...  64.7    7e-09   
ref|XP_007036327.1|  P-loop containing nucleoside triphosphate hy...  64.7    7e-09   
ref|XP_007210287.1|  hypothetical protein PRUPE_ppa002741mg           64.3    9e-09   Prunus persica
ref|XP_004138092.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.9    1e-08   Cucumis sativus [cucumbers]
gb|KGN63542.1|  hypothetical protein Csa_1G004080                     63.9    1e-08   
ref|XP_006344459.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.5    2e-08   Solanum tuberosum [potatoes]
ref|XP_004236255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  63.5    2e-08   Solanum lycopersicum
ref|XP_002322195.2|  hypothetical protein POPTR_0015s09460g           63.2    2e-08   Populus trichocarpa [western balsam poplar]
gb|KDP31038.1|  hypothetical protein JCGZ_11414                       63.2    2e-08   Jatropha curcas
ref|XP_011046220.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    5e-08   Populus euphratica
gb|KHN34349.1|  DEAD-box ATP-dependent RNA helicase 30                62.0    5e-08   Glycine soja [wild soybean]
gb|KHN18420.1|  DEAD-box ATP-dependent RNA helicase 30                62.0    6e-08   Glycine soja [wild soybean]
ref|XP_006579582.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  62.0    6e-08   
ref|XP_003549600.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  61.6    7e-08   Glycine max [soybeans]
ref|XP_007155471.1|  hypothetical protein PHAVU_003G204200g           60.8    1e-07   Phaseolus vulgaris [French bean]
ref|XP_007155472.1|  hypothetical protein PHAVU_003G204200g           60.8    1e-07   Phaseolus vulgaris [French bean]
ref|XP_010932245.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  60.5    2e-07   Elaeis guineensis
ref|XP_006858286.1|  hypothetical protein AMTR_s00064p00050700        59.7    3e-07   Amborella trichopoda
ref|XP_004515873.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  59.3    4e-07   Cicer arietinum [garbanzo]
ref|XP_001763089.1|  predicted protein                                59.3    4e-07   
gb|ABR16327.1|  unknown                                               58.9    5e-07   Picea sitchensis
ref|XP_008239580.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.9    5e-07   Prunus mume [ume]
gb|KEH31793.1|  DEAD-box ATP-dependent RNA helicase-like protein      58.5    7e-07   Medicago truncatula
gb|KEH31792.1|  DEAD-box ATP-dependent RNA helicase-like protein      58.5    7e-07   Medicago truncatula
ref|XP_011071940.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.5    8e-07   Sesamum indicum [beniseed]
ref|XP_011071939.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  58.2    9e-07   Sesamum indicum [beniseed]
ref|XP_008807455.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    1e-06   Phoenix dactylifera
ref|XP_009412685.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  57.8    1e-06   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN39916.1|  unknown                                               57.4    2e-06   Picea sitchensis
gb|EYU22173.1|  hypothetical protein MIMGU_mgv1a003417mg              56.6    3e-06   Erythranthe guttata [common monkey flower]
ref|XP_006845267.1|  hypothetical protein AMTR_s00005p00263980        56.2    4e-06   Amborella trichopoda
ref|XP_010678860.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  55.8    5e-06   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA56211.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  53.1    4e-05   
ref|XP_002458964.1|  hypothetical protein SORBIDRAFT_03g043450        53.1    4e-05   Sorghum bicolor [broomcorn]
tpg|DAA56212.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  53.1    4e-05   
tpg|DAA56213.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...  53.1    5e-05   
ref|XP_004971011.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  52.8    6e-05   Setaria italica
ref|XP_004971010.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  52.8    6e-05   
dbj|BAJ85074.1|  predicted protein                                    52.4    8e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006646592.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  52.0    1e-04   
ref|XP_003564892.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  51.6    1e-04   Brachypodium distachyon [annual false brome]
emb|CDM85602.1|  unnamed protein product                              51.6    2e-04   Triticum aestivum [Canadian hard winter wheat]
sp|Q5N7W4.2|RH30_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...  51.2    2e-04   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD82428.1|  putative DEAD box RNA helicase                       50.8    3e-04   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD82427.1|  putative DEAD box RNA helicase                       50.8    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EMS66298.1|  DEAD-box ATP-dependent RNA helicase 30                50.1    4e-04   Triticum urartu



>gb|KJB40104.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
 gb|KJB40105.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
 gb|KJB40106.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
Length=516

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 86/188 (46%), Gaps = 39/188 (21%)
 Frame = +2

Query  146  YDSRYADSNSYRQRRSDL------IGPPHIAGGAALSNS--RGAPTPYG-----------  268
            YD RY D  SYRQRRSD       +GPP +  G  + +S  RG   PYG           
Sbjct  4    YDRRYGDPQSYRQRRSDFMGQPPPVGPPTMGPGMVMPSSYPRGGQIPYGGPPTAHPPSFH  63

