BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045H23

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588089.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...    115   2e-26   Nicotiana tomentosiformis
ref|XP_006362449.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    111   6e-25   Solanum tuberosum [potatoes]
emb|CDX92008.1|  BnaC03g33100D                                          108   1e-24   
ref|XP_010485586.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    109   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010463686.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    108   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002884331.1|  tRNA synthetase class I family protein             108   6e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_006297370.1|  hypothetical protein CARUB_v10013389mg             108   6e-24   
ref|XP_010500039.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010500171.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_004242803.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    107   2e-23   Solanum lycopersicum
ref|XP_009118453.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    104   2e-22   Brassica rapa
ref|XP_004303944.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    103   4e-22   Fragaria vesca subsp. vesca
ref|XP_009134705.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    103   5e-22   Brassica rapa
emb|CDX74240.1|  BnaA03g28070D                                          103   5e-22   
ref|XP_009134703.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    103   6e-22   Brassica rapa
ref|XP_010276894.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    103   7e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010549888.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    102   8e-22   Tarenaya hassleriana [spider flower]
ref|NP_186915.1|  tyrosyl-tRNA synthetase                               102   9e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009760674.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    102   1e-21   Nicotiana sylvestris
ref|XP_009355255.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    101   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_009355254.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    101   1e-21   Pyrus x bretschneideri [bai li]
ref|XP_008218548.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    101   2e-21   Prunus mume [ume]
ref|XP_009591201.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    102   2e-21   Nicotiana tomentosiformis
ref|XP_007222608.1|  hypothetical protein PRUPE_ppa004925mg             101   2e-21   Prunus persica
ref|XP_008347911.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    101   2e-21   
ref|XP_004299915.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    101   2e-21   Fragaria vesca subsp. vesca
ref|XP_006408394.1|  hypothetical protein EUTSA_v10020578mg           99.0    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_009348746.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  99.0    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_009348745.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  99.0    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_008339494.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  99.0    2e-20   
ref|XP_008361702.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  98.6    2e-20   
ref|XP_008339493.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  98.6    2e-20   
ref|XP_009414004.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  97.1    8e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010683748.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial  95.9    2e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008801775.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  94.0    1e-18   Phoenix dactylifera
gb|KJB12925.1|  hypothetical protein B456_002G045400                  93.6    1e-18   Gossypium raimondii
ref|XP_008783116.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  92.4    4e-18   Phoenix dactylifera
ref|XP_007022035.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...  91.3    7e-18   
ref|XP_007022036.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...  91.3    7e-18   
ref|XP_010927782.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  91.3    9e-18   Elaeis guineensis
ref|XP_007022034.1|  Tyrosyl-tRNA synthetase isoform 1                91.3    1e-17   
emb|CDP19091.1|  unnamed protein product                              91.3    1e-17   Coffea canephora [robusta coffee]
gb|KDO63480.1|  hypothetical protein CISIN_1g037749mg                 89.7    2e-17   Citrus sinensis [apfelsine]
ref|XP_006468947.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  89.7    2e-17   Citrus sinensis [apfelsine]
ref|XP_002512791.1|  tyrosyl-tRNA synthetase, putative                89.7    3e-17   
ref|XP_006446866.1|  hypothetical protein CICLE_v10015023mg           86.7    3e-16   Citrus clementina [clementine]
gb|KCW55733.1|  hypothetical protein EUGRSUZ_I01565                   85.1    1e-15   Eucalyptus grandis [rose gum]
gb|KEH34424.1|  tyrosyl-tRNA synthetase                               84.7    1e-15   Medicago truncatula
ref|XP_010028900.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  84.7    1e-15   Eucalyptus grandis [rose gum]
ref|XP_003544330.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  84.3    2e-15   Glycine max [soybeans]
ref|XP_004500343.1|  PREDICTED: tyrosine--tRNA ligase-like            84.3    2e-15   Cicer arietinum [garbanzo]
ref|XP_003519285.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  83.6    4e-15   Glycine max [soybeans]
gb|EYU42284.1|  hypothetical protein MIMGU_mgv1a005712mg              83.2    4e-15   Erythranthe guttata [common monkey flower]
gb|KDP41896.1|  hypothetical protein JCGZ_26914                       83.2    5e-15   Jatropha curcas
gb|KHN08832.1|  Tyrosine--tRNA ligase                                 82.8    6e-15   Glycine soja [wild soybean]
ref|XP_007142062.1|  hypothetical protein PHAVU_008G249300g           82.8    7e-15   Phaseolus vulgaris [French bean]
ref|XP_002980036.1|  hypothetical protein SELMODRAFT_111886           82.0    1e-14   Selaginella moellendorffii
ref|XP_002992920.1|  hypothetical protein SELMODRAFT_136175           82.0    1e-14   
ref|XP_001751567.1|  predicted protein                                81.3    2e-14   
ref|XP_011071261.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  81.3    2e-14   
gb|EYU24457.1|  hypothetical protein MIMGU_mgv1a005745mg              80.5    4e-14   Erythranthe guttata [common monkey flower]
ref|XP_004146892.1|  PREDICTED: tyrosine--tRNA ligase-like            80.5    4e-14   Cucumis sativus [cucumbers]
ref|XP_004166614.1|  PREDICTED: tyrosine--tRNA ligase-like            80.5    5e-14   
ref|XP_011033705.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial  80.5    5e-14   Populus euphratica
ref|XP_008453844.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  80.1    5e-14   
gb|KEH32330.1|  tyrosyl-tRNA synthetase                               80.1    6e-14   Medicago truncatula
ref|XP_006826574.1|  hypothetical protein AMTR_s00138p00020780        74.7    3e-12   Amborella trichopoda
gb|KIY99495.1|  tyrosyl-tRNA synthetase                               72.0    3e-12   Monoraphidium neglectum
emb|CAN64191.1|  hypothetical protein VITISV_016956                   74.7    5e-12   Vitis vinifera
emb|CBI22389.3|  unnamed protein product                              73.6    5e-12   Vitis vinifera
ref|XP_002265238.2|  PREDICTED: probable tyrosine--tRNA ligase, m...  73.9    7e-12   Vitis vinifera
ref|WP_006340872.1|  tyrosyl-tRNA synthetase                          73.2    1e-11   Parachlamydia acanthamoebae
ref|WP_039376683.1|  tyrosyl-tRNA synthetase                          72.8    1e-11   
gb|EMT07165.1|  Tyrosyl-tRNA synthetase                               72.4    2e-11   
gb|EPS58486.1|  hypothetical protein M569_16327                       71.2    4e-11   Genlisea aurea
ref|XP_006645923.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  71.2    5e-11   
ref|XP_005650588.1|  tyrosyl-tRNA synthetase                          70.1    1e-10   Coccomyxa subellipsoidea C-169
gb|EMS54027.1|  Tyrosyl-tRNA synthetase                               70.1    2e-10   Triticum urartu
ref|XP_010229641.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...  69.7    2e-10   
ref|XP_003574045.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  69.3    2e-10   Brachypodium distachyon [annual false brome]
ref|XP_002504529.1|  predicted protein                                68.6    4e-10   Micromonas commoda
ref|XP_005538192.1|  tyrosine--tRNA ligase, mitochondrial or chlo...  68.2    5e-10   Cyanidioschyzon merolae strain 10D
gb|KIC71389.1|  Tyrosine--tRNA ligase                                 67.0    1e-09   Candidatus Protochlamydia amoebophila
ref|WP_042279297.1|  tyrosyl-tRNA synthetase                          67.0    1e-09   Candidatus Protochlamydia sp. R18
ref|WP_039359281.1|  tyrosyl-tRNA synthetase                          67.0    1e-09   Candidatus Protochlamydia amoebophila
ref|WP_011175719.1|  tyrosyl-tRNA synthetase                          66.2    2e-09   Candidatus Protochlamydia amoebophila
ref|XP_004982893.1|  PREDICTED: probable tyrosine--tRNA ligase, m...  65.9    2e-09   Setaria italica
ref|XP_004993733.1|  tyrosyl-tRNA synthetase                          65.9    3e-09   Salpingoeca rosetta
ref|XP_007509051.1|  tyrosyl-tRNA synthetase                          65.1    5e-09   Bathycoccus prasinos
ref|XP_010110726.1|  Tyrosine--tRNA ligase                            64.7    6e-09   Morus notabilis
ref|XP_003059850.1|  predicted protein                                64.7    6e-09   Micromonas pusilla CCMP1545
ref|NP_001141566.1|  hypothetical protein                             64.7    7e-09   Zea mays [maize]
ref|WP_032125960.1|  tyrosyl-tRNA synthetase                          63.9    1e-08   Candidatus Protochlamydia massiliensis
ref|XP_002447960.1|  hypothetical protein SORBIDRAFT_06g018870        63.9    1e-08   
ref|XP_005707106.1|  tyrosyl-tRNA synthetase                          62.8    3e-08   Galdieria sulphuraria
ref|XP_002955541.1|  hypothetical protein VOLCADRAFT_83275            62.8    3e-08   Volvox carteri f. nagariensis
ref|WP_042103652.1|  tyrosyl-tRNA synthetase                          62.4    3e-08   Parachlamydiaceae bacterium HS-T3
ref|NP_001043131.1|  Os01g0500900                                     62.4    4e-08   
gb|EAZ12037.1|  hypothetical protein OsJ_01916                        62.0    6e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005848281.1|  hypothetical protein CHLNCDRAFT_48743            61.6    7e-08   Chlorella variabilis
ref|XP_005713019.1|  tyrosine--tRNA ligase, mitochondrial or chlo...  60.8    1e-07   Chondrus crispus [carageen]
ref|WP_039384881.1|  tyrosyl-tRNA synthetase                          58.2    1e-06   Neochlamydia sp. TUME1
gb|KIC73976.1|  Tyrosine--tRNA ligase                                 57.8    1e-06   Neochlamydia sp. EPS4
ref|WP_042240888.1|  tyrosyl-tRNA synthetase                          57.8    1e-06   Neochlamydia sp. S13
gb|KIO28484.1|  hypothetical protein M407DRAFT_230436                 57.8    1e-06   Tulasnella calospora MUT 4182
ref|XP_001699082.1|  hypothetical protein CHLREDRAFT_139405           57.8    1e-06   Chlamydomonas reinhardtii
emb|CDZ80947.1|  Tyrosine--tRNA ligase                                56.6    3e-06   Candidatus Rubidus massiliensis
ref|WP_013943141.1|  tyrosyl-tRNA synthetase                          56.6    3e-06   Simkania negevensis
ref|XP_003075033.1|  TyrS Tyrosyl-tRNA synthetase, probable (IC)      56.6    3e-06   Ostreococcus tauri
dbj|BAK00149.1|  predicted protein                                    56.2    5e-06   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ELL68304.1|  tyrosyl-tRNA synthetase                               52.4    5e-06   Salmonella enterica subsp. enterica serovar Enteritidis str. SE30663
ref|XP_002615773.1|  hypothetical protein CLUG_04655                  55.8    6e-06   Clavispora lusitaniae ATCC 42720
ref|WP_017492945.1|  tyrosyl-tRNA synthetase                          55.5    7e-06   Rouxiella badensis
emb|CBX71308.1|  hypothetical protein YEW_BZ08530                     52.0    7e-06   Yersinia enterocolitica W22703
ref|WP_004157449.1|  tyrosyl-tRNA synthetase                          55.5    7e-06   Erwinia amylovora
ref|WP_004169729.1|  tyrosyl-tRNA synthetase                          55.5    7e-06   Erwinia amylovora
emb|CBX80578.1|  Tyrosyl-tRNA synthetase                              55.5    7e-06   Erwinia amylovora ATCC BAA-2158
ref|WP_034913283.1|  tyrosyl-tRNA synthetase                          55.5    7e-06   Gilliamella apicola
ref|WP_021016274.1|  tyrosyl-tRNA synthetase                          55.5    7e-06   Serratia sp. ATCC 39006
gb|KDN09996.1|  Tyrosyl-tRNA synthetase                               55.5    7e-06   Gilliamella apicola
ref|WP_012441522.1|  tyrosyl-tRNA synthetase                          55.5    8e-06   Erwinia tasmaniensis
ref|XP_002548674.1|  hypothetical protein CTRG_02971                  55.5    8e-06   Candida tropicalis MYA-3404
ref|WP_034948561.1|  tyrosyl-tRNA synthetase                          55.5    8e-06   Gilliamella apicola
ref|WP_014544220.1|  tyrosyl-tRNA synthetase                          55.5    8e-06   Erwinia sp. Ejp617
ref|WP_012668183.1|  tyrosyl-tRNA synthetase                          55.5    8e-06   Erwinia pyrifoliae
gb|KFA58049.1|  Tyrosyl-tRNA synthetase                               55.5    8e-06   Gilliamella apicola
ref|WP_023655005.1|  tyrosyl-tRNA synthetase                          55.5    8e-06   Erwinia piriflorinigrans
ref|WP_042393767.1|  tyrosyl-tRNA synthetase                          55.1    9e-06   Pseudescherichia vulneris
ref|WP_013182397.1|  tyrosyl-tRNA synthetase                          55.1    1e-05   Waddlia chondrophila
ref|WP_011411268.1|  tyrosyl-tRNA synthetase                          55.1    1e-05   Sodalis glossinidius
ref|WP_023306008.1|  tyrosyl-tRNA synthetase                          55.1    1e-05   Enterobacter cloacae complex
ref|WP_032327767.1|  tyrosyl-tRNA synthetase                          51.6    1e-05   
ref|WP_044719105.1|  tyrosyl-tRNA synthetase                          52.0    1e-05   
ref|WP_011146818.1|  tyrosyl-tRNA synthetase                          55.1    1e-05   Photorhabdus
gb|EEP91904.1|  Tyrosyl-tRNA synthetase                               55.1    1e-05   Yersinia kristensenii ATCC 33638
ref|WP_042110692.1|  tyrosyl-tRNA synthetase                          52.0    1e-05   Escherichia coli [E. coli]
ref|WP_015834075.1|  tyrosyl-tRNA synthetase                          55.1    1e-05   Photorhabdus asymbiotica
ref|WP_032819694.1|  tyrosyl-tRNA synthetase                          55.1    1e-05   Yersinia kristensenii
ref|XP_011429226.1|  PREDICTED: tyrosine--tRNA ligase, mitochondr...  54.7    1e-05   Crassostrea gigas
ref|WP_040149889.1|  tyrosyl-tRNA synthetase                          54.7    1e-05   Photorhabdus luminescens
ref|WP_036805443.1|  tyrosyl-tRNA synthetase                          54.7    1e-05   Photorhabdus luminescens
ref|WP_021325605.1|  tyrosyl-tRNA synthetase                          54.7    1e-05   Photorhabdus temperata
ref|WP_034914572.1|  tyrosyl-tRNA synthetase                          54.7    1e-05   Erwinia sp. 9145
ref|WP_023045582.1|  tyrosyl-tRNA synthetase                          54.7    1e-05   Photorhabdus temperata
ref|WP_017802198.1|  tyrosyl-tRNA synthetase                          54.7    1e-05   
ref|WP_044725469.1|  tyrosyl-tRNA synthetase                          52.0    2e-05   
ref|WP_025245619.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Candidatus Sodalis pierantonius
ref|WP_036849510.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Photorhabdus
ref|WP_009635941.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Serratia sp. M24T3
ref|WP_034370072.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Dermabacter hominis
ref|WP_014605927.1|  MULTISPECIES: tyrosyl-tRNA synthetase            54.3    2e-05   Pantoea
ref|WP_033782985.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Pantoea
ref|WP_016662951.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Dermabacter sp. HFH0086
ref|WP_028722225.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Pantoea ananatis
ref|WP_013357760.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Pantoea vagans
ref|WP_033741218.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   
ref|WP_033732557.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Pantoea
ref|WP_031377358.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Pantoea
ref|WP_039340530.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Pantoea stewartii
gb|KGL54482.1|  tyrosyl-tRNA synthetase                               54.3    2e-05   Pantoea ananatis
ref|WP_033786227.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Pantoea agglomerans
ref|WP_006119012.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Pantoea stewartii
ref|WP_044818191.1|  tyrosyl-tRNA synthetase                          52.0    2e-05   
ref|WP_032098097.1|  MULTISPECIES: tyrosyl-tRNA synthetase            54.3    2e-05   Morganella
ref|WP_004235488.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Morganella
ref|WP_000168619.1|  tyrosyl-tRNA synthetase                          53.1    2e-05   Salmonella enterica
ref|WP_010245429.1|  MULTISPECIES: tyrosyl-tRNA synthetase            54.3    2e-05   Pantoea
gb|ADD76942.1|  TyrS                                                  54.3    2e-05   Pantoea ananatis LMG 20103
ref|WP_025422217.1|  tyrosyl-tRNA synthetase                          54.3    2e-05   Sodalis praecaptivus
gb|KDA95769.1|  tyrosyl-tRNA synthetase                               54.3    2e-05   Pantoea agglomerans Eh318
gb|ADI18056.1|  tyrosyl-tRNA synthetase                               53.9    2e-05   uncultured actinobacterium HF0200_20K23
ref|WP_034883707.1|  tyrosyl-tRNA synthetase                          53.9    2e-05   
ref|WP_000168630.1|  tyrosyl-tRNA synthetase                          52.4    2e-05   Escherichia coli [E. coli]
gb|KES17804.1|  Tyrosyl-tRNA synthetase                               53.9    2e-05   Gilliamella apicola SCGC AB-598-I20
ref|WP_041027995.1|  tyrosyl-tRNA synthetase                          52.8    2e-05   
ref|WP_027273256.1|  tyrosyl-tRNA synthetase                          53.9    2e-05   Leminorella grimontii
emb|CDS06680.1|  hypothetical protein LRAMOSA09207                    53.9    2e-05   Lichtheimia ramosa
gb|EFP56700.1|  tyrosine--tRNA ligase                                 53.9    2e-05   Dermacoccus sp. Ellin185
ref|WP_044652136.1|  tyrosyl-tRNA synthetase                          52.4    3e-05   
gb|AHS60148.1|  hypothetical protein AU67_10290                       52.8    3e-05   
ref|WP_008813567.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.9    3e-05   Hafnia
ref|WP_025801054.1|  tyrosyl-tRNA synthetase                          53.9    3e-05   Hafnia
gb|EHM39809.1|  tyrosine--tRNA ligase                                 53.9    3e-05   Hafnia alvei ATCC 51873
ref|WP_014354199.1|  tyrosyl-tRNA synthetase                          53.9    3e-05   Wigglesworthia glossinidia
ref|WP_013201954.1|  tyrosyl-tRNA synthetase                          53.9    3e-05   Erwinia billingiae
ref|WP_034862023.1|  tyrosyl-tRNA synthetase                          53.9    3e-05   Enterobacteriaceae bacterium B14
gb|KEP73662.1|  tyrosyl-tRNA synthetase                               52.4    3e-05   Microbacterium sp. SUBG005
ref|WP_027725608.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Tuberibacillus calidus
ref|WP_026059022.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Enterobacteriaceae bacterium LSJC7
emb|CCG82830.1|  Tyrosyl-tRNA synthetase,mitochondrial                53.5    3e-05   Taphrina deformans PYCC 5710
gb|AJA45898.1|  tyrosyl-tRNA synthetase                               53.5    3e-05   Frischella perrara
ref|WP_023212222.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Salmonella enterica
ref|WP_039105903.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Frischella perrara
ref|WP_020844165.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Salmonella bongori
ref|WP_038027353.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Tatumella saanichensis
ref|WP_038626278.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Erwiniaceae
ref|WP_034895231.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Erwinia typographi
gb|EHC64013.1|  Tyrosyl-tRNA synthetase                               53.5    3e-05   Salmonella enterica subsp. enterica serovar Johannesburg str. S5-703
ref|WP_023490182.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Serratia sp. DD3
ref|WP_039057179.1|  tyrosyl-tRNA synthetase                          52.4    3e-05   
ref|WP_008915525.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Providencia sneebia
ref|WP_034791103.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Ewingella americana
ref|WP_009090365.1|  tyrosyl-tRNA synthetase                          53.5    3e-05   Pantoea
ref|WP_016582918.1|  tyrosyl-tRNA synthetase                          52.4    3e-05   Yersinia pestis
ref|WP_000168620.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Salmonella enterica
ref|WP_013508892.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Pantoea sp. At-9b
ref|WP_021185208.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Pantoea sp. AS-PWVM4
ref|WP_023223722.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   
ref|WP_017348953.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Pantoea sp. A4
ref|WP_015840590.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Pectobacterium carotovorum
ref|WP_031621900.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Salmonella enterica
gb|ESG44513.1|  tyrosyl-tRNA synthetase                               53.5    4e-05   