Query  269  ----GPVVAPPRYSGFPSFQTggnedrggagrgFDLSRGG--------RAsgrgfdrghg  412
                GPV     +  + SF+             F++ RGG        R S     R  G
Sbjct  64   GRVHGPVRGQGDFDSYSSFRPPAGR--------FEMGRGGDIGHSHADRRSDGIRVREAG  115

Query  413  grgggrsgydggrsggtgrhgahgrgrdDLDNISLPKQDFGNLVRFEKNFYSESPSVMAM  592
              GGGR G   G  G        G  R DLDN+SLP+Q+FG LV FEKNFY ESP+V  M
Sbjct  116  RGGGGRGGGGRGGGGRGYGGRHGGSSRGDLDNVSLPRQNFGKLVPFEKNFYIESPAVREM  175

Query  593  TEHEVALY  616
            TE EV  Y
Sbjct  176  TEQEVMFY  183



>gb|KJB40103.1| hypothetical protein B456_007G047000 [Gossypium raimondii]
Length=623

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 86/188 (46%), Gaps = 39/188 (21%)
 Frame = +2

Query  146  YDSRYADSNSYRQRRSDL------IGPPHIAGGAALSNS--RGAPTPYG-----------  268
            YD RY D  SYRQRRSD       +GPP +  G  + +S  RG   PYG           
Sbjct  4    YDRRYGDPQSYRQRRSDFMGQPPPVGPPTMGPGMVMPSSYPRGGQIPYGGPPTAHPPSFH  63

Query  269  ----GPVVAPPRYSGFPSFQTggnedrggagrgFDLSRGG--------RAsgrgfdrghg  412
                GPV     +  + SF+             F++ RGG        R S     R  G
Sbjct  64   GRVHGPVRGQGDFDSYSSFRPPAGR--------FEMGRGGDIGHSHADRRSDGIRVREAG  115

Query  413  grgggrsgydggrsggtgrhgahgrgrdDLDNISLPKQDFGNLVRFEKNFYSESPSVMAM  592
              GGGR G   G  G        G  R DLDN+SLP+Q+FG LV FEKNFY ESP+V  M
Sbjct  116  RGGGGRGGGGRGGGGRGYGGRHGGSSRGDLDNVSLPRQNFGKLVPFEKNFYIESPAVREM  175

Query  593  TEHEVALY  616
            TE EV  Y
Sbjct  176  TEQEVMFY  183



>gb|KHG00890.1| DEAD-box ATP-dependent RNA helicase 30 [Gossypium arboreum]
Length=516

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 86/188 (46%), Gaps = 39/188 (21%)
 Frame = +2

Query  146  YDSRYADSNSYRQRRSDLIGPPHIAG------GAALSNS--RGAPTPYG-----------  268
            YD RY D  SYRQRRSD +G P   G      G A+ +S  RG   PYG           
Sbjct  4    YDRRYGDPQSYRQRRSDFMGQPPPVGPTTMGPGMAMPSSYPRGGQIPYGGPPTAHPPSFH  63

Query  269  ----GPVVAPPRYSGFPSFQTggnedrggagrgFDLSRGG--------RAsgrgfdrghg  412
                GPV     +  + SF+             F++ RGG        R S     R  G
Sbjct  64   GRVHGPVRGQGDFDSYSSFRPPVGR--------FEMGRGGDIGHSHADRRSDGIRGREAG  115

Query  413  grgggrsgydggrsggtgrhgahgrgrdDLDNISLPKQDFGNLVRFEKNFYSESPSVMAM  592
              GGGR G   G  G        G  R DLDN+SLP+Q+FG LV FEKNFY ESP+V  M
Sbjct  116  RGGGGRGGGGRGGGGRGYGGRHGGSSRGDLDNVSLPRQNFGKLVPFEKNFYIESPAVREM  175

Query  593  TEHEVALY  616
            TE EV  Y
Sbjct  176  TEQEVMFY  183



>ref|XP_009769444.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
sylvestris]
Length=646

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 43/62 (69%), Gaps = 6/62 (10%)
 Frame = +2

Query  131  MYNPNYDSRYADSNSYRQRRSDLIGPPHI-----AGGAALSNSRGAPTPYGGPVVAPPRY  295
            M   NYDSRY DS SYRQRRSDL+GPPHI     AGGAA S  RG P PYGGP  APP  
Sbjct  1    MSYSNYDSRYGDSGSYRQRRSDLMGPPHIYSRPMAGGAAASYGRGGPVPYGGP-QAPPMD  59

Query  296  SG  301
            +G
Sbjct  60   AG  61


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDN++LPK DFGNLV FEKNFY E  SV AMTE +VALY
Sbjct  172  DLDNLTLPKVDFGNLVPFEKNFYVEHHSVRAMTEEDVALY  211



>ref|XP_002512773.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF49276.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=540

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDNI+LPKQDFGNLV FEKNFY E+PSV AM+EHEV +Y
Sbjct  168  DLDNIALPKQDFGNLVPFEKNFYIENPSVQAMSEHEVIMY  207



>ref|XP_010102487.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
 gb|EXB93551.1| DEAD-box ATP-dependent RNA helicase 20 [Morus notabilis]
Length=625

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDN++LP+QDFGNLV FEKNFY ESPSV AMTEHEV  Y
Sbjct  148  DLDNVALPRQDFGNLVPFEKNFYVESPSVRAMTEHEVVQY  187



>ref|XP_008464518.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X2 
[Cucumis melo]
Length=536

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 88/185 (48%), Gaps = 28/185 (15%)
 Frame = +2

Query  137  NPNYDSRYADSNSYRQRRSDLIG-----PPHIAGGAALSNSRGAP--------TPYGGPV  277
            NP YD RYAD NSYR RRSDL+G     PP IAG  +L      P           GG +
Sbjct  2    NP-YDHRYADPNSYRDRRSDLVGFQPAAPPPIAGRESLYKGYQPPPAPYYGRERGGGGAL  60

Query  278  VAPPRYSGFPSFQ------------TggnedrggagrgFDLSRGGRAsgrgfdrghggrg  421
                  +G P FQ             GG    GG  R FD  RGGR +G     G G  G
Sbjct  61   ANAGGVNGLPRFQPPAGPFNIGRGGGGGFSSSGGGRRMFDSERGGRRTGGNIGFGGGRGG  120

Query  422  ggrsgydggrsggtgrhgahgrgrdDLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEH  601
            G      GG  GG        RG  D  NI LP Q+FGNLV FEKNFY+E PSV  MTE 
Sbjct  121  GTGFDGRGGGRGGGRGGAGSSRGDLD--NIVLPSQNFGNLVPFEKNFYTECPSVRVMTES  178

Query  602  EVALY  616
            EV +Y
Sbjct  179  EVKIY  183



>ref|XP_008365657.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Malus 
domestica]
Length=643

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDNI LPKQDFGNLV FEKNFY+ESPSV AM+EH+V +Y
Sbjct  165  DLDNIMLPKQDFGNLVPFEKNFYAESPSVRAMSEHDVMVY  204



>ref|XP_008464517.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Cucumis melo]
Length=622

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 88/185 (48%), Gaps = 28/185 (15%)
 Frame = +2

Query  137  NPNYDSRYADSNSYRQRRSDLIG-----PPHIAGGAALSNSRGAP--------TPYGGPV  277
            NP YD RYAD NSYR RRSDL+G     PP IAG  +L      P           GG +
Sbjct  2    NP-YDHRYADPNSYRDRRSDLVGFQPAAPPPIAGRESLYKGYQPPPAPYYGRERGGGGAL  60

Query  278  VAPPRYSGFPSFQ------------TggnedrggagrgFDLSRGGRAsgrgfdrghggrg  421
                  +G P FQ             GG    GG  R FD  RGGR +G     G G  G
Sbjct  61   ANAGGVNGLPRFQPPAGPFNIGRGGGGGFSSSGGGRRMFDSERGGRRTGGNIGFGGGRGG  120

Query  422  ggrsgydggrsggtgrhgahgrgrdDLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEH  601
            G      GG  GG        RG  D  NI LP Q+FGNLV FEKNFY+E PSV  MTE 
Sbjct  121  GTGFDGRGGGRGGGRGGAGSSRGDLD--NIVLPSQNFGNLVPFEKNFYTECPSVRVMTES  178

Query  602  EVALY  616
            EV +Y
Sbjct  179  EVKIY  183



>ref|XP_009594348.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Nicotiana 
tomentosiformis]
Length=646

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 40/54 (74%), Gaps = 6/54 (11%)
 Frame = +2

Query  143  NYDSRYADSNSYRQRRSDLIGPPHI-----AGGAALSNSRGAPTPYGGPVVAPP  289
            NYDSRY DS+SYRQRRSDL+GPPHI      GGAA S  RG P PYGGP  APP
Sbjct  5    NYDSRYGDSSSYRQRRSDLVGPPHIYSRPMPGGAAASYGRGGPLPYGGP-QAPP  57


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDN++LPK DFGNLV FEKNFY E  SV AM E +VALY
Sbjct  172  DLDNLTLPKVDFGNLVPFEKNFYVEHHSVRAMAEEDVALY  211



>emb|CDP12744.1| unnamed protein product [Coffea canephora]
Length=624

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDN++LPKQ+FGNLV FEKNFY ESPSV AMTE EVA+Y
Sbjct  151  DLDNLALPKQEFGNLVPFEKNFYVESPSVRAMTEQEVAVY  190