ref|WP_040075905.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Enterobacter cloacae
ref|WP_000168624.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   
ref|WP_023220918.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Salmonella enterica
ref|WP_033789864.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Pantoea septica
ref|WP_033747414.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Pantoea
ref|WP_023195535.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Salmonella enterica
ref|WP_016505353.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Salmonella enterica
gb|EHC57554.1|  Tyrosyl-tRNA synthetase                               53.5    4e-05   Salmonella enterica subsp. enterica serovar Inverness str. R8-3668
ref|WP_042844016.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Providencia rettgeri
ref|WP_034947778.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Erwinia oleae
ref|WP_032114939.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Arsenophonus endosymbiont of Nilaparvata lugens
ref|WP_037399671.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.5    4e-05   Serratia
ref|WP_031625199.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   
ref|WP_023198307.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Salmonella enterica
ref|WP_019209911.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Yersinia massiliensis
ref|WP_000168626.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Salmonella
ref|WP_000168618.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Salmonella bongori
ref|WP_023232826.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Salmonella enterica
ref|WP_023209468.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Salmonella enterica
gb|AHM74144.1|  Tyrosyl-tRNA synthetase                               53.1    4e-05   Yersinia enterocolitica LC20
ref|WP_026742637.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Lonsdalea quercina
ref|WP_039854143.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Providencia rustigianii
ref|WP_000168627.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Salmonella enterica
gb|EHC36772.1|  Tyrosyl-tRNA synthetase                               53.1    4e-05   Salmonella enterica subsp. enterica serovar Gaminara str. A4-567
ref|WP_041030274.1|  tyrosyl-tRNA synthetase                          52.8    4e-05   
ref|WP_038251393.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Yersinia ruckeri
ref|WP_000168625.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Salmonella enterica
ref|WP_033761546.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Pantoea
ref|WP_023891828.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Salmonella enterica
gb|EFE94325.1|  tyrosine--tRNA ligase                                 53.1    4e-05   Serratia odorifera DSM 4582
sp|C0Q5T3.1|SYY_SALPC  RecName: Full=Tyrosine--tRNA ligase; AltNa...  53.1    4e-05   Salmonella enterica subsp. enterica serovar Paratyphi C str. RKS4594
ref|WP_004910453.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Providencia rettgeri
ref|WP_026740282.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Lonsdalea quercina
gb|EFB73889.1|  tyrosine--tRNA ligase                                 53.1    4e-05   Providencia rustigianii DSM 4541
ref|WP_012210189.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
gb|AJJ11368.1|  tyrosine--tRNA ligase                                 53.1    4e-05   Yersinia rohdei
ref|WP_038275972.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Yersinia ruckeri
ref|WP_039292531.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Cedecea neteri
ref|WP_023187188.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Salmonella enterica
ref|WP_000168621.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Salmonella enterica
ref|XP_006689302.1|  tyrosyl-tRNA synthetase                          53.5    4e-05   Yamadazyma tenuis ATCC 10573
ref|WP_039992142.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Serratia odorifera
ref|WP_000168622.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Salmonella enterica
gb|ELO29336.1|  tyrosyl-tRNA synthetase                               52.8    4e-05   Salmonella enterica subsp. enterica serovar Enteritidis str. 648901 39-2
ref|WP_042545797.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Yersinia aldovae
ref|WP_038242652.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Yersinia ruckeri
ref|WP_023183135.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Salmonella enterica
ref|WP_008926220.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.1    4e-05   Pantoea
gb|EEQ20033.1|  Tyrosyl-tRNA synthetase                               53.1    4e-05   Yersinia intermedia ATCC 29909
gb|EEQ00523.1|  Tyrosyl-tRNA synthetase                               53.1    4e-05   Yersinia ruckeri ATCC 29473
ref|WP_016671261.1|  tyrosyl-tRNA synthetase                          52.4    4e-05   Yersinia pestis
ref|WP_023248114.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Salmonella enterica
ref|WP_010618963.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Plautia stali symbiont
ref|WP_023637871.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Dickeya solani
ref|WP_009112930.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Brenneria sp. EniD312
ref|WP_004712945.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_042839395.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Yersinia aldovae
ref|WP_039384166.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Pantoea
ref|WP_039302415.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Cedecea neteri
ref|WP_036953505.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Providencia alcalifaciens
ref|WP_006661929.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Providencia alcalifaciens
ref|WP_026358025.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Enterobacterales
gb|AHR86433.1|  tyrosyl-tRNA synthetase                               53.1    4e-05   
gb|ELO99720.1|  tyrosyl-tRNA ligase                                   53.1    4e-05   Salmonella enterica subsp. enterica serovar Enteritidis str. 6.0562-1
ref|WP_042525018.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Yersinia ruckeri
ref|WP_007892793.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   Pantoea
gb|ELP07553.1|  tyrosyl-tRNA ligase                                   52.4    4e-05   Salmonella enterica subsp. enterica serovar Enteritidis str. 50-5646
ref|WP_032906088.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_032908387.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_026823907.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_015672198.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_008110275.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_008456432.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_005165912.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_038669566.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.1    4e-05   
ref|WP_024109972.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.1    4e-05   
ref|WP_024108865.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_042663953.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_004263852.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
gb|ERO55966.1|  Tyrosyl-tRNA synthetase                               53.1    4e-05   
ref|WP_005169489.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_039509672.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_039299232.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_005972530.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_038923098.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
gb|KGQ13172.1|  Tyrosine--tRNA ligase                                 53.1    4e-05   
ref|WP_033111919.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_039705316.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
emb|CCV61620.1|  tyrosyl-tRNA synthetase                              53.1    4e-05   
ref|WP_036562073.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_039334182.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_036937235.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_024106282.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_023236637.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_016671911.1|  tyrosyl-tRNA synthetase                          52.8    4e-05   
ref|WP_038473162.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_038632681.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.1    4e-05   
ref|WP_039503307.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_039359307.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
gb|AIR71713.1|  tyrosyl-tRNA synthetase                               53.1    4e-05   
gb|EEB45108.1|  tyrosine--tRNA ligase                                 53.1    4e-05   
gb|EEQ11634.1|  Tyrosyl-tRNA synthetase                               53.1    4e-05   
ref|WP_042569813.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_034821575.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_032910188.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_039553709.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_039471678.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_039288996.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_014915732.1|  tyrosyl-tRNA synthetase                          53.1    4e-05   
ref|WP_014700285.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.1    4e-05   
gb|EEQ16586.1|  Tyrosyl-tRNA synthetase                               53.1    4e-05   
gb|EEP96493.1|  Tyrosyl-tRNA synthetase                               53.1    4e-05   
emb|CBA73966.1|  tyrosyl-tRNA synthetase                              53.1    4e-05   
ref|WP_038647256.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_013649859.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_011816372.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_040031605.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_039515827.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_039525655.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_039323120.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_032813567.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
gb|ADM98875.1|  tyrosyl-tRNA synthetase                               53.1    5e-05   
ref|WP_039314469.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_010302304.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_000168628.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_039550744.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_039481051.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_010276628.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_024913078.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_036913193.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_004248155.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_015697779.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_042871043.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
emb|CAR42933.1|  tyrosyl-tRNA synthetase                              53.1    5e-05   
gb|AFJ47367.1|  tyrosine tRNA synthetase                              53.1    5e-05   
ref|WP_000168629.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_016256906.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_013576069.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.1    5e-05   
ref|WP_011093502.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_006537030.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_025118928.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.1    5e-05   
ref|WP_040003564.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_033569899.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
gb|ERK16673.1|  Tyrosyl-tRNA synthetase                               53.1    5e-05   
gb|EPI67612.1|  tyrosine--tRNA ligase                                 53.1    5e-05   
gb|ACZ76544.1|  tyrosyl-tRNA synthetase                               53.1    5e-05   
ref|WP_011192524.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.1    5e-05   
ref|WP_034920070.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
gb|AAM85532.1|AE013799_7  tyrosine tRNA synthetase                    53.1    5e-05   
ref|WP_032966976.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_024967960.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_024529915.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_002210960.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_008911456.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_004919214.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_041164866.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
gb|EST58979.1|  tyrosyl-tRNA synthetase                               53.1    5e-05   
ref|WP_041069477.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
gb|AJC66684.1|  tyrosyl-tRNA synthetase                               53.1    5e-05   
ref|XP_004202244.1|  Piso0_001732                                     53.1    5e-05   
ref|WP_027711783.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_016602896.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_044550655.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_025384010.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_020438927.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_039995094.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_038927215.1|  MULTISPECIES: tyrosyl-tRNA synthetase            53.1    5e-05   
ref|XP_001416448.1|  Tyrosyl-tRNA synthetase, probable                53.1    5e-05   
ref|WP_037374787.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_024486511.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_020826694.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
ref|WP_033581440.1|  tyrosyl-tRNA synthetase                          53.1    5e-05   
gb|ERK15758.1|  Tyrosyl-tRNA synthetase                               53.1    5e-05   
ref|WP_037418742.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_012905691.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_004943805.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_033638393.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_013812695.1|  MULTISPECIES: tyrosyl-tRNA synthetase            52.8    5e-05   
ref|WP_044031333.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_032692908.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_015377740.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_038906304.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_038396055.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_033642931.1|  MULTISPECIES: tyrosyl-tRNA synthetase            52.8    5e-05   
ref|WP_033648189.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
gb|ACT06579.1|  tyrosyl-tRNA synthetase                               52.8    5e-05   
ref|WP_012144950.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_039351678.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
emb|CCJ80939.1|  Tyrosyl-tRNA synthetase ## cluster 1                 52.8    5e-05   
ref|WP_016672520.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_021505454.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_004931289.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_004851444.1|  MULTISPECIES: tyrosyl-tRNA synthetase            52.8    5e-05   
ref|WP_033577385.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_038219800.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_010847289.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_033640489.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_024232085.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_017892678.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
ref|WP_035594539.1|  tyrosyl-tRNA synthetase                          52.8    5e-05   
pdb|1X8X|A  Chain A, Tyrosyl T-Rna Synthetase From E.Coli Complex...  52.8    5e-05   
ref|WP_033633171.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_014229592.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_016583832.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_025302669.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_019455969.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
emb|CBJ89948.1|  tyrosine tRNA synthetase                             52.8    6e-05   
gb|ELN84999.1|  tyrosyl-tRNA ligase                                   49.3    6e-05   
ref|WP_043141190.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_016927908.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_044711194.1|  tyrosyl-tRNA synthetase                          52.4    6e-05   
ref|WP_016169797.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_012848532.1|  MULTISPECIES: tyrosyl-tRNA synthetase            52.8    6e-05   
gb|EFE22904.1|  tyrosine--tRNA ligase                                 52.4    6e-05   
ref|WP_029989572.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_034163451.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_044707869.1|  tyrosyl-tRNA synthetase                          52.4    6e-05   
ref|WP_032106983.1|  tyrosyl-tRNA synthetase                          52.4    6e-05   
ref|WP_020240975.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_000168631.1|  tyrosyl-tRNA synthetase                          52.4    6e-05   
ref|WP_042021291.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
gb|EFA49802.1|  tRNA synthetase class I (W and Y)                     52.0    6e-05   
pdb|1VBM|A  Chain A, Crystal Structure Of The Escherichia Coli Ty...  52.8    6e-05   
ref|WP_023565294.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_035370125.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_000168634.1|  tyrosyl-tRNA synthetase                          52.4    6e-05   
ref|WP_038265693.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_039076565.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_025901946.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
emb|CDL08187.1|  Tyrosyl-tRNA synthetase                              52.8    6e-05   
ref|WP_044177113.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_005294292.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_001571498.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_044071400.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_043083692.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_032300800.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
gb|KJF92142.1|  tyrosyl-tRNA synthetase                               52.4    6e-05   
ref|WP_038863161.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_034168106.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_032345262.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_001378963.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
emb|CCJ92438.1|  Tyrosyl-tRNA synthetase ## cluster 1                 52.8    6e-05   
ref|WP_042111121.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_028985476.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_040195622.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|XP_011397334.1|  Tyrosine-tRNA ligase                             52.8    6e-05   
ref|WP_036774837.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_042003698.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_001639570.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_024214005.1|  tyrosyl-tRNA synthetase                          52.4    6e-05   
emb|CDL41523.1|  Tyrosyl-tRNA synthetase                              52.8    6e-05   
emb|CCK14256.1|  Tyrosyl-tRNA synthetase ## cluster 1                 52.8    6e-05   
ref|WP_038339542.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_032983858.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_032804569.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_001559369.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
gb|AFJ99721.1|  tyrosyl-tRNA synthetase                               52.8    6e-05   
gb|EGB76212.1|  tyrosine--tRNA ligase                                 52.8    6e-05   
ref|WP_027360668.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_000168637.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_039021265.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_038020553.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_025710830.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_024552240.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_032205430.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_021552074.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_016234393.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_016230979.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_001302716.1|  tyrosyl-tRNA synthetase                          52.8    6e-05   
ref|WP_041460517.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_034495770.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_001301026.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_011378747.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_032231207.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_021559240.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_021527817.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_020239190.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_001373650.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_001441974.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_001516333.1|  MULTISPECIES: tyrosyl-tRNA synthetase            52.8    7e-05   
ref|WP_004386091.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_001359163.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_001339629.1|  MULTISPECIES: tyrosyl-tRNA synthetase            52.8    7e-05   
gb|EFK19528.1|  tyrosine--tRNA ligase                                 52.8    7e-05   
ref|WP_031597302.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_032968160.1|  MULTISPECIES: tyrosyl-tRNA synthetase            52.8    7e-05   
ref|WP_032617839.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   
ref|WP_029488429.1|  tyrosyl-tRNA synthetase                          52.8    7e-05   