>gb|AHZ57095.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
Length=487

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LDN+SLPKQ+FGNLV FEKNFY ESP V AMTE +VA+Y
Sbjct  110  ELDNVSLPKQNFGNLVHFEKNFYVESPDVQAMTEQDVAMY  149



>gb|AFW97645.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
 gb|AHZ57094.1| cold responsive DEAD-box RNA helicase [Chorispora bungeana]
Length=595

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LDN+SLPKQ+FGNLV FEKNFY ESP V AMTE +VA+Y
Sbjct  110  ELDNVSLPKQNFGNLVHFEKNFYVESPDVQAMTEQDVAMY  149



>ref|XP_009345779.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Pyrus 
x bretschneideri]
Length=612

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDNI LPKQDFG LV FEKNFY+ESPSV AM+EH+V +Y
Sbjct  134  DLDNIVLPKQDFGTLVPFEKNFYAESPSVRAMSEHDVMVY  173



>ref|XP_009363040.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Pyrus 
x bretschneideri]
Length=611

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDNI LPKQDFG LV FEKNFY+ESPSV AM+EH+V +Y
Sbjct  133  DLDNIMLPKQDFGTLVPFEKNFYAESPSVRAMSEHDVMVY  172



>ref|XP_010484039.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Camelina sativa]
Length=490

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+Y
Sbjct  110  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMY  149



>ref|XP_010444192.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Camelina sativa]
Length=488

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+Y
Sbjct  108  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMY  147



>ref|XP_010459859.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X2 
[Camelina sativa]
Length=494

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+Y
Sbjct  114  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMY  153



>ref|XP_006280217.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
 gb|EOA13115.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
Length=486

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+Y
Sbjct  109  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMY  148



>ref|XP_002866536.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42795.1| hypothetical protein ARALYDRAFT_496494 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+Y
Sbjct  105  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMY  144



>ref|XP_006439906.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 ref|XP_006439907.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 ref|XP_006439908.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53146.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53147.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53148.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=493

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LDN+SLPKQDFGNLV FEKNFY ESPS+ AMTE EV +Y
Sbjct  122  LDNLSLPKQDFGNLVPFEKNFYVESPSIRAMTETEVKMY  160



>ref|XP_010484038.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=594

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+Y
Sbjct  110  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMY  149



>ref|XP_010444189.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Camelina sativa]
Length=591

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+Y
Sbjct  108  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMY  147



>ref|XP_006280218.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
 gb|EOA13116.1| hypothetical protein CARUB_v10026128mg [Capsella rubella]
Length=594

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+Y
Sbjct  109  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMY  148



>ref|XP_006476871.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Citrus sinensis]
Length=493

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LDN+SLPKQDFGNLV FEKNFY ESPS+ AMTE EV +Y
Sbjct  122  LDNLSLPKQDFGNLVPFEKNFYVESPSIRAMTETEVKMY  160



>ref|XP_010459851.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Camelina sativa]
Length=598

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESPSV AMTE +VA+Y
Sbjct  114  ELDSVSLPKQNFGNLVHFEKNFYVESPSVQAMTEQDVAMY  153



>ref|XP_006439909.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
 gb|ESR53149.1| hypothetical protein CICLE_v10019394mg [Citrus clementina]
Length=599

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LDN+SLPKQDFGNLV FEKNFY ESPS+ AMTE EV +Y
Sbjct  122  LDNLSLPKQDFGNLVPFEKNFYVESPSIRAMTETEVKMY  160



>ref|XP_011047813.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Populus euphratica]
Length=625

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LDNI+LPKQDFGNLV FEKNFY E+PS+ A++EHEV +Y
Sbjct  147  ELDNIALPKQDFGNLVPFEKNFYIENPSIRALSEHEVVMY  186



>ref|XP_006476870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Citrus sinensis]
Length=599

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/39 (79%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LDN+SLPKQDFGNLV FEKNFY ESPS+ AMTE EV +Y
Sbjct  122  LDNLSLPKQDFGNLVPFEKNFYVESPSIRAMTETEVKMY  160



>ref|NP_568964.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
 gb|AAL31214.1| AT5g63120/MDC12_8 [Arabidopsis thaliana]
 gb|AAN18177.1| At5g63120/MDC12_8 [Arabidopsis thaliana]
 gb|AED97707.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
Length=484

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESP+V AMTE +VA+Y
Sbjct  108  ELDSVSLPKQNFGNLVHFEKNFYVESPTVQAMTEQDVAMY  147



>ref|XP_002318665.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
 gb|EEE96885.2| ethylene-responsive DEAD box RNA helicase family protein [Populus 
trichocarpa]
Length=543

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LDNI+LPKQDFGNLV FEKNFY E+PS+ A++EHEV +Y
Sbjct  65   ELDNIALPKQDFGNLVPFEKNFYFENPSIRALSEHEVVMY  104



>dbj|BAB10554.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
Length=564

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESP+V AMTE +VA+Y
Sbjct  81   ELDSVSLPKQNFGNLVHFEKNFYVESPTVQAMTEQDVAMY  120



>ref|NP_974985.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
 sp|Q8W4R3.2|RH30_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis 
thaliana]
 dbj|BAE98724.1| ATP-dependent RNA helicase-like protein [Arabidopsis thaliana]
 gb|AED97706.1| DEAD-box ATP-dependent RNA helicase 30 [Arabidopsis thaliana]
Length=591

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESP+V AMTE +VA+Y
Sbjct  108  ELDSVSLPKQNFGNLVHFEKNFYVESPTVQAMTEQDVAMY  147



>gb|KFK25761.1| hypothetical protein AALP_AA8G156100 [Arabis alpina]
Length=582

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            D D++SLPKQ+FGNLV FEKNFY ESP+V AMTE +VA+Y
Sbjct  102  DFDSVSLPKQNFGNLVHFEKNFYVESPAVQAMTEQDVAMY  141



>ref|XP_006394312.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
 gb|ESQ31598.1| hypothetical protein EUTSA_v10003871mg [Eutrema salsugineum]
Length=596

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ+FGNLV FEKNFY ESP+V AMTE +VA+Y
Sbjct  114  ELDSVSLPKQNFGNLVHFEKNFYVESPAVQAMTEQDVAMY  153



>ref|XP_010663104.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Vitis vinifera]
Length=718

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDNI+LPKQDFG+LV FEKNFY ESPSV AM+E E  LY
Sbjct  239  DLDNIALPKQDFGSLVPFEKNFYIESPSVQAMSEQEAMLY  278



>emb|CBI14965.3| unnamed protein product [Vitis vinifera]
Length=611

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDNI+LPKQDFG+LV FEKNFY ESPSV AM+E E  LY
Sbjct  239  DLDNIALPKQDFGSLVPFEKNFYIESPSVQAMSEQEAMLY  278



>emb|CAN78903.1| hypothetical protein VITISV_026451 [Vitis vinifera]
Length=692

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDNI+LPKQDFG+LV FEKNFY ESPSV AM+E E  LY
Sbjct  239  DLDNIALPKQDFGSLVPFEKNFYIESPSVQAMSEQEAMLY  278



>ref|XP_010550696.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Tarenaya hassleriana]
Length=576

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LDN+SLP+Q+FGNLV FEKNFY E PSV AMTE +VA+Y
Sbjct  102  ELDNVSLPRQNFGNLVPFEKNFYVECPSVQAMTEQDVAMY  141



>ref|XP_004299135.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Fragaria vesca 
subsp. vesca]
Length=606

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLD I LPKQDFG+LV FEKNFY ESPSV AM+EHEV  Y
Sbjct  133  DLDGIVLPKQDFGDLVPFEKNFYVESPSVKAMSEHEVVAY  172



>ref|XP_009112064.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X2 
[Brassica rapa]
Length=488

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ FGNLV FEKNFY ESP V AMTE +VALY
Sbjct  109  ELDSVSLPKQSFGNLVHFEKNFYVESPVVQAMTEEDVALY  148



>ref|XP_009112063.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 isoform X1 
[Brassica rapa]
Length=591

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ FGNLV FEKNFY ESP V AMTE +VALY
Sbjct  109  ELDSVSLPKQSFGNLVHFEKNFYVESPVVQAMTEEDVALY  148



>emb|CDY16735.1| BnaA09g06470D [Brassica napus]
Length=591

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ FGNLV FEKNFY ESP V AMTE +VALY
Sbjct  110  ELDSVSLPKQSFGNLVHFEKNFYVESPVVQAMTEEDVALY  149



>emb|CDY48128.1| BnaCnng15700D [Brassica napus]
Length=594

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD++SLPKQ FGNLV FEKNFY ESP V AMTE +VA+Y
Sbjct  112  ELDSVSLPKQSFGNLVHFEKNFYVESPVVQAMTEQDVAMY  151



>ref|XP_010251083.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Nelumbo 
nucifera]
Length=719

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD+I+LPKQDFGNLV FEKNFY ES SV AMTE E A+Y
Sbjct  239  ELDSIALPKQDFGNLVPFEKNFYIESSSVEAMTEQETAIY  278



>ref|XP_007036326.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY20827.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=626

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDN+SLP+Q+FGNLV FEKNFY ESP+V  MTE E  +Y
Sbjct  148  DLDNVSLPRQNFGNLVPFEKNFYVESPAVRGMTEQEAMVY  187



>ref|XP_007036327.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY20828.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=523