>ref|XP_009588089.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Nicotiana tomentosiformis]
Length=521

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 84/128 (66%), Gaps = 3/128 (2%)
 Frame = +2

Query  254  ARMASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQFIPQLKS  433
            A   ++RTF+LN   + F+  F++   +          SL  +S  P CS +  +   + 
Sbjct  3    AGAGAIRTFLLNATQKPFTSSFLKNISLPTCLFLHNCLSLRSFSHRPFCSISTQLTSQED  62

Query  434  EPEMESDQ---RQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAES  604
             P+ E+ Q   ++ R NV++ILEERGLLESVT+++LRS+CSDPNL PL VYCGFDPTAES
Sbjct  63   TPQPENFQHSNKKTRPNVLQILEERGLLESVTNDSLRSVCSDPNLGPLKVYCGFDPTAES  122

Query  605  LHLGNLLG  628
            LHLGNLLG
Sbjct  123  LHLGNLLG  130



>ref|XP_006362449.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Solanum tuberosum]
Length=522

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 81/124 (65%), Gaps = 4/124 (3%)
 Frame = +2

Query  263  ASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQFIPQLKSEPE  442
            + +R+ +LN   R F+  F++K P+          S   +S  P CS +   P   S+ +
Sbjct  12   SGLRSLLLNTTLRPFTSSFLRKLPLPTYLFLPNTPSHHNFSHRPFCSIS---PLTTSQED  68

Query  443  MESDQRQRRR-NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGN  619
              S+   + R NV+ ILEERGLLESVTS++LRS+CSDPNL PL VYCGFDPTAESLHLGN
Sbjct  69   NFSNPNSKSRPNVLHILEERGLLESVTSDSLRSVCSDPNLGPLKVYCGFDPTAESLHLGN  128

Query  620  LLGL  631
            LLG+
Sbjct  129  LLGI  132



>emb|CDX92008.1| BnaC03g33100D [Brassica napus]
Length=262

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 64/86 (74%), Gaps = 7/86 (8%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S +PL SS +F     S   +E+     R NVV+ILEERGLLESVTSENLRS CSDP
Sbjct  49   FSTSRAPLFSSVKF-----STSSLET--AASRSNVVDILEERGLLESVTSENLRSACSDP  101

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
            N+ PL VYCGFDPTAESLHLGNLLG+
Sbjct  102  NVAPLKVYCGFDPTAESLHLGNLLGI  127



>ref|XP_010485586.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010485587.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SSA+   Q  S PE  S Q   R NVV+ILEERGLLES+TS NLRS CSDP
Sbjct  52   YSTSTTPLFSSAKCSVQSTSSPETVS-QAVSRPNVVDILEERGLLESITSNNLRSACSDP  110

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
             + PL VYCGFDPTAESLHLGNLLG+
Sbjct  111  KVTPLRVYCGFDPTAESLHLGNLLGI  136



>ref|XP_010463686.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010463687.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SS +   Q  S PE  + Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  52   YSTSTTPLFSSVRCSVQSTSSPETLT-QAASRPNVVDILEERGLLESITSENLRSACSDP  110

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
             + PL VYCGFDPTAESLHLGNLLG+
Sbjct  111  KVAPLKVYCGFDPTAESLHLGNLLGI  136



>ref|XP_002884331.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60590.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +   Q  S  E E +Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  52   FSTSTTPLFSSVKCSIQSTSSLETE-NQAVSRPNVVDILEERGLLESITSENLRSACSDP  110

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
             + PL VYCGFDPTAESLHLGNLLG+
Sbjct  111  KVAPLRVYCGFDPTAESLHLGNLLGI  136



>ref|XP_006297370.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
 gb|EOA30268.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
Length=548

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL S  +   Q  S P+ E +Q   R NVV+ILEERGLLES+TSENLRS CSDP
Sbjct  89   FSTSTTPLFSYVKCSVQSTSTPQTE-NQAVSRPNVVDILEERGLLESITSENLRSACSDP  147

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
             + PL VYCGFDPTAESLHLGNLLG+
Sbjct  148  KVAPLRVYCGFDPTAESLHLGNLLGI  173



>ref|XP_010500039.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010500108.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=511

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SSA+   Q  S PE  + Q   R NVV+ILEERGLLESVTSENLRS  SDP
Sbjct  52   YSTSTTPLFSSAKCSVQSTSSPETVT-QTVSRPNVVDILEERGLLESVTSENLRSASSDP  110

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
             + PL VYCGFDPTAESLHLGNLLG+
Sbjct  111  KVAPLRVYCGFDPTAESLHLGNLLGI  136



>ref|XP_010500171.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=505

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            +  S++PL SSA+   Q  S PE  + Q   R NVV+ILEERGLLESVTSENLRS  SDP
Sbjct  46   YSTSTTPLFSSAKCSVQSTSSPETVT-QTVSRPNVVDILEERGLLESVTSENLRSASSDP  104

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
             + PL VYCGFDPTAESLHLGNLLG+
Sbjct  105  KVAPLRVYCGFDPTAESLHLGNLLGI  130



>ref|XP_004242803.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Solanum 
lycopersicum]
Length=521

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 81/133 (61%), Gaps = 4/133 (3%)
 Frame = +2

Query  236  CADNTNARMASVRTFILNGAHRHFSPLFIQKFPIrlltshrrrsslFCYSSSPLCSSAQF  415
             A    A  + +R+ +LN   R F+   ++  P+          S   +S  P CS +  
Sbjct  2    AAAGAGAINSGLRSLLLNTTLRPFTSSLLRILPLPTYVFLPNTPSRHNFSHRPFCSIS--  59

Query  416  IPQLKSEPEMESDQRQRRR-NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDP  592
             P   S+ ++ S    + R NV+ ILEERGLLESVTS++LRS+CSDPNL PL VYCGFDP
Sbjct  60   -PLPASQEDIFSKPNSKSRPNVLHILEERGLLESVTSDSLRSVCSDPNLGPLKVYCGFDP  118

Query  593  TAESLHLGNLLGL  631
            TAESLHLGNLLG+
Sbjct  119  TAESLHLGNLLGI  131



>ref|XP_009118453.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118460.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118468.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118475.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
Length=503

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 63/86 (73%), Gaps = 6/86 (7%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL     F P   S  E E  Q   R NVV+IL+ERGLLESVTSENLRS CSDP
Sbjct  52   FSTSTTPL-----FAPVKCSTLETEV-QAVSRPNVVDILQERGLLESVTSENLRSACSDP  105

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
            N+ PL VYCGFDPTAESLHLGNLLG+
Sbjct  106  NVAPLKVYCGFDPTAESLHLGNLLGI  131



>ref|XP_004303944.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 6/90 (7%)
 Frame = +2

Query  380  YSSSPLCSSAQF-IPQLKSEPEMESDQR-----QRRRNVVEILEERGLLESVTSENLRSI  541
            Y S PLC  + F +P+    P + S  +       R+NVV+ILEERGLLES+TSE LR  
Sbjct  20   YYSLPLCVPSFFRVPRFHRNPILLSAVKCLQSSSGRQNVVDILEERGLLESLTSEQLRHA  79

Query  542  CSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            CSDP++PPL VYCGFDPTAESLHLGNLLGL
Sbjct  80   CSDPSIPPLKVYCGFDPTAESLHLGNLLGL  109



>ref|XP_009134705.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134706.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134707.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
Length=500

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 63/86 (73%), Gaps = 7/86 (8%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  50   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  102

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
            N+ PL VYCGFDPTAESLHLGNLLG+
Sbjct  103  NVAPLKVYCGFDPTAESLHLGNLLGI  128



>emb|CDX74240.1| BnaA03g28070D [Brassica napus]
Length=500

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 63/86 (73%), Gaps = 7/86 (8%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  50   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  102

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
            N+ PL VYCGFDPTAESLHLGNLLG+
Sbjct  103  NVAPLKVYCGFDPTAESLHLGNLLGI  128



>ref|XP_009134703.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Brassica rapa]
Length=520

 Score =   103 bits (256),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 63/86 (73%), Gaps = 7/86 (8%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +      S   +E+     R NVV ILEERGLLES+TSENLRS CSDP
Sbjct  70   FSTSTAPLFSSVKC-----STSSLET--AASRPNVVTILEERGLLESITSENLRSACSDP  122

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
            N+ PL VYCGFDPTAESLHLGNLLG+
Sbjct  123  NVAPLKVYCGFDPTAESLHLGNLLGI  148



>ref|XP_010276894.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nelumbo 
nucifera]
Length=531

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVVEILEERGLLES+TSENLRS CS+PNL PL VYCGFDPTAESLHLGNLLG+
Sbjct  76   RLNVVEILEERGLLESITSENLRSACSNPNLNPLKVYCGFDPTAESLHLGNLLGI  130



>ref|XP_010549888.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Tarenaya hassleriana]
Length=516

 Score =   102 bits (255),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 3/66 (5%)
 Frame = +2

Query  434  EPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHL  613
            EPE   +Q   R NVV+ILEERGLLES+TSENLRS CSDP L PL VYCGFDPTAESLHL
Sbjct  72   EPE---NQVASRPNVVDILEERGLLESITSENLRSACSDPTLGPLKVYCGFDPTAESLHL  128

Query  614  GNLLGL  631
            GNLLG+
Sbjct  129  GNLLGI  134



>ref|NP_186915.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AAF32473.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 dbj|BAD95182.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|ABK32110.1| At3g02660 [Arabidopsis thaliana]
 gb|AEE73845.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
Length=511

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/67 (76%), Positives = 56/67 (84%), Gaps = 1/67 (1%)
 Frame = +2

Query  431  SEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLH  610
            S PE E +Q   R NVV+ILEERGLLES+TSENLRS CSDP + PL VYCGFDPTAESLH
Sbjct  71   SSPETE-NQAVFRPNVVDILEERGLLESITSENLRSACSDPKVAPLRVYCGFDPTAESLH  129

Query  611  LGNLLGL  631
            LGNLLG+
Sbjct  130  LGNLLGI  136



>ref|XP_009760674.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
sylvestris]
Length=522

 Score =   102 bits (254),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 63/87 (72%), Gaps = 6/87 (7%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPE-MESDQRQRRRNVVEILEERGLLESVTSENLRSICSD  550
            FCYSS+ L S           PE  ++     R NV++ILEERGLLESVTS++LRS+CSD
Sbjct  51   FCYSSTQLTSQED-----NPRPEKWQNPNSNTRPNVLQILEERGLLESVTSDSLRSVCSD  105

Query  551  PNLPPLXVYCGFDPTAESLHLGNLLGL  631
             NL PL VYCGFDPTAESLHLGNLLG+
Sbjct  106  SNLGPLKVYCGFDPTAESLHLGNLLGI  132



>ref|XP_009355255.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355256.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355257.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355258.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVVEILEERGLLESVTSE+LR  CSDPNLPPL VYCGFDPTAESLHLGNL+G+
Sbjct  58   RPNVVEILEERGLLESVTSEHLRQSCSDPNLPPLKVYCGFDPTAESLHLGNLIGI  112



>ref|XP_009355254.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVVEILEERGLLESVTSE+LR  CSDPNLPPL VYCGFDPTAESLHLGNL+G+
Sbjct  62   RPNVVEILEERGLLESVTSEHLRQSCSDPNLPPLKVYCGFDPTAESLHLGNLIGI  116



>ref|XP_008218548.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218549.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218550.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
Length=485

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R+NVVEILEERGLLES+TSE+LR  CSDP+LPPL VYCGFDPTAESLHLGNLLG+
Sbjct  60   RQNVVEILEERGLLESLTSEHLRQACSDPSLPPLKVYCGFDPTAESLHLGNLLGI  114