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDN+SLP+Q+FGNLV FEKNFY ESP+V  MTE E  +Y
Sbjct  148  DLDNVSLPRQNFGNLVPFEKNFYVESPAVRGMTEQEAMVY  187



>ref|XP_007210287.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
 gb|EMJ11486.1| hypothetical protein PRUPE_ppa002741mg [Prunus persica]
Length=638

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDNI LPKQDFG+LV FEKNFY ES SV AM+E EV +Y
Sbjct  162  DLDNIVLPKQDFGSLVPFEKNFYVESSSVRAMSEQEVMVY  201



>ref|XP_004138092.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
 ref|XP_004168110.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Cucumis 
sativus]
Length=622

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LDNI LP Q+FGNLV FEKNFY+E PSV AMTE EV +Y
Sbjct  145  LDNIVLPSQNFGNLVPFEKNFYTECPSVRAMTESEVKIY  183



>gb|KGN63542.1| hypothetical protein Csa_1G004080 [Cucumis sativus]
Length=550

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LDNI LP Q+FGNLV FEKNFY+E PSV AMTE EV +Y
Sbjct  145  LDNIVLPSQNFGNLVPFEKNFYTECPSVRAMTESEVKIY  183



>ref|XP_006344459.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Solanum tuberosum]
Length=648

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDN++LPKQDFGNLV FEKNFY E+ +V AMT+ EVA Y
Sbjct  171  DLDNLTLPKQDFGNLVPFEKNFYVENHAVRAMTDQEVAHY  210


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 8/49 (16%)
 Frame = +2

Query  131  MYNPNYDSRYADSNSYRQRRSDLIGP-------PHIAGGAALSNSRGAP  256
            M  PNYDSRY DS SYRQRRSDL+GP       P   GGAA S  RG P
Sbjct  1    MSYPNYDSRYGDSGSYRQRRSDLMGPQPSMYPRPMSDGGAA-SYGRGGP  48



>ref|XP_004236255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Solanum lycopersicum]
Length=651

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDN++LPKQDFGNLV FEKNFY E+ +V AMT+ EVA Y
Sbjct  173  DLDNLTLPKQDFGNLVPFEKNFYVENHAVRAMTDQEVAHY  212


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 30/48 (63%), Gaps = 6/48 (13%)
 Frame = +2

Query  131  MYNPNYDSRYADSNSYRQRRSDLIGPP------HIAGGAALSNSRGAP  256
            M  PNYDSRY DS SYRQRRSDL+GP        + GG A S  RG P
Sbjct  1    MSYPNYDSRYGDSGSYRQRRSDLMGPQPSMYPRPMPGGGAASYGRGGP  48



>ref|XP_002322195.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
 gb|EEF06322.2| hypothetical protein POPTR_0015s09460g [Populus trichocarpa]
Length=609

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LDNI+LPKQDFG+LV FEKN Y E+PS+ AM+EHEV  +
Sbjct  135  ELDNIALPKQDFGDLVPFEKNLYFENPSIRAMSEHEVVTF  174



>gb|KDP31038.1| hypothetical protein JCGZ_11414 [Jatropha curcas]
Length=627

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLD+I+LPKQDFGNLV F+KNFY ESPSV +M+E++  +Y
Sbjct  150  DLDDIALPKQDFGNLVPFKKNFYIESPSVQSMSENDAMMY  189



>ref|XP_011046220.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Populus 
euphratica]
Length=612

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LDNI+LPKQDFG+LV FEKN Y E+PS+ +M+EHEV  +
Sbjct  138  ELDNIALPKQDFGDLVPFEKNLYFENPSIRSMSEHEVVTF  177



>gb|KHN34349.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DL+NI+LPKQDF NLV FEKNFY E P+V AM+E EV  Y
Sbjct  36   DLNNIALPKQDFKNLVPFEKNFYVECPAVRAMSEQEVLHY  75



>gb|KHN18420.1| DEAD-box ATP-dependent RNA helicase 30 [Glycine soja]
Length=517

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DL+NI+LPKQDF NLV FEKNFY E P+V AM+E EV  Y
Sbjct  36   DLNNIALPKQDFKNLVPFEKNFYVECPAVRAMSEQEVLHY  75



>ref|XP_006579582.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=605

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DL+NI+LPKQDF NLV FEKNFY E P+V AM+E EV  Y
Sbjct  124  DLNNIALPKQDFKNLVPFEKNFYVECPAVRAMSEQEVLHY  163



>ref|XP_003549600.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Glycine max]
Length=602

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DL+NI+LPKQDF NLV FEKNFY E P+V AM+E EV  Y
Sbjct  121  DLNNIALPKQDFKNLVPFEKNFYVECPAVRAMSEQEVLHY  160



>ref|XP_007155471.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 ref|XP_007155473.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27465.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27467.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
Length=501