>ref|XP_009591201.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
tomentosiformis]
Length=522

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 62/87 (71%), Gaps = 6/87 (7%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPE-MESDQRQRRRNVVEILEERGLLESVTSENLRSICSD  550
            FCYSS+ L S           PE  ++     R NV++ILEERGLLESVTS++LRS+CSD
Sbjct  51   FCYSSTQLTSQED-----NPRPEKWQNPNNNTRPNVLQILEERGLLESVTSDSLRSVCSD  105

Query  551  PNLPPLXVYCGFDPTAESLHLGNLLGL  631
             N  PL VYCGFDPTAESLHLGNLLG+
Sbjct  106  SNFGPLKVYCGFDPTAESLHLGNLLGI  132



>ref|XP_007222608.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
 gb|EMJ23807.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
Length=485

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R+NVVEILEERGLLES+TSE+LR  CSDP+LPPL VYCGFDPTAESLHLGNLLG+
Sbjct  60   RQNVVEILEERGLLESLTSEHLRQACSDPSLPPLKVYCGFDPTAESLHLGNLLGI  114



>ref|XP_008347911.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347912.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347913.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365305.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365306.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365307.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVVEILEERGLLES+TSE+LR  CSDPNLPPL VYCGFDPTAESLHLGNL+G+
Sbjct  58   RPNVVEILEERGLLESITSEHLRQSCSDPNLPPLKVYCGFDPTAESLHLGNLIGI  112



>ref|XP_004299915.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
 ref|XP_011464831.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  464  RRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RR NV++ILEERGLLES+TSE LR  CSDP++PPL VYCGFDPTAESLHLGNLLGL
Sbjct  59   RRHNVIDILEERGLLESMTSEQLRHACSDPSVPPLKVYCGFDPTAESLHLGNLLGL  114



>ref|XP_006408394.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 ref|XP_006408395.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49847.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49848.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
Length=499

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 61/86 (71%), Gaps = 10/86 (12%)
 Frame = +2

Query  374  FCYSSSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDP  553
            F  S++PL SS +   Q              R NVV+ILEERGLLES+TSE+LRS CSDP
Sbjct  52   FSASTTPLLSSVKCSIQ----------STVSRPNVVDILEERGLLESITSESLRSACSDP  101

Query  554  NLPPLXVYCGFDPTAESLHLGNLLGL  631
            ++ PL VYCGFDPTAESLHLGNLLG+
Sbjct  102  SVAPLKVYCGFDPTAESLHLGNLLGI  127



>ref|XP_009348746.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348747.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348748.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348749.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVVEILEERGLLES+TSE+LR +CSDP LPPL VYCGFDPTAESLHLGNL+G+
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCSDPILPPLKVYCGFDPTAESLHLGNLIGI  112



>ref|XP_009348745.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVVEILEERGLLES+TSE+LR +CSDP LPPL VYCGFDPTAESLHLGNL+G+
Sbjct  62   RPNVVEILEERGLLESLTSEHLRQVCSDPILPPLKVYCGFDPTAESLHLGNLIGI  116



>ref|XP_008339494.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Malus domestica]
Length=482

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVVEILEERGLLES+TSE+LR +C+DPNL PL VYCGFDPTAESLHLGNL+G+
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCTDPNLXPLKVYCGFDPTAESLHLGNLIGI  112



>ref|XP_008361702.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVVEILEERGLLES+TSE+LR +C+DPNL PL VYCGFDPTAESLHLGNL+G+
Sbjct  58   RPNVVEILEERGLLESLTSEHLRQVCTDPNLXPLKVYCGFDPTAESLHLGNLIGI  112



>ref|XP_008339493.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Malus domestica]
Length=486

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/55 (82%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVVEILEERGLLES+TSE+LR +C+DPNL PL VYCGFDPTAESLHLGNL+G+
Sbjct  62   RPNVVEILEERGLLESLTSEHLRQVCTDPNLXPLKVYCGFDPTAESLHLGNLIGI  116



>ref|XP_009414004.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=535

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +2

Query  401  SSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYC  580
            SS+Q  P+    P    D   R  NVV+IL+ERGL+ES+TSENLRS CS P   PL VYC
Sbjct  49   SSSQPAPETLEAPIQGLDSSTRAPNVVDILQERGLIESITSENLRSACSTPAANPLKVYC  108

Query  581  GFDPTAESLHLGNLLGL  631
            GFDPTAESLHLGNLLG+
Sbjct  109  GFDPTAESLHLGNLLGI  125



>ref|XP_010683748.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683749.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683750.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683751.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 1/59 (2%)
 Frame = +2

Query  458  RQRRRNVVEILEERGLLESVTSENLRSICS-DPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            +QR RNVVEILEERGL+ES+TS+NLRS  S D N PPL VYCGFDPTAESLHLGNL+G+
Sbjct  68   QQRSRNVVEILEERGLIESITSDNLRSASSLDNNHPPLKVYCGFDPTAESLHLGNLIGI  126



>ref|XP_008801775.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=544

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 5/75 (7%)
 Frame = +2

Query  422  QLKSEPEMESDQRQRRR-----NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGF  586
            Q  ++P +E+  R         NVV+IL+ERGL+ES+TSE++RS CS+P++ PL VYCGF
Sbjct  43   QSAAQPTLEAQARNLDSLAGIPNVVDILQERGLVESITSESIRSACSNPSVSPLKVYCGF  102

Query  587  DPTAESLHLGNLLGL  631
            DPTAESLHLGNLLGL
Sbjct  103  DPTAESLHLGNLLGL  117



>gb|KJB12925.1| hypothetical protein B456_002G045400 [Gossypium raimondii]
Length=491

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NVV+ILEERGLLES+T+ENLR +CSD    PL VYCGFDPTAESLHLGNLLGL
Sbjct  61   NVVKILEERGLLESITNENLRLVCSDQTAGPLKVYCGFDPTAESLHLGNLLGL  113



>ref|XP_008783116.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
 ref|XP_008783117.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=543

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 5/75 (7%)
 Frame = +2

Query  422  QLKSEPEMESDQRQRRR-----NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGF  586
            Q  ++P +E+  R         NVV+IL+ERGL+ES+TSE++RS CS+P + PL VYCGF
Sbjct  42   QSAAQPTLEAQARNLDSPSGIANVVDILQERGLVESITSESIRSACSNPIVSPLKVYCGF  101

Query  587  DPTAESLHLGNLLGL  631
            DPTAESLHLGNLLGL
Sbjct  102  DPTAESLHLGNLLGL  116



>ref|XP_007022035.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
 gb|EOY13560.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
Length=486

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV++ILEERGLLESVT+ENLR  CSD    PL VYCGFDPTAESLHLGNLLGL
Sbjct  61   NVIKILEERGLLESVTNENLRLACSDQTAGPLKVYCGFDPTAESLHLGNLLGL  113



>ref|XP_007022036.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 ref|XP_007022037.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13561.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13562.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
Length=491

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV++ILEERGLLESVT+ENLR  CSD    PL VYCGFDPTAESLHLGNLLGL
Sbjct  61   NVIKILEERGLLESVTNENLRLACSDQTAGPLKVYCGFDPTAESLHLGNLLGL  113



>ref|XP_010927782.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Elaeis 
guineensis]
Length=544

 Score = 91.3 bits (225),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 56/75 (75%), Gaps = 5/75 (7%)
 Frame = +2

Query  422  QLKSEPEMESDQRQRRR-----NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGF  586
            Q  ++P +E   R         NVV+IL+ERGL+ES+TSE++RS CS+P++ PL VYCGF
Sbjct  43   QSATQPTLEDSTRNLDSIAGIPNVVDILQERGLVESITSESIRSACSNPSISPLKVYCGF  102

Query  587  DPTAESLHLGNLLGL  631
            DPTAESLHLGNLL L
Sbjct  103  DPTAESLHLGNLLAL  117



>ref|XP_007022034.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY13559.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=542

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV++ILEERGLLESVT+ENLR  CSD    PL VYCGFDPTAESLHLGNLLGL
Sbjct  117  NVIKILEERGLLESVTNENLRLACSDQTAGPLKVYCGFDPTAESLHLGNLLGL  169



>emb|CDP19091.1| unnamed protein product [Coffea canephora]
Length=525

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 2/55 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSD--PNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NVVEILE+RGLLES+TS+ LRS+CS   PN PPL VYCGFDPTA+SLHLGNLLG+
Sbjct  96   NVVEILEQRGLLESLTSDGLRSVCSSSAPNQPPLRVYCGFDPTADSLHLGNLLGI  150



>gb|KDO63480.1| hypothetical protein CISIN_1g037749mg [Citrus sinensis]
Length=495

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = +2

Query  386  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPP  565
            +S   SS   + QL+S+P+ ++    R  NVV+ILE RGLLES+TS+NLRS+ S  N   
Sbjct  45   NSAFFSSISCVHQLQSDPQTQT--HGRHPNVVDILERRGLLESITSDNLRSLAS-SNEKT  101

Query  566  LXVYCGFDPTAESLHLGNLLGL  631
            L VYCGFDPTAESLHLGNLLG+
Sbjct  102  LKVYCGFDPTAESLHLGNLLGI  123



>ref|XP_006468947.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Citrus sinensis]
Length=493

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 60/82 (73%), Gaps = 3/82 (4%)
 Frame = +2

Query  386  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPP  565
            +S   SS   + QL+S+P+ ++    R  NVV+ILE RGLLES+TS+NLRS+ S  N   
Sbjct  43   NSAFFSSISCVHQLQSDPQTQT--HGRHPNVVDILERRGLLESITSDNLRSLAS-SNEKT  99

Query  566  LXVYCGFDPTAESLHLGNLLGL  631
            L VYCGFDPTAESLHLGNLLG+
Sbjct  100  LKVYCGFDPTAESLHLGNLLGI  121



>ref|XP_002512791.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF49294.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
Length=492

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 3/56 (5%)
 Frame = +2

Query  464  RRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RR+NVV+ILEERGLLESVTS+NLRS CS   +  L VYCGFDPTAESLHLGNL+G+
Sbjct  63   RRQNVVDILEERGLLESVTSDNLRSACS---ISTLKVYCGFDPTAESLHLGNLIGI  115



>ref|XP_006446866.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
 gb|ESR60106.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
Length=493

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = +2

Query  386  SSPLCSSAQFIPQLKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPP  565
            +S   SS   + QL+S+P+ ++    R  NVV+  E RGLLES+TS+NLRS+ S  N   
Sbjct  43   NSAFFSSISCVQQLQSDPQTQT--HGRHPNVVDTFERRGLLESITSDNLRSLAS-SNEKT  99

Query  566  LXVYCGFDPTAESLHLGNLLGL  631
            L VYCGFDPTAESLHLGNLLG+
Sbjct  100  LKVYCGFDPTAESLHLGNLLGI  121



>gb|KCW55733.1| hypothetical protein EUGRSUZ_I01565, partial [Eucalyptus grandis]
Length=479

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 2/53 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NVV++LEERGLLESVTSENLRS CS  +   L VYCGFDPTAESLHLGNLLG+
Sbjct  48   NVVDVLEERGLLESVTSENLRSACSSGS--GLRVYCGFDPTAESLHLGNLLGI  98



>gb|KEH34424.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=500

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RNV+ ILEERGLL+S+T+++LRSI S+    PL VYCGFDPTAESLHLGNLLGL
Sbjct  59   RNVIRILEERGLLDSLTNDSLRSISSNTINAPLKVYCGFDPTAESLHLGNLLGL  112



>ref|XP_010028900.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
Length=506

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 46/53 (87%), Gaps = 2/53 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NVV++LEERGLLESVTSENLRS CS  +   L VYCGFDPTAESLHLGNLLG+
Sbjct  75   NVVDVLEERGLLESVTSENLRSACSSGS--GLRVYCGFDPTAESLHLGNLLGI  125



>ref|XP_003544330.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=490

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 45/53 (85%), Gaps = 2/53 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV+ ILEERGL+ES+TS+ LRS C  P  PPL VYCGFDPTAESLHLGNLLGL
Sbjct  59   NVIGILEERGLVESITSDALRSACLTP--PPLKVYCGFDPTAESLHLGNLLGL  109



>ref|XP_004500343.1| PREDICTED: tyrosine--tRNA ligase-like [Cicer arietinum]
Length=501

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R+VV ILEERGLL+S+T++ LRSI S+    PL VYCGFDPTAESLHLGNLLGL
Sbjct  58   RSVVGILEERGLLDSITNDTLRSISSNTINAPLKVYCGFDPTAESLHLGNLLGL  111



>ref|XP_003519285.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=496

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 46/59 (78%), Gaps = 2/59 (3%)
 Frame = +2

Query  455  QRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            +R    NV+ ILEERGL+ES+TS+ LRS C  P   PL VYCGFDPTAESLHLGNLLGL
Sbjct  51   RRNNNYNVIGILEERGLVESITSDALRSACLTP--APLKVYCGFDPTAESLHLGNLLGL  107



>gb|EYU42284.1| hypothetical protein MIMGU_mgv1a005712mg [Erythranthe guttata]
Length=473

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 44/54 (81%), Gaps = 4/54 (7%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RNVVEILEERGLLES+T + LR     PN PPL VYCGFDPTAESLHLGNLL L
Sbjct  44   RNVVEILEERGLLESLTGDALRR----PNHPPLRVYCGFDPTAESLHLGNLLAL  93



>gb|KDP41896.1| hypothetical protein JCGZ_26914 [Jatropha curcas]
Length=509

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 47/56 (84%), Gaps = 2/56 (4%)
 Frame = +2

Query  464  RRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R  NVV+ILEERGLLES+TS+NLRSI S  N   + VYCGFDPTAESLHLGNLLG+
Sbjct  79   RHPNVVDILEERGLLESLTSDNLRSISSTSN--NVRVYCGFDPTAESLHLGNLLGI  132



>gb|KHN08832.1| Tyrosine--tRNA ligase [Glycine soja]
Length=482

 Score = 82.8 bits (203),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 50/64 (78%), Gaps = 7/64 (11%)
 Frame = +2

Query  455  QRQRRRN-----VVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGN  619
            Q+Q RRN     V+ ILEERGL+ES+TS+ LRS C  P  PPL VYCGFDPTAESLHLGN
Sbjct  45   QQQPRRNNNNNNVIGILEERGLVESITSDALRSACLTP--PPLKVYCGFDPTAESLHLGN  102

Query  620  LLGL  631
            LLGL
Sbjct  103  LLGL  106



>ref|XP_007142062.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
 gb|ESW14056.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
Length=478

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 4/59 (7%)
 Frame = +2

Query  455  QRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            Q+Q  RNV+EILEERGL+ES+TS+ LR+ CS      + VYCGFDPTAESLHLGNLLG+
Sbjct  46   QQQPLRNVIEILEERGLVESITSDALRAACS----SSVKVYCGFDPTAESLHLGNLLGI  100



>ref|XP_002980036.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
 gb|EFJ18906.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
Length=467

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 3/55 (5%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RRNVVEILE+RGL+ES+  E+L+  C +    P+ VYCGFDPTAESLHLGNLLG+
Sbjct  49   RRNVVEILEQRGLVESIAGESLKKACDEK---PIKVYCGFDPTAESLHLGNLLGI  100



>ref|XP_002992920.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
 gb|EFJ06009.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
Length=467