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DL+NI+LPKQ F NLV FEKNFY E P+V AMTE EV  Y
Sbjct  122  DLNNITLPKQSFRNLVPFEKNFYVECPAVRAMTEQEVTHY  161



>ref|XP_007155472.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
 gb|ESW27466.1| hypothetical protein PHAVU_003G204200g [Phaseolus vulgaris]
Length=603

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DL+NI+LPKQ F NLV FEKNFY E P+V AMTE EV  Y
Sbjct  122  DLNNITLPKQSFRNLVPFEKNFYVECPAVRAMTEQEVTHY  161



>ref|XP_010932245.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Elaeis 
guineensis]
Length=701

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLD +SLPKQDF +L+ FEKNFY ESP+V AM+E +  LY
Sbjct  227  DLDKLSLPKQDFHDLIPFEKNFYVESPAVQAMSEQDAMLY  266



>ref|XP_006858286.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
 gb|ERN19753.1| hypothetical protein AMTR_s00064p00050700 [Amborella trichopoda]
Length=501

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            D DNISLPKQDF  L  FEKNFY ES +V +MTE EV  Y
Sbjct  38   DFDNISLPKQDFDGLTHFEKNFYVESEAVASMTEEEVEAY  77



>ref|XP_004515873.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Cicer arietinum]
Length=622

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DL+NI+LPKQDF NLV F+KNFY ES S+ AM++H+V  Y
Sbjct  140  DLNNINLPKQDFRNLVPFQKNFYVESSSIAAMSDHQVMHY  179



>ref|XP_001763089.1| predicted protein [Physcomitrella patens]
 gb|EDQ71966.1| predicted protein [Physcomitrella patens]
Length=514

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLD+I+LP Q+F NL+ FEKNFY E P+V A+TE EVA Y
Sbjct  37   DLDDIALPAQEFENLIPFEKNFYVEHPAVSALTEEEVAAY  76



>gb|ABR16327.1| unknown [Picea sitchensis]
Length=504

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            D D+ISLPKQDF NL+ FEKNFY E+P + +MTE EV  Y
Sbjct  42   DFDSISLPKQDFENLIPFEKNFYVETPGIASMTEDEVREY  81



>ref|XP_008239580.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Prunus mume]
Length=609

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LDNI LPKQDF +LV FEKNFY ES SV AM+E EV +Y
Sbjct  134  LDNIVLPKQDFRSLVPFEKNFYVESSSVRAMSEQEVMVY  172



>gb|KEH31793.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=625

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DL+NI+LPKQDF NLV F+KNFY ESP + AM++ +V  Y
Sbjct  144  DLNNITLPKQDFRNLVPFQKNFYVESPMIQAMSDQQVMQY  183



>gb|KEH31792.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=523

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DL+NI+LPKQDF NLV F+KNFY ESP + AM++ +V  Y
Sbjct  144  DLNNITLPKQDFRNLVPFQKNFYVESPMIQAMSDQQVMQY  183



>ref|XP_011071940.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X2 
[Sesamum indicum]
Length=600

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLD ISLPK DF  L+ F+K+FY ESPSV AMTE EV +Y
Sbjct  122  DLDAISLPKPDFRGLIAFKKDFYVESPSVRAMTEQEVMIY  161



>ref|XP_011071939.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 isoform X1 
[Sesamum indicum]
Length=626

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLD ISLPK DF  L+ F+K+FY ESPSV AMTE EV +Y
Sbjct  148  DLDAISLPKPDFRGLIAFKKDFYVESPSVRAMTEQEVMIY  187



>ref|XP_008807455.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Phoenix 
dactylifera]
Length=683

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLD +SLPKQDF +L  FEKNFY ESP+V AM+E +  LY
Sbjct  209  DLDKLSLPKQDFRDLNPFEKNFYVESPAVQAMSEQDAMLY  248



>ref|XP_009412685.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20-like [Musa 
acuminata subsp. malaccensis]
Length=695

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLD I+LPKQ+F +L+ FEKNFY ES SV AM+E +V LY
Sbjct  223  DLDKIALPKQNFHDLIPFEKNFYIESLSVQAMSEQDVMLY  262



>gb|ACN39916.1| unknown [Picea sitchensis]
Length=593

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD+++LPK+DF NL+ FEKNFY E P+V A+++HEV+ Y
Sbjct  114  LDSVALPKEDFDNLIPFEKNFYVEHPAVAALSDHEVSAY  152



>gb|EYU22173.1| hypothetical protein MIMGU_mgv1a003417mg [Erythranthe guttata]
Length=586

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLDNI+L K DF  L+ F+K+FY ESPSV AMTE EV +Y
Sbjct  111  DLDNITLTKPDFRGLIPFKKDFYVESPSVRAMTEQEVLMY  150



>ref|XP_006845267.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
 gb|ERN06942.1| hypothetical protein AMTR_s00005p00263980 [Amborella trichopoda]
Length=670