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 3/55 (5%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RRNVVEILE+RGL+ES+  E+L+  C +    P+ VYCGFDPTAESLHLGNLLG+
Sbjct  49   RRNVVEILEQRGLVESIAGESLKKACDEK---PIKVYCGFDPTAESLHLGNLLGI  100



>ref|XP_001751567.1| predicted protein [Physcomitrella patens]
 gb|EDQ83884.1| predicted protein [Physcomitrella patens]
Length=502

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 3/54 (6%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RNVVE+LEERGL+ESVTSE L++ C    L    VYCGFDPTAESLHLGNLLG+
Sbjct  78   RNVVEVLEERGLIESVTSEELKATCMKQRLK---VYCGFDPTAESLHLGNLLGI  128



>ref|XP_011071261.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Sesamum 
indicum]
Length=503

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 46/55 (84%), Gaps = 2/55 (4%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RRNVV ILEERGLL+S+TS+ LR    D  LPPL VYCGFDPTA+SLHLGNLLG+
Sbjct  42   RRNVVHILEERGLLDSLTSDALRR--PDLPLPPLRVYCGFDPTAQSLHLGNLLGI  94



>gb|EYU24457.1| hypothetical protein MIMGU_mgv1a005745mg [Erythranthe guttata]
Length=472

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 43/54 (80%), Gaps = 4/54 (7%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RNVVEILEERGLLES+T + LR      N PPL VYCGFDPTAESLHLGNLL L
Sbjct  44   RNVVEILEERGLLESLTGDALRR----QNHPPLRVYCGFDPTAESLHLGNLLAL  93



>ref|XP_004146892.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
 gb|KGN53185.1| hypothetical protein Csa_4G025150 [Cucumis sativus]
Length=493

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV++ILE+RGLL+S+TS+NLRS     +L PL VYCGFDPTA+SLHLGNLLGL
Sbjct  67   NVIQILEQRGLLDSITSDNLRS----ASLSPLKVYCGFDPTAQSLHLGNLLGL  115



>ref|XP_004166614.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
Length=493

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV++ILE+RGLL+S+TS+NLRS     +L PL VYCGFDPTA+SLHLGNLLGL
Sbjct  67   NVIQILEQRGLLDSITSDNLRS----ASLSPLKVYCGFDPTAQSLHLGNLLGL  115



>ref|XP_011033705.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Populus euphratica]
Length=502

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 3/60 (5%)
 Frame = +2

Query  452  DQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            D  + R +VV+ILEERGLLES+TS+NLRSI +   L     YCGFDPTAESLHLGNLLG+
Sbjct  59   DPMRSRSSVVDILEERGLLESITSDNLRSISTTSTLK---AYCGFDPTAESLHLGNLLGI  115



>ref|XP_008453844.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Cucumis 
melo]
Length=493

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 46/53 (87%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV++ILE+RGLL+S+TS+NLRS     +L PL VYCGFDPTA+SLHLGNLLGL
Sbjct  67   NVIQILEQRGLLDSITSDNLRS----ASLSPLKVYCGFDPTAQSLHLGNLLGL  115



>gb|KEH32330.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=482

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +2

Query  455  QRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            Q Q+  NV+ ILE+RGLL+S+T+E+LR+I S+    PL VYCGFDPTA+SLHLGNLL L
Sbjct  43   QHQQPPNVIGILEQRGLLDSITNESLRTISSNTINAPLKVYCGFDPTAQSLHLGNLLAL  101



>ref|XP_006826574.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
 gb|ERM93811.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
Length=495

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  449  SDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLG  628
            + + Q  +NV+++LE+RGL++S+TS++L+S  S+PN  PL VYCGFDPTAESLHLGNLLG
Sbjct  53   ASKAQNCKNVIQVLEDRGLVDSITSQDLKSASSNPNSSPLKVYCGFDPTAESLHLGNLLG  112

Query  629  L  631
            L
Sbjct  113  L  113



>gb|KIY99495.1| tyrosyl-tRNA synthetase [Monoraphidium neglectum]
Length=216

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 44/58 (76%), Gaps = 3/58 (5%)
 Frame = +2

Query  458  RQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R    NVV+IL ERGL++ VTSE+L S+ +  +L    VYCGFDPTA+SLHLGNLLG+
Sbjct  25   RGATANVVQILRERGLVQEVTSEDLESLAAQTSLS---VYCGFDPTADSLHLGNLLGI  79



>emb|CAN64191.1| hypothetical protein VITISV_016956 [Vitis vinifera]
Length=868

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NV+EILE+RGL++S+TS  LR+  S   L    VYCGFDPTAESLHLGNLLGL
Sbjct  58   RSNVIEILEQRGLVDSITSPILRASSSTQTL---KVYCGFDPTAESLHLGNLLGL  109



>emb|CBI22389.3| unnamed protein product [Vitis vinifera]
Length=399

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NV+EILE+RGL++S+TS  LR+  S   L    VYCGFDPTAESLHLGNLLGL
Sbjct  58   RSNVIEILEQRGLVDSITSPILRASSSTQTLK---VYCGFDPTAESLHLGNLLGL  109



>ref|XP_002265238.2| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Vitis 
vinifera]
Length=485

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 3/55 (5%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NV+EILE+RGL++S+TS  LR+  S   L    VYCGFDPTAESLHLGNLLGL
Sbjct  58   RSNVIEILEQRGLVDSITSPILRASSSTQTLK---VYCGFDPTAESLHLGNLLGL  109



>ref|WP_006340872.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|EFB41848.1| hypothetical protein pah_c022o146 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86267.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae UV-7]
Length=430

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 4/54 (7%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            +NV++IL+ERG +E++TS NL+ I S     PL VYCGFDPTAESLHLGN++ +
Sbjct  2    QNVIDILQERGFIEAMTSNNLKEITS----TPLKVYCGFDPTAESLHLGNMVAI  51



>ref|WP_039376683.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|KIA77993.1| Tyrosine--tRNA ligase [Parachlamydia acanthamoebae]
Length=437

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 4/54 (7%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            +NV++IL+ERG +E++TS NL+ I S     PL VYCGFDPTAESLHLGN++ +
Sbjct  2    QNVIDILQERGFIEAMTSNNLKEITS----TPLKVYCGFDPTAESLHLGNMVAI  51



>gb|EMT07165.1| Tyrosyl-tRNA synthetase [Aegilops tauschii]
Length=512

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  458  RQRRRNVVEILEERGLLESVTSENLRSICS-DPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R  RR VV++L ERGL+E+ TSE L S  +       L VYCGFDPTAESLHLGNLLGL
Sbjct  44   RTVRRGVVDVLRERGLVEATTSEALGSSSAVSGEQQQLKVYCGFDPTAESLHLGNLLGL  102



>gb|EPS58486.1| hypothetical protein M569_16327, partial [Genlisea aurea]
Length=428

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 43/55 (78%), Gaps = 4/55 (7%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVVEIL++RGL+ES+T++      S  NL  + VYCGFDPTAESLHLGNL+GL
Sbjct  6    RLNVVEILQQRGLVESITAD----AGSLSNLSAVRVYCGFDPTAESLHLGNLVGL  56



>ref|XP_006645923.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Oryza brachyantha]
Length=485

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 2/54 (4%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R+VV++L ERGL+E+ TSE L S  + P    L  YCGFDPTAESLHLGNLLGL
Sbjct  34   RSVVDVLRERGLVEATTSETLGSGSASPR--ELKAYCGFDPTAESLHLGNLLGL  85



>ref|XP_005650588.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE26044.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=450

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 46/66 (70%), Gaps = 5/66 (8%)
 Frame = +2

Query  434  EPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHL  613
            EPE E   +Q +  +VE+L  RGL++ +TS +L  + +  NL    VYCGFDPTAESLHL
Sbjct  10   EPEKEQGAQQLK--IVEVLRSRGLVQDITSPSLEKVAATENLT---VYCGFDPTAESLHL  64

Query  614  GNLLGL  631
            GNLLG+
Sbjct  65   GNLLGI  70



>gb|EMS54027.1| Tyrosyl-tRNA synthetase [Triticum urartu]
Length=796

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENL-RSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RR VV++L ERGL+E+ TSE L  S  +      L VYCGFDPTAESLHLGNLLGL
Sbjct  331  RRGVVDVLRERGLVEATTSEALGSSSAASGEQQKLKVYCGFDPTAESLHLGNLLGL  386



>ref|XP_010229641.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Brachypodium distachyon]
Length=473

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSI-CSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RR+VV++L ERGL+E+ TSE L S   +      L  YCGFDPTAESLHLGNLLGL
Sbjct  50   RRSVVDVLRERGLVEATTSEALGSSPSAGGQQQQLKAYCGFDPTAESLHLGNLLGL  105



>ref|XP_003574045.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=512

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSI-CSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RR+VV++L ERGL+E+ TSE L S   +      L  YCGFDPTAESLHLGNLLGL
Sbjct  50   RRSVVDVLRERGLVEATTSEALGSSPSAGGQQQQLKAYCGFDPTAESLHLGNLLGL  105



>ref|XP_002504529.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65787.1| predicted protein [Micromonas sp. RCC299]
Length=506

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 46/56 (82%), Gaps = 4/56 (7%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSEN-LRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            + +VV++L+ERGLL++ T+E+ LR  C++ +L    VYCGFDPTA+SLHLGNLLG+
Sbjct  76   KADVVDVLKERGLLDACTNEDELRKACAEGSLS---VYCGFDPTADSLHLGNLLGI  128



>ref|XP_005538192.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82156.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
Length=522

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 43/53 (81%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV+++LE RGL+++VTS ++ ++C+ P    + VY GFDPTA+SLH+GNLLGL
Sbjct  85   NVIQVLESRGLIDAVTSTDVYAVCARP----VAVYVGFDPTADSLHIGNLLGL  133



>gb|KIC71389.1| Tyrosine--tRNA ligase [Candidatus Protochlamydia amoebophila]
Length=437

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV+++L ERG +++VTSE +R + +     P+ VYCGFDPTA+SLHLGNL+ +
Sbjct  15   NVIDVLRERGFIDAVTSEEIRQLTN----QPIKVYCGFDPTADSLHLGNLVAI  63



>ref|WP_042279297.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia sp. R18]
Length=425

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV+++L ERG +++VTSE +R + +     P+ VYCGFDPTA+SLHLGNL+ +
Sbjct  3    NVIDVLRERGFIDAVTSEEIRQLTN----QPIKVYCGFDPTADSLHLGNLVAI  51



>ref|WP_039359281.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
Length=425

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV+++L ERG +++VTSE +R + +     P+ VYCGFDPTA+SLHLGNL+ +
Sbjct  3    NVIDVLRERGFIDAVTSEEIRQLTN----QPIKVYCGFDPTADSLHLGNLVAI  51



>ref|WP_011175719.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
 sp|Q6MC06.1|SYY_PARUW RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF23893.1| probable tyrosine-tRNA ligase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=425

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV+++L ERG +++VTSE +R + +     P+ VYCGFDPTA+SLHLGNL+ +
Sbjct  3    NVMDVLRERGFIDAVTSEEIRQLTN----QPIKVYCGFDPTADSLHLGNLVAI  51



>ref|XP_004982893.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Setaria italica]
Length=494

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
             VV++L ERGL+E+ TSE L +  + P    L VYCGFDPTAESLHLGNLLGL
Sbjct  49   GVVDVLRERGLVEATTSEALAA--ARPG--ELKVYCGFDPTAESLHLGNLLGL  97



>ref|XP_004993733.1| tyrosyl-tRNA synthetase [Salpingoeca rosetta]
 gb|EGD73451.1| tyrosyl-tRNA synthetase [Salpingoeca rosetta]
Length=459

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 44/69 (64%), Gaps = 6/69 (9%)
 Frame = +2

Query  425  LKSEPEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAES  604
            L+  P  + DQR   R  V  LEERGLL+  TS+ LR++C    L    VYCGFDPTA +
Sbjct  2    LQGMPMQQLDQR---RPFVGTLEERGLLKDSTSDELRTLCEKEQLT---VYCGFDPTART  55

Query  605  LHLGNLLGL  631
            LH+GNLL +
Sbjct  56   LHIGNLLAI  64



>ref|XP_007509051.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO19508.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
Length=486

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 3/53 (6%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            NV+ IL ERGLL++ TSE      S+    P+ VYCGFDPTA+SLHLGNLLG+
Sbjct  63   NVLNILRERGLLDACTSEG---SLSEATQKPVRVYCGFDPTADSLHLGNLLGI  112



>ref|XP_010110726.1| Tyrosine--tRNA ligase [Morus notabilis]
 gb|EXC27891.1| Tyrosine--tRNA ligase [Morus notabilis]
Length=481

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 37/48 (77%), Gaps = 5/48 (10%)
 Frame = +2

Query  488  LEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            LE+RGLL+S+TS+NLR+  S     PL  YCGFDPTA SLHLGNLL L
Sbjct  69   LEQRGLLDSLTSDNLRTTSS-----PLTAYCGFDPTAPSLHLGNLLAL  111



>ref|XP_003059850.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55802.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=430

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 4/53 (8%)
 Frame = +2

Query  476  VVEILEERGLLESVTSEN-LRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            VV++L ERGLL++ T+E+ LR    D +L    VYCGFDPTA+SLHLGNLLG+
Sbjct  1    VVDVLRERGLLDACTNEDELREAAGDGSLS---VYCGFDPTADSLHLGNLLGI  50



>ref|NP_001141566.1| hypothetical protein [Zea mays]
 gb|ACF86629.1| unknown [Zea mays]
 tpg|DAA37471.1| TPA: hypothetical protein ZEAMMB73_107188 [Zea mays]
Length=496

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
             VV++L +RGL+E++TSE L +  + P    L VYCGFDPTAESLHLGNLLGL
Sbjct  52   GVVDVLMKRGLVEAITSEALAA--ARPG--ELKVYCGFDPTAESLHLGNLLGL  100



>ref|WP_032125960.1| tyrosyl-tRNA synthetase [Chlamydia sp. 'Diamant']
Length=424

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 39/53 (74%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
             ++++L ERG +++VTSE +R +       P+ VYCGFDPTA+SLHLGNL+ +
Sbjct  3    TIIDVLRERGFIDAVTSEEIRQLTQ----QPVKVYCGFDPTADSLHLGNLVAI  51



>ref|XP_002447960.1| hypothetical protein SORBIDRAFT_06g018870 [Sorghum bicolor]
 gb|EES12288.1| hypothetical protein SORBIDRAFT_06g018870 [Sorghum bicolor]
Length=521

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
             VV++L +RGL+E+ TSE L    + P    L VYCGFDPTAESLHLGNLLGL
Sbjct  77   GVVDVLMKRGLVEATTSEAL--AAARPG--ELKVYCGFDPTAESLHLGNLLGL  125



>ref|XP_005707106.1| tyrosyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME30586.1| tyrosyl-tRNA synthetase [Galdieria sulphuraria]
Length=501

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = +2

Query  449  SDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLG  628
            + Q   ++ V+++L ERGLL+  T   +  +C      P+ +Y GFDPTAESLH+GNLLG
Sbjct  65   ASQAASKKTVIQVLRERGLLDQTTGPEVEKLCQ----KPVRIYVGFDPTAESLHIGNLLG  120

Query  629  L  631
            +
Sbjct  121  I  121



>ref|XP_002955541.1| hypothetical protein VOLCADRAFT_83275 [Volvox carteri f. nagariensis]
 gb|EFJ43394.1| hypothetical protein VOLCADRAFT_83275 [Volvox carteri f. nagariensis]
Length=520

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R NVV +L  RGL++ VT        +     PL VYCGFDPTA+SLHLGNLLG+
Sbjct  84   RPNVVALLRSRGLVQEVTGGEELEAAAGGAEGPLSVYCGFDPTADSLHLGNLLGI  138



>ref|WP_042103652.1| tyrosyl-tRNA synthetase [Parachlamydiaceae bacterium HS-T3]
Length=420

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 39/54 (72%), Gaps = 4/54 (7%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            +NVV+IL+ERG +++ TS+ +  +       P+ VYCGFDPTA+SLHLGN + +
Sbjct  2    KNVVKILKERGFIDATTSDEIEQLVE----KPIRVYCGFDPTADSLHLGNFVAI  51



>ref|NP_001043131.1| Os01g0500900 [Oryza sativa Japonica Group]
 dbj|BAB64064.1| putative tyrosine-tRNA ligase [Oryza sativa Japonica Group]
 dbj|BAF05045.1| Os01g0500900 [Oryza sativa Japonica Group]
 gb|EAY74203.1| hypothetical protein OsI_02083 [Oryza sativa Indica Group]
 dbj|BAG90095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=497

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 2/48 (4%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLH  610
            RR+VVE+L ERGL+E+ TSE+L S  + P    L  YCGFDPTAESLH
Sbjct  46   RRSVVEVLRERGLVEATTSESLGSASASPR--ELKAYCGFDPTAESLH  91



>gb|EAZ12037.1| hypothetical protein OsJ_01916 [Oryza sativa Japonica Group]
Length=545

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 36/48 (75%), Gaps = 2/48 (4%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLH  610
            RR+VVE+L ERGL+E+ TSE+L S  + P    L  YCGFDPTAESLH
Sbjct  46   RRSVVEVLRERGLVEATTSESLGSASASPR--ELKAYCGFDPTAESLH  91


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 2/44 (5%)
 Frame = +2

Query  479  VEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLH  610
            V +L ERGL+E+ TSE+L S  + P    L  YCGFDPTAESLH
Sbjct  122  VSVLRERGLVEATTSESLGSASASPR--ELKAYCGFDPTAESLH  163



>ref|XP_005848281.1| hypothetical protein CHLNCDRAFT_48743 [Chlorella variabilis]
 gb|EFN56179.1| hypothetical protein CHLNCDRAFT_48743 [Chlorella variabilis]
Length=440

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 3/54 (6%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            ++VV  L  RGLL+ VTS +L ++ +   L     YCGFDPTAESLHLGNLLG+
Sbjct  38   QDVVAALRSRGLLQDVTSPDLAAVSTQEQL---LAYCGFDPTAESLHLGNLLGI  88



>ref|XP_005713019.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Chondrus 
crispus]
 emb|CDF33216.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Chondrus 
crispus]
Length=510

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 6/57 (11%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSE--NLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R N++++LE RGL ++ TS+   LR +C+     P+ VY GFDPTA+SLHLGNLL +
Sbjct  77   RPNIIDVLESRGLFDASTSDPDALRELCA----KPVGVYSGFDPTADSLHLGNLLAI  129



>ref|WP_039384881.1| tyrosyl-tRNA synthetase [Neochlamydia sp. TUME1]
 gb|KIC75964.1| Tyrosine--tRNA ligase [Neochlamydia sp. TUME1]
Length=424

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 4/50 (8%)
 Frame = +2

Query  476  VVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            ++E L ERG +E+ TS+ L+ I + P      VYCGFDPTA+SLHLG+L+
Sbjct  4    LIETLAERGFIEACTSDELKDILTQPT----KVYCGFDPTADSLHLGHLI  49



>gb|KIC73976.1| Tyrosine--tRNA ligase [Neochlamydia sp. EPS4]
Length=424

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 4/50 (8%)
 Frame = +2

Query  476  VVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            ++E L ERG +E+ TS+ L+ I + P      VYCGFDPTA+SLHLG+L+
Sbjct  4    LIETLAERGFIEACTSDELKDILTQPT----KVYCGFDPTADSLHLGHLI  49



>ref|WP_042240888.1| tyrosyl-tRNA synthetase [Neochlamydia sp. S13]
Length=424

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 4/50 (8%)
 Frame = +2

Query  476  VVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            ++E L ERG +E+ TS+ L+ I + P      VYCGFDPTA+SLHLG+L+
Sbjct  4    LIETLAERGFIEACTSDELKDILTQPT----KVYCGFDPTADSLHLGHLI  49



>gb|KIO28484.1| hypothetical protein M407DRAFT_230436 [Tulasnella calospora MUT 
4182]
Length=479

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +VV  L  RGL+   TS+NL  IC   N  P+ VYCG DP+A SLH+GNLL
Sbjct  26   SVVTELNSRGLVAQTTSQNLEKIC---NEQPITVYCGVDPSARSLHIGNLL  73



>ref|XP_001699082.1| hypothetical protein CHLREDRAFT_139405 [Chlamydomonas reinhardtii]
 gb|EDO98937.1| predicted protein [Chlamydomonas reinhardtii]
Length=492

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 4/56 (7%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVT-SENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R N+V +L  RGL++ VT +E L    +   L    VYCGFDPTA+SLHLGNLLG+
Sbjct  59   RPNIVSLLRARGLIQEVTNTEELERAAAAGRL---SVYCGFDPTADSLHLGNLLGI  111



>emb|CDZ80947.1| Tyrosine--tRNA ligase [Chlamydia sp. 'Rubis']
Length=419

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 40/54 (74%), Gaps = 3/54 (6%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            +NV+++L+ERGL+E++++E       D    P  +YCGFDPT++SLH+GNL+ +
Sbjct  2    QNVIDVLKERGLIETLSAEKE---MVDLLKKPTKIYCGFDPTSDSLHVGNLVAI  52



>ref|WP_013943141.1| tyrosyl-tRNA synthetase [Simkania negevensis]
 emb|CCB88674.1| tyrosyl-tRNA synthetase [Simkania negevensis Z]
Length=424

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
             V++ LE+RG +++++S+ LR     P    L +Y GFDPTA SLHLGNL+G+
Sbjct  3    TVIDALEKRGFIDAISSDELRERVKQP----LKLYIGFDPTANSLHLGNLVGI  51



>ref|XP_003075033.1| TyrS Tyrosyl-tRNA synthetase, probable (IC) [Ostreococcus tauri]
 emb|CAL52305.2| Aminoacyl-tRNA synthetase, class Ic [Ostreococcus tauri]
Length=488

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 3/53 (6%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            +++  L+ RGL +S T E   +  ++    PL VYCGFDPTA+SLHLGNLLG+
Sbjct  63   DLITTLKARGLFDSCTDE---TSLAEALQKPLKVYCGFDPTADSLHLGNLLGI  112



>dbj|BAK00149.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 1/45 (2%)
 Frame = +2

Query  500  GLLESVTSENL-RSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            GL+E+ TSE L  S  +      L VYCGFDPTAESLHLGNLLGL
Sbjct  58   GLVEATTSEALGSSSAASGEQQQLKVYCGFDPTAESLHLGNLLGL  102



>gb|ELL68304.1| tyrosyl-tRNA synthetase, partial [Salmonella enterica subsp. 
enterica serovar Enteritidis str. SE30663]
Length=78

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIKQLQERGLVAQVTDED--ALAERLAQGPVALYCGFDPTADSLHLGHLV  57



>ref|XP_002615773.1| hypothetical protein CLUG_04655 [Clavispora lusitaniae ATCC 42720]
 gb|EEQ40527.1| hypothetical protein CLUG_04655 [Clavispora lusitaniae ATCC 42720]
Length=524

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            ++V  L  R L+E++TS++L  I    N   L +YCG DPTAESLHLGNLL
Sbjct  59   SLVAHLYSRNLIETLTSDDLYKITEHGNKQKLKLYCGADPTAESLHLGNLL  109



>ref|WP_017492945.1| tyrosyl-tRNA synthetase [gamma proteobacterium WG36]
Length=424

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDEN--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>emb|CBX71308.1| hypothetical protein YEW_BZ08530 [Yersinia enterocolitica W22703]
Length=80

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_004157449.1| tyrosyl-tRNA synthetase [Erwinia amylovora]
 emb|CBJ46356.1| tyrosyl-tRNA synthetase [Erwinia amylovora ATCC 49946]
 emb|CBA20657.1| Tyrosyl-tRNA synthetase [Erwinia amylovora CFBP1430]
 gb|EKV54408.1| tyrosyl-tRNA synthetase [Erwinia amylovora ACW56400]
 emb|CCO78560.1| tyrosyl-tRNA synthetase [Erwinia amylovora Ea356]
 emb|CCO82355.1| tyrosyl-tRNA synthetase [Erwinia amylovora Ea266]
 emb|CCO86141.1| tyrosyl-tRNA synthetase [Erwinia amylovora CFBP 2585]
 emb|CCO89929.1| tyrosyl-tRNA synthetase [Erwinia amylovora 01SFR-BO]
 emb|CCO93686.1| tyrosyl-tRNA synthetase [Erwinia amylovora CFBP 1232]
 emb|CCO99038.1| tyrosyl-tRNA synthetase [Erwinia amylovora UPN527]
 emb|CDK15201.1| tyrosyl-tRNA synthetase [Erwinia amylovora LA635]
 emb|CDK18568.1| tyrosyl-tRNA synthetase [Erwinia amylovora LA636]
 emb|CDK21937.1| tyrosyl-tRNA synthetase [Erwinia amylovora LA637]
 dbj|GAJ88984.1| tyrosine--tRNA ligase [Erwinia amylovora NBRC 12687]
Length=425

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEN--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_004169729.1| tyrosyl-tRNA synthetase [Erwinia amylovora]
 emb|CCP03154.1| tyrosyl-tRNA synthetase [Erwinia amylovora Ea644]
 emb|CCP07154.1| tyrosyl-tRNA synthetase [Erwinia amylovora MR1]
Length=425

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEN--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>emb|CBX80578.1| Tyrosyl-tRNA synthetase [Erwinia amylovora ATCC BAA-2158]
Length=425

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEN--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_034913283.1| tyrosyl-tRNA synthetase [Gilliamella apicola]
Length=424

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +NV++ L+ERGL+  +T E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  4    KNVIKQLQERGLIAQLTDE--KALIEQIEQNPIALYCGFDPTADSLHLGHLV  53



>ref|WP_021016274.1| tyrosyl-tRNA synthetase [Serratia sp. ATCC 39006]
 gb|ESN62087.1| Tyrosine--tRNA ligase [Serratia sp. ATCC 39006]
Length=425

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEN--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|KDN09996.1| Tyrosyl-tRNA synthetase [Gilliamella apicola]
Length=423

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +NV++ L+ERGL+  +T E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  3    KNVIKQLQERGLIAQLTDE--KALIEQIEQNPIALYCGFDPTADSLHLGHLV  52



>ref|WP_012441522.1| tyrosyl-tRNA synthetase [Erwinia tasmaniensis]
 sp|B2VEN3.1|SYY_ERWT9 RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Erwinia tasmaniensis]
 emb|CAO96833.1| Tyrosyl-tRNA synthetase [Erwinia tasmaniensis Et1/99]
Length=425

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEN--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|XP_002548674.1| hypothetical protein CTRG_02971 [Candida tropicalis MYA-3404]
 gb|EER34153.1| hypothetical protein CTRG_02971 [Candida tropicalis MYA-3404]
Length=500

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 39/63 (62%), Gaps = 5/63 (8%)
 Frame = +2

Query  437  PEMESDQRQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLG  616
            PE  SD      +++E L+ R L+ES+T +NL  +    +     +YCG DPTAESLHLG
Sbjct  43   PETSSDT-----SLLEYLQSRHLVESITDDNLYKLTKRDSGQKFKLYCGADPTAESLHLG  97

Query  617  NLL  625
            NLL
Sbjct  98   NLL  100



>ref|WP_034948561.1| tyrosyl-tRNA synthetase [Gilliamella apicola]
Length=424

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +NV++ L+ERGL+  +T E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  4    KNVIKQLQERGLIAQLTDE--KALIEQIEQNPIALYCGFDPTADSLHLGHLV  53



>ref|WP_014544220.1| tyrosyl-tRNA synthetase [Erwinia sp. Ejp617]
 gb|ADP12525.1| tyrosyl-tRNA synthetase [Erwinia sp. Ejp617]
Length=424

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEN--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_012668183.1| tyrosyl-tRNA synthetase [Erwinia pyrifoliae]
 emb|CAX55658.1| Tyrosyl-tRNA synthetase [Erwinia pyrifoliae Ep1/96]
 emb|CAY74405.1| tyrS [Erwinia pyrifoliae DSM 12163]
Length=424

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEN--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|KFA58049.1| Tyrosyl-tRNA synthetase [Gilliamella apicola]
Length=423

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +NV++ L+ERGL+  +T E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  3    KNVIKQLQERGLIAQLTDE--KALIEQIEQNPIALYCGFDPTADSLHLGHLV  52



>ref|WP_023655005.1| tyrosyl-tRNA synthetase [Erwinia piriflorinigrans]
 emb|CCG87212.1| Tyrosyl-tRNA synthetase [Erwinia piriflorinigrans CFBP 5888]
Length=425

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEN--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_042393767.1| tyrosyl-tRNA synthetase [Escherichia vulneris]
 dbj|GAL59646.1| tyrosyl-tRNA synthetase [Escherichia vulneris NBRC 102420]
Length=424

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEN--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_013182397.1| tyrosyl-tRNA synthetase [Waddlia chondrophila]
 gb|ADI38686.1| Tyrosyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
 emb|CCB90919.1| tyrosyl-tRNA synthetase [Waddlia chondrophila 2032/99]
Length=427

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 4/53 (8%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            N++E L ERG +ESVT + L           + VYCGFDPT++SLHLGN++ +
Sbjct  3    NLLETLRERGFIESVTHDQLGDFLE----KQVHVYCGFDPTSDSLHLGNMVAI  51



>ref|WP_011411268.1| tyrosyl-tRNA synthetase [Sodalis glossinidius]
 sp|Q2NT02.1|SYY_SODGM RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Sodalis glossinidius str. 'morsitans']
 dbj|BAE74723.1| tyrosyl-tRNA synthase [Sodalis glossinidius str. 'morsitans']
Length=424

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--KALAERLAAGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_023306008.1| tyrosyl-tRNA synthetase [Enterobacter cloacae]
 gb|ESM17465.1| tyrosyl-tRNA synthetase [Enterobacter cloacae UCICRE 3]
 gb|EUL38073.1| tyrosyl-tRNA synthetase [Enterobacter cloacae UCI 50]
Length=424

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++     L P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDE--EALAERLALGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_032327767.1| tyrosyl-tRNA synthetase, partial [Shigella flexneri]
Length=81

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEE--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_044719105.1| tyrosyl-tRNA synthetase, partial [Escherichia coli]
Length=100