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            +LD+I LP +DFG L+ FEKNFY E+P+V  M+E +V LY
Sbjct  194  ELDSIELPPEDFGELIPFEKNFYVENPAVQVMSEQDVVLY  233



>ref|XP_010678860.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 20 [Beta vulgaris 
subsp. vulgaris]
Length=643

 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  497  DLDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            DLD+++LPKQ+F NLV FEK+FY ES SV AM++ EV +Y
Sbjct  169  DLDSMALPKQEFRNLVPFEKDFYLESSSVRAMSDQEVMMY  208



>tpg|DAA56211.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=397

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD+++LPK DF +L+ FEKNFY E PSV AM+E +VA Y
Sbjct  97   LDSLALPKPDFRSLIPFEKNFYVECPSVQAMSEADVAQY  135



>ref|XP_002458964.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
 gb|EES04084.1| hypothetical protein SORBIDRAFT_03g043450 [Sorghum bicolor]
Length=578

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD+++LPK DF +L+ FEKNFY E PSV AM+E +VA Y
Sbjct  103  LDSLALPKPDFRSLIPFEKNFYVECPSVQAMSEADVAQY  141



>tpg|DAA56212.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=473

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD+++LPK DF +L+ FEKNFY E PSV AM+E +VA Y
Sbjct  97   LDSLALPKPDFRSLIPFEKNFYVECPSVQAMSEADVAQY  135



>tpg|DAA56213.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=571

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD+++LPK DF +L+ FEKNFY E PSV AM+E +VA Y
Sbjct  97   LDSLALPKPDFRSLIPFEKNFYVECPSVQAMSEADVAQY  135



>ref|XP_004971011.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X2 [Setaria italica]
Length=569

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD ++LPK DF +L+ FEKNFY ESPSV AM++ +VA Y
Sbjct  95   LDTLALPKPDFRSLIPFEKNFYVESPSVQAMSDADVAQY  133



>ref|XP_004971010.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like isoform 
X1 [Setaria italica]
Length=596

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD ++LPK DF +L+ FEKNFY ESPSV AM++ +VA Y
Sbjct  95   LDTLALPKPDFRSLIPFEKNFYVESPSVQAMSDADVAQY  133



>dbj|BAJ85074.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD++SLPK DF  L+ FEK+FY E P+V AM+E EVA Y
Sbjct  98   LDSLSLPKPDFRGLIPFEKSFYVECPAVQAMSETEVAQY  136



>ref|XP_006646592.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30-like [Oryza 
brachyantha]
Length=547

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD +SLPK DF +L+ FEKNFY E P+V AM++ +VA Y
Sbjct  76   LDTLSLPKPDFRSLIPFEKNFYVECPAVQAMSDTDVAQY  114



>ref|XP_003564892.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 30 [Brachypodium 
distachyon]
Length=571

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD++SLPK DF +L+ FEK+FY E P+V AM++ EVA Y
Sbjct  101  LDSLSLPKPDFRDLIPFEKSFYVECPAVQAMSDMEVAQY  139



>emb|CDM85602.1| unnamed protein product [Triticum aestivum]
Length=574

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD++SLPK DF  L+ FEK+FY E P+V AM++ EVA Y
Sbjct  98   LDSLSLPKADFRGLIPFEKSFYVECPAVQAMSDTEVAQY  136



>sp|Q5N7W4.2|RH30_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 30 [Oryza sativa 
Japonica Group]
Length=666

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD++SLPK DF +L+ FEKNFY E P+V AM++ +V+ Y
Sbjct  195  LDSLSLPKPDFRSLIPFEKNFYVECPAVQAMSDMDVSQY  233



>dbj|BAD82428.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 dbj|BAD82340.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
Length=477

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD++SLPK DF +L+ FEKNFY E P+V AM++ +V+ Y
Sbjct  100  LDSLSLPKPDFRSLIPFEKNFYVECPAVQAMSDMDVSQY  138



>dbj|BAD82427.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 dbj|BAD82339.1| putative DEAD box RNA helicase [Oryza sativa Japonica Group]
 gb|EEE55863.1| hypothetical protein OsJ_04500 [Oryza sativa Japonica Group]
Length=571

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD++SLPK DF +L+ FEKNFY E P+V AM++ +V+ Y
Sbjct  100  LDSLSLPKPDFRSLIPFEKNFYVECPAVQAMSDMDVSQY  138



>gb|EMS66298.1| DEAD-box ATP-dependent RNA helicase 30 [Triticum urartu]
Length=587

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  500  LDNISLPKQDFGNLVRFEKNFYSESPSVMAMTEHEVALY  616
            LD+++LPK DF  L+ FEK+FY E P+V AM++ EVA Y
Sbjct  98   LDSLNLPKADFRGLIPFEKSFYVECPAVQAMSDTEVAQY  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520