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEE--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_011146818.1| tyrosyl-tRNA synthetase [Photorhabdus luminescens]
 sp|Q7N3W6.1|SYY1_PHOLL RecName: Full=Tyrosine--tRNA ligase 1; AltName: Full=Tyrosyl-tRNA 
synthetase 1; Short=TyrRS 1 [Photorhabdus luminescens subsp. 
laumondii TTO1]
 emb|CAE14970.1| tyrosine-tRNA synthetase (tyrosine--tRNA ligase) (TYRRS) [Photorhabdus 
luminescens subsp. laumondii TTO1]
Length=424

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDEN--ALAERLAQGPVSLYCGFDPTADSLHLGHLV  53



>gb|EEP91904.1| Tyrosyl-tRNA synthetase [Yersinia kristensenii ATCC 33638]
Length=428

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIKQLQERGLVAQVTDEN--ALAERLAQGPISLYCGFDPTADSLHLGHLV  57



>ref|WP_042110692.1| tyrosyl-tRNA synthetase, partial [Escherichia coli]
Length=99

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEE--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_015834075.1| tyrosyl-tRNA synthetase [Photorhabdus asymbiotica]
 emb|CAQ84030.1| tyrosyl-tRNA synthetase 1 [Photorhabdus asymbiotica]
Length=424

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDEN--ALAERLAQGPVSLYCGFDPTADSLHLGHLV  53



>ref|WP_032819694.1| tyrosyl-tRNA synthetase [Yersinia kristensenii]
Length=424

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEN--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|XP_011429226.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial-like [Crassostrea 
gigas]
 gb|EKC31715.1| Putative tyrosyl-tRNA synthetase, mitochondrial [Crassostrea 
gigas]
Length=463

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            RNV++ L+ERG+++SV    L          PL +YCGFDPTA+SLH+GNLL +
Sbjct  28   RNVLK-LQERGVIQSVFPTTLTHEVEKQVGQPLTLYCGFDPTADSLHIGNLLAI  80



>ref|WP_040149889.1| tyrosyl-tRNA synthetase [Photorhabdus luminescens]
Length=424

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDEN--ALVERLAQGPVSLYCGFDPTADSLHLGHLV  53



>ref|WP_036805443.1| tyrosyl-tRNA synthetase [Photorhabdus luminescens]
 gb|KGM29532.1| tyrosyl-tRNA synthetase [Photorhabdus luminescens]
Length=424

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDEN--ALVERLAQGPVSLYCGFDPTADSLHLGHLV  53



>ref|WP_021325605.1| tyrosyl-tRNA synthetase [Photorhabdus temperata]
 gb|EQB99219.1| tyrosyl-tRNA ligase [Photorhabdus temperata subsp. temperata 
M1021]
Length=424

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDEN--ALVERLAQGPVSLYCGFDPTADSLHLGHLV  53



>ref|WP_034914572.1| tyrosyl-tRNA synthetase [Erwinia sp. 9145]
Length=424

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++ +     P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAARLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_023045582.1| tyrosyl-tRNA synthetase [Photorhabdus temperata]
 gb|ERT11703.1| tyrosyl-tRNA synthetase [Photorhabdus temperata J3]
 gb|KER02079.1| tyrosyl-tRNA synthetase [Photorhabdus temperata subsp. temperata 
Meg1]
Length=424

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDEN--ALVERLAQGPVSLYCGFDPTADSLHLGHLV  53



>ref|WP_017802198.1| tyrosyl-tRNA synthetase [Erwinia toletana]
Length=423

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 38/51 (75%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++ +     P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAARLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_044725469.1| tyrosyl-tRNA synthetase, partial [Escherichia coli]
Length=118

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDEE--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_025245619.1| tyrosyl-tRNA synthetase [Candidatus Sodalis pierantonius]
 gb|AHF74139.1| tyrosyl-tRNA synthetase [Candidatus Sodalis pierantonius str. 
SOPE]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--KALAERLVAGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_036849510.1| tyrosyl-tRNA synthetase [Photorhabdus temperata]
 gb|ETS30525.1| tyrosyl-tRNA synthetase [Photorhabdus temperata subsp. khanii 
NC19]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT EN  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDEN--ALVERLAQGPVSLYCGFDPTADSLHLGHLV  53



>ref|WP_009635941.1| tyrosyl-tRNA synthetase [Serratia sp. M24T3]
 gb|EIC85531.1| tyrosyl-tRNA synthetase [Serratia sp. M24T3]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--KALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_034370072.1| tyrosyl-tRNA synthetase [Dermabacter hominis]
 gb|KDS93960.1| tyrosyl-tRNA synthetase [Dermabacter hominis 1368]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNL  622
            N+V+ LE RGLL  V S  + +I +  N  P+ +YCGFDPTA SLH+G+L
Sbjct  3    NIVDELEWRGLL--VNSTGIEAIRTAANEGPIKLYCGFDPTASSLHVGHL  50



>ref|WP_014605927.1| MULTISPECIES: tyrosyl-tRNA synthetase [Pantoea]
 gb|AER32844.1| tyrosyl-tRNA synthetase TyrS [Pantoea ananatis PA13]
 emb|CCF09819.1| Tyrosyl-tRNA synthetase [Pantoea ananatis LMG 5342]
 gb|ERM14597.1| tyrosyl-tRNA synthetase [Pantoea ananatis BRT175]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALVEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_033782985.1| tyrosyl-tRNA synthetase [Pantoea sp. 9140]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALTEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_016662951.1| tyrosyl-tRNA synthetase [Dermabacter sp. HFH0086]
 gb|EPH18147.1| tyrosine-tRNA ligase [Dermabacter sp. HFH0086]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 35/50 (70%), Gaps = 2/50 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNL  622
            N+V+ LE RGLL  V S  + +I +  N  P+ +YCGFDPTA SLH+G+L
Sbjct  3    NIVDELEWRGLL--VNSTGIEAIRTAANEGPIKLYCGFDPTASSLHVGHL  50



>ref|WP_028722225.1| tyrosyl-tRNA synthetase [Pantoea ananatis]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALVEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_013357760.1| tyrosyl-tRNA synthetase [Pantoea vagans]
 gb|ADO09416.1| Tyrosyl-tRNA synthetase [Pantoea vagans C9-1]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALTEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_033741218.1| tyrosyl-tRNA synthetase [Pantoea stewartii]
 gb|KGD82555.1| tyrosyl-tRNA synthetase [Pantoea stewartii subsp. indologenes]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALVEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_033732557.1| tyrosyl-tRNA synthetase [Pantoea vagans]
 gb|KGD77945.1| tyrosyl-tRNA synthetase [Pantoea vagans]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALTEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_031377358.1| tyrosyl-tRNA synthetase [Pantoea sp. 3.5.1]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALTEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_039340530.1| tyrosyl-tRNA synthetase [Pantoea stewartii]
 gb|KHE02197.1| tyrosyl-tRNA synthetase [Pantoea stewartii]
 gb|KHN61820.1| tyrosyl-tRNA synthetase [Pantoea stewartii]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALVEKLAQGPISLYCGFDPTADSLHLGHLV  53



>gb|KGL54482.1| tyrosyl-tRNA synthetase [Pantoea ananatis]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALVEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_033786227.1| tyrosyl-tRNA synthetase [Pantoea agglomerans]
 gb|EZI34658.1| Tyrosine--tRNA ligase [Pantoea agglomerans]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALTEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_006119012.1| tyrosyl-tRNA synthetase [Pantoea stewartii]
 gb|EHU00885.1| tyrosyl-tRNA synthetase [Pantoea stewartii subsp. stewartii DC283]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALVEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_044818191.1| tyrosyl-tRNA synthetase, partial [Escherichia coli]
Length=151

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIKQLQERGLVAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  57



>ref|WP_032098097.1| MULTISPECIES: tyrosyl-tRNA synthetase [Morganella]
 gb|ETO43966.1| tyrosyl-tRNA synthetase [Morganella sp. EGD-HP17]
 emb|CDK63960.1| Tyrosyl-tRNA synthetase [Morganella morganii IS15]
 gb|KGZ28049.1| tyrosyl-tRNA synthetase [Morganella morganii]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDE--KALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_004235488.1| tyrosyl-tRNA synthetase [Morganella morganii]
 ref|YP_007505801.1| Tyrosyl-tRNA synthetase [Morganella morganii subsp. morganii 
KT]
 gb|AGG31428.1| Tyrosyl-tRNA synthetase [Morganella morganii subsp. morganii 
KT]
 gb|EMP53252.1| Tyrosyl-tRNA synthetase [Morganella morganii SC01]
 gb|KGP44670.1| tyrosyl-tRNA synthetase [Morganella morganii]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDE--KALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_000168619.1| tyrosyl-tRNA synthetase, partial [Salmonella enterica]
 gb|EGA29775.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2009159199]
Length=205

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_010245429.1| MULTISPECIES: tyrosyl-tRNA synthetase [Pantoea]
 gb|ERM07112.1| tyrosyl-tRNA synthetase [Pantoea agglomerans Tx10]
 gb|KEY43120.1| tyrosyl-tRNA ligase [Pantoea agglomerans]
 gb|KFL59177.1| tyrosyl-tRNA synthetase [Pantoea agglomerans]
 gb|KGD80562.1| tyrosyl-tRNA synthetase [Pantoea agglomerans]
 gb|KIC85224.1| tyrosyl-tRNA synthetase [Pantoea agglomerans]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDED--ALTEKLAQGPISLYCGFDPTADSLHLGHLV  53



>gb|ADD76942.1| TyrS [Pantoea ananatis LMG 20103]
 dbj|BAK11195.1| tyrosyl-tRNA synthetase TyrS [Pantoea ananatis AJ13355]
Length=438

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  19   NLIQQLQERGLIAQVTDED--ALVEKLAQGPISLYCGFDPTADSLHLGHLV  67



>ref|WP_025422217.1| tyrosyl-tRNA synthetase [Sodalis sp. HS1]
 gb|AHF77083.1| Tyrosyl-tRNA synthetase [Sodalis sp. HS1]
Length=424

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDET--ALAERLAAGPIALYCGFDPTADSLHLGHLV  53



>gb|KDA95769.1| tyrosyl-tRNA synthetase [Pantoea agglomerans Eh318]
Length=438

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  19   NLIQQLQERGLIAQVTDED--ALTEKLAQGPISLYCGFDPTADSLHLGHLV  67



>gb|ADI18056.1| tyrosyl-tRNA synthetase [uncultured actinobacterium HF0200_20K23]
Length=422

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            +++  LE RGL+   T  +  ++ S     P+ +YCGFDPTA+SLH+GNL+GL
Sbjct  2    DILSDLEARGLIHDTTDRD--ALASRLAAGPITLYCGFDPTADSLHVGNLIGL  52



>ref|WP_034883707.1| tyrosyl-tRNA synthetase [Gilliamella apicola]
Length=424

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +NV++ L+ERGL+  +T E       + N  P+ +YCGFDPTA+SLHLG+L+
Sbjct  4    KNVIKQLQERGLIAQLTDEKALMELIEQN--PIALYCGFDPTADSLHLGHLV  53



>ref|WP_000168630.1| tyrosyl-tRNA synthetase, partial [Escherichia coli]
Length=164

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|KES17804.1| Tyrosyl-tRNA synthetase [Gilliamella apicola SCGC AB-598-I20]
Length=423

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +NV++ L+ERGL+  +T E       + N  P+ +YCGFDPTA+SLHLG+L+
Sbjct  3    KNVIKQLQERGLIAQLTDEKALMELIEQN--PIALYCGFDPTADSLHLGHLV  52



>ref|WP_041027995.1| tyrosyl-tRNA synthetase, partial [Salmonella enterica]
Length=192

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPVALYCGFDPTADSLHLGHLV  53



>ref|WP_027273256.1| tyrosyl-tRNA synthetase [Leminorella grimontii]
 gb|KFC96090.1| tyrosyl-tRNA synthetase [Leminorella grimontii ATCC 33999 = DSM 
5078]
Length=423

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +N++E L+ERGL+  +T E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  3    KNLIEQLQERGLVAQLTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  52



>emb|CDS06680.1| hypothetical protein LRAMOSA09207 [Absidia idahoensis var. thermophila]
Length=472

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 38/58 (66%), Gaps = 8/58 (14%)
 Frame = +2

Query  464  RRRNVVEILEERGLLESVTSENL--RSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R RNVVE + +RGLL  +TS +L  R+  S        +YCG DPTA+SLHLGNL+ L
Sbjct  30   RSRNVVEEMTDRGLLAQITSPDLLRRTETSTS------IYCGVDPTAKSLHLGNLVTL  81



>gb|EFP56700.1| tyrosine--tRNA ligase [Dermacoccus sp. Ellin185]
Length=433

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 4/62 (6%)
 Frame = +2

Query  449  SDQRQRRRNVVEILEERGLLESVTSEN-LRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            SD+R    N+++ L+ RG +   T E  LR   ++    PL VYCGFDPTA SLH GNL+
Sbjct  8    SDERDDVSNILDELQWRGAVAQTTDETQLRDALANG---PLTVYCGFDPTAPSLHFGNLV  64

Query  626  GL  631
             L
Sbjct  65   QL  66



>ref|WP_044652136.1| tyrosyl-tRNA synthetase, partial [Klebsiella variicola]
Length=183

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|AHS60148.1| hypothetical protein AU67_10290, partial [Salmonella enterica 
subsp. enterica serovar Enteritidis str. SA20085285]
Length=200

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPVALYCGFDPTADSLHLGHLV  53



>ref|WP_008813567.1| MULTISPECIES: tyrosyl-tRNA synthetase [Hafnia]
 gb|EFV41308.1| tyrosyl-tRNA synthetase [Enterobacteriaceae bacterium 9_2_54FAA]
 gb|KFC87137.1| tyrosyl-tRNA synthetase [Hafnia alvei ATCC 13337]
 gb|KHS47433.1| tyrosyl-tRNA synthetase [Hafnia paralvei]
 gb|AJQ99330.1| Tyrosyl-tRNA synthetase [Enterobacteriaceae bacterium bta3-1]
Length=424

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       PL +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDE--EALAERLAQGPLALYCGFDPTADSLHLGHLV  53



>ref|WP_025801054.1| tyrosyl-tRNA synthetase [Hafnia alvei]
 gb|AIU72925.1| tyrosyl-tRNA synthetase [Hafnia alvei FB1]
 gb|KID04909.1| tyrosyl-tRNA synthetase [Hafnia alvei]
 gb|KID05414.1| tyrosyl-tRNA synthetase [Hafnia alvei]
Length=424

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       PL +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDE--EALAERLAQGPLALYCGFDPTADSLHLGHLV  53



>gb|EHM39809.1| tyrosine--tRNA ligase [Hafnia alvei ATCC 51873]
Length=428

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       PL +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIKQLQERGLIAQVTDE--EALAERLAQGPLALYCGFDPTADSLHLGHLV  57



>ref|WP_014354199.1| tyrosyl-tRNA synthetase [Wigglesworthia glossinidia]
 gb|AFA41260.1| tyrosyl-tRNA synthetase [Wigglesworthia glossinidia endosymbiont 
of Glossina morsitans morsitans (Yale colony)]
Length=429

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 4/54 (7%)
 Frame = +2

Query  467  RRNVVEILEERGLLESVTSE-NLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            R N+++ L  RGL++ +T E NL+    +     + +YCGFDPTAESLH+G+L+
Sbjct  2    RTNIIQELYNRGLIKKLTDEINLKKTVQEK---KIHIYCGFDPTAESLHIGHLI  52



>ref|WP_013201954.1| tyrosyl-tRNA synthetase [Erwinia billingiae]
 emb|CAX59464.1| Tyrosyl-tRNA synthetase [Erwinia billingiae Eb661]
Length=424

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_034862023.1| tyrosyl-tRNA synthetase [Enterobacteriaceae bacterium B14]
Length=424

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|KEP73662.1| tyrosyl-tRNA synthetase, partial [Microbacterium sp. SUBG005]
Length=183

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_027725608.1| tyrosyl-tRNA synthetase [Tuberibacillus calidus]
Length=418

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N++E LE RGLL  VT    R    +    P+ +YCGFDPTA+SLH+GNLL
Sbjct  2    NILEDLEYRGLLFQVTD---RKGLEEALSKPIALYCGFDPTADSLHVGNLL  49



>ref|WP_026059022.1| tyrosyl-tRNA synthetase [Enterobacteriaceae bacterium LSJC7]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>emb|CCG82830.1| Tyrosyl-tRNA synthetase,mitochondrial [Taphrina deformans PYCC 
5710]
Length=484

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 3/58 (5%)
 Frame = +2

Query  458  RQRRRNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLLGL  631
            R+    +V  L+ERGL++++TS  L  I ++    P+ +YCG DPTA SLH+GNLL L
Sbjct  21   RRSNTTLVSALQERGLVKTITSPQL-GIAAEK--APISLYCGVDPTAASLHVGNLLTL  75



>gb|AJA45898.1| tyrosyl-tRNA synthetase [Frischella perrara]
Length=423

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +V++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  4    DVIKQLQERGLIAQVTDET--ALTEQIMQGPIALYCGFDPTADSLHLGHLV  52



>ref|WP_023212222.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|ESG09162.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Panama str. ATCC 7378]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_039105903.1| tyrosyl-tRNA synthetase [Frischella perrara]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +V++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    DVIKQLQERGLIAQVTDET--ALTEQIMQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_020844165.1| tyrosyl-tRNA synthetase [Salmonella bongori]
 gb|AGR58650.1| Tyrosyl-tRNA synthetase [Salmonella bongori N268-08]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_038027353.1| tyrosyl-tRNA synthetase [Tatumella saanichensis]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--KALSERLAEGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_038626278.1| tyrosyl-tRNA synthetase [Pantoea sp. PSNIH2]
 gb|AIX73849.1| tyrosyl-tRNA synthetase [Pantoea sp. PSNIH2]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_034895231.1| tyrosyl-tRNA synthetase [Erwinia typographi]
 gb|KGT91585.1| tyrosyl-tRNA synthetase [Erwinia typographi]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|EHC64013.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Johannesburg str. S5-703]
Length=370

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  57



>ref|WP_023490182.1| tyrosyl-tRNA synthetase [Serratia sp. DD3]
 gb|KEY58015.1| tyrosine--tRNA ligase [Serratia sp. DD3]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_039057179.1| tyrosyl-tRNA synthetase, partial [Shigella flexneri]
Length=188

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_008915525.1| tyrosyl-tRNA synthetase [Providencia sneebia]
 gb|EKT57415.1| tyrosyl-tRNA ligase [Providencia sneebia DSM 19967]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_034791103.1| tyrosyl-tRNA synthetase [Ewingella americana]
 gb|KFC80697.1| tyrosyl-tRNA synthetase [Ewingella americana ATCC 33852]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E  +++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDE--QALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_009090365.1| tyrosyl-tRNA synthetase [Pantoea sp. Sc1]
 gb|EIB98904.1| tyrosyl-tRNA synthetase [Pantoea sp. Sc1]
Length=424

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--EALTEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_016582918.1| tyrosyl-tRNA synthetase, partial [Yersinia pestis]
Length=198

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_000168620.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|EDZ33578.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Hadar str. RI_05P066]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_013508892.1| tyrosyl-tRNA synthetase [Pantoea sp. At-9b]
 gb|ADU69035.1| tyrosyl-tRNA synthetase [Pantoea sp. At-9b]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_021185208.1| tyrosyl-tRNA synthetase [Pantoea sp. AS-PWVM4]
 gb|ERK10253.1| Tyrosyl-tRNA synthetase [Pantoea sp. AS-PWVM4]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_023223722.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|ESG87509.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. ATCC 9263]
Length=419

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_017348953.1| tyrosyl-tRNA synthetase [Pantoea sp. A4]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_015840590.1| tyrosyl-tRNA synthetase [Pectobacterium carotovorum]
 sp|C6DK25.1|SYY_PECCP RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Pectobacterium carotovorum subsp. 
carotovorum PC1]
 gb|ACT13408.1| tyrosyl-tRNA synthetase [Pectobacterium carotovorum subsp. carotovorum 
PC1]
Length=425

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLIAQVTDEG--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_031621900.1| tyrosyl-tRNA synthetase, partial [Salmonella enterica]
 gb|EYH96164.1| tyrosyl-tRNA ligase, partial [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N653]
Length=357

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|ESG44513.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Mbandaka str. ATCC 51958]
Length=419

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_040075905.1| tyrosyl-tRNA synthetase [Enterobacteriaceae bacterium ATCC 29904]
 gb|KGB00709.1| tyrosine--tRNA ligase [Enterobacteriaceae bacterium ATCC 29904]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++ S     P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDE--EALASLLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_000168624.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|EHC78978.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. S5-403]
Length=437

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_023220918.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|ESG50668.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Muenchen str. baa1674]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_033789864.1| tyrosyl-tRNA synthetase [Pantoea sp. FF5]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_033747414.1| tyrosyl-tRNA synthetase [Pantoea sp. NGS-ED-1003]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_023195535.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|ESE94330.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Worthington str. ATCC 9607]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_016505353.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|EPE48321.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. GXS2268]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|EHC57554.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Inverness str. R8-3668]
Length=428

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  57



>ref|WP_042844016.1| tyrosyl-tRNA synthetase [Providencia rettgeri]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_034947778.1| tyrosyl-tRNA synthetase [Erwinia oleae]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAVRLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_032114939.1| tyrosyl-tRNA synthetase [Arsenophonus endosymbiont of Nilaparvata 
lugens]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 38/52 (73%), Gaps = 2/52 (4%)
 Frame = +2

Query  470  RNVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            +N++E L+ERGL+  +T E  +++    +   + +YCGFDPTA+SLHLG+L+
Sbjct  4    KNLIEQLQERGLIAQLTDE--KALIEKLSQGSVALYCGFDPTADSLHLGHLV  53



>ref|WP_037399671.1| MULTISPECIES: tyrosyl-tRNA synthetase [Serratia]
 gb|KFK94720.1| tyrosyl-tRNA synthetase [Serratia sp. Ag2]
 gb|KFK99120.1| tyrosyl-tRNA synthetase [Serratia sp. Ag1]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_031625199.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|KDQ94701.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. FVM_628064]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_023198307.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|ESF16450.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. SARA13]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_019209911.1| tyrosyl-tRNA synthetase [Yersinia massiliensis]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_000168626.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 ref|NP_456081.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhi str. CT18]
 ref|NP_460412.1| tyrosine--tRNA ligase [Salmonella enterica subsp. enterica serovar 
Typhimurium str. LT2]
 ref|NP_805118.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhi str. Ty2]
 ref|YP_150657.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. ATCC 9150]
 ref|YP_001588098.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. SPB7]
 ref|YP_002040698.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. SL254]
 ref|YP_002045487.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SL476]
 ref|YP_002114461.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Schwarzengrund str. CVM19633]
 ref|YP_002146596.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. SL483]
 ref|YP_002142143.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. AKU_12601]
 ref|YP_002215685.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Dublin str. CT_02021853]
 ref|YP_005237319.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 14028S]
 ref|YP_006087696.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. B182]
 ref|YP_006886058.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Weltevreden str. 2007-60-3289-1]
 sp|Q57PI8.1|SYY_SALCH RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
 sp|Q5PIK7.1|SYY_SALPA RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. ATCC 9150]
 sp|Q7CQK7.1|SYY_SALTY RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Typhimurium str. LT2]
 sp|Q8XG70.1|SYY_SALTI RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Typhi]
 sp|A9N034.1|SYY_SALPB RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. SPB7]
 sp|B5F6J8.1|SYY_SALA4 RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Agona str. SL483]
 sp|B5FIF4.1|SYY_SALDC RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Dublin str. CT_02021853]
 sp|B5RAL0.1|SYY_SALG2 RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Gallinarum str. 287/91]
 sp|B4THC6.1|SYY_SALHS RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SL476]
 sp|B4T586.1|SYY_SALNS RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Newport str. SL254]
 sp|B5BKC0.1|SYY_SALPK RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. AKU_12601]
 sp|B4TV08.1|SYY_SALSV RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Schwarzengrund str. CVM19633]
 pir||AE0693 tyrosyl-tRNA synthetase [imported] - Salmonella enterica subsp. 
enterica serovar Typhi (strain CT18)
 gb|AAL20371.1| tyrosine tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. LT2]
 emb|CAD01918.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhi str. CT18]
 gb|AAO68967.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhi str. Ty2]
 gb|AAV77345.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. ATCC 9150]
 gb|AAX65373.1| tyrosine tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
 gb|ABX67265.1| hypothetical protein SPAB_01872 [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. SPB7]
 gb|ACF62680.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. SL254]
 gb|ACF66560.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SL476]
 gb|EDX44552.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. CVM29188]
 gb|ACF90235.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Schwarzengrund str. CVM19633]
 gb|EDX52884.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. SL317]
 emb|CAR59479.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. AKU_12601]
 gb|ACH49793.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. SL483]
 gb|EDY22503.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Saintpaul str. SARA23]
 gb|EDY30519.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Schwarzengrund str. SL480]
 gb|ACH76765.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Dublin str. CT_02021853]
 gb|EDZ08450.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Javiana str. GA_MM04042433]
 emb|CAR37528.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Gallinarum str. 287/91]
 gb|EDZ11435.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Saintpaul str. SARA29]
 gb|EDZ14605.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar 4,[5],12:i:- str. CVM23701]
 gb|EDZ22222.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. CDC 191]
 gb|EDZ26009.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SL486]
 gb|EDZ30429.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Weltevreden str. HI_N05-537]
 gb|ACY88223.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 14028S]
 emb|CBW17477.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. SL1344]
 dbj|BAJ36406.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. T000240]
 emb|CBY95849.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Weltevreden str. 2007-60-3289-1]
 gb|EFX49130.1| Tyrosyl-tRNA synthetase ; cluster 1 [Salmonella enterica subsp. 
enterica serovar Typhimurium str. TN061786]
 gb|EFY11994.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 315996572]
 gb|EFY16010.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 495297-1]
 gb|EFY19067.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 495297-3]
 gb|EFY24534.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 495297-4]
 gb|EFY29655.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 515920-1]
 gb|EFY33301.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 515920-2]
 gb|EFY37851.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 531954]
 gb|EFY41389.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. NC_MB110209-0054]
 gb|EFY46722.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. OH_2009072675]
 gb|EFY52182.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CASC_09SCPH15965]
 gb|EFY56447.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 19N]
 gb|EFY61415.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 81038-01]
 gb|EFY65632.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. MD_MDA09249507]
 gb|EFY69512.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 414877]
 gb|EFY73402.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 366867]
 gb|EFY76038.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 413180]
 gb|EFZ79274.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 609458-1]
 gb|EFZ83658.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 556150-1]
 gb|EFZ87919.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 609460]
 gb|EFZ95185.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 556152]
 gb|EGA00596.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. MB101509-0077]
 gb|EGA07721.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. MB102109-0047]
 gb|EGA09398.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. MB110209-0055]
 gb|EGA13505.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. MB111609-0052]
 gb|EGA20953.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 2009083312]
 gb|EGA24401.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 2009085258]
 gb|EGA26675.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 315731156]
 gb|EGA36277.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008282]
 gb|EGA43979.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008284]
 gb|EGA50709.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008285]
 gb|EGA56148.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008287]
 gb|EGE29777.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Dublin str. SD3246]
 gb|AEF07317.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. UK-1]
 gb|EHL33315.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. ATCC BAA710]
 gb|EHL37852.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. SARB31]
 gb|EHL49626.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 29N]
 gb|EHL50033.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. SARB30]
 gb|EHL57810.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 4441 H]
 gb|EHL58084.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 42N]
 gb|EHN19943.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 80959-06]
 gb|EHN23777.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CT_02035318]
 gb|EHN35687.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CT_02035320]
 gb|EHN38722.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CT_02035321]
 gb|EHN41027.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CT_02035327]
 gb|EHN45609.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Pomona str. ATCC 10729]
 gb|EHP18235.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. IA_2010008286]
 gb|AEZ45109.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhi str. P-stx-12]
 emb|CCF86858.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. SS209]
 gb|EIC37546.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41579]
 gb|EIC44460.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41563]
 gb|EIC45759.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41573]
 gb|EIC48928.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41566]
 gb|EIC56708.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41565]
 gb|AFH45422.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. B182]
 gb|EIX01486.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. Levine 1]
 gb|EIX01750.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. Levine 15]
 gb|EIZ87873.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 35199]
 gb|EIZ98334.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 35185]
 gb|EJA03828.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 33953]
 gb|EJA06032.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 21559]
 gb|EJA06557.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 35188]
 gb|EJA19699.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 19447]
 gb|EJA21855.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 19567]
 gb|EJA26008.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 19449]
 gb|EJA31061.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 22513]
 gb|EJA32359.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 21550]
 gb|EJA36378.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 35202]
 gb|EJA45467.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 21538]
 gb|EJA48943.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 22425]
 gb|EJA53046.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM N18486]
 gb|EJA61260.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM N1543]
 gb|EJA66217.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 19443]
 gb|EJA67480.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 21554]
 gb|EJA76467.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 37978]
 gb|EJA77192.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 19593]
 gb|EJA88500.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 19536]
 gb|EJI81905.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Enteritidis str. 58-6482]
 gb|EJW24047.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. CFSAN00325]
 gb|EJW26458.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. CFSAN00326]
 gb|EJW31220.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. CFSAN00322]
 gb|EJW35273.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. CFSAN00328]
 gb|EKT03672.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm1]
 gb|EKT04220.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm8]
 gb|EKT05470.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Typhimurium str. STm2]
 gb|EKT17445.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm9]
 gb|EKT18462.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm3]
 gb|EKT22065.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm4]
 gb|EKT31123.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm10]
 gb|EKT32496.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm6]
 gb|EKT36663.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm11]
 gb|EKT41990.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm12]
 gb|EKT46573.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm5]
 gb|ELO82539.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Enteritidis str. SARB17]
 gb|ELP11692.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. SH10GFN094]
 gb|ELP16204.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. SH11G1113]
 gb|ELP17575.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. SH08SF124]
 gb|ELX23654.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar 4,[5],12:i:- str. 08-1700]
 gb|ELX24330.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar 4,[5],12:i:- str. 08-1739]
 gb|ELX31155.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Rissen str. 150]
 gb|ELX42697.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 29439]
 gb|ELX44085.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. CDC_2009K1153]
 gb|ELX44234.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Javiana str. ATCC BAA-1593]
 gb|ELX50759.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. LT2-4_delta.ramA::kan]
 gb|ELX53697.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 316111868]
 gb|ELX53946.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Tennessee str. 4535]
 gb|ELX58939.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. LT2-4]
 gb|ELX74707.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Dublin str. SL1438]
 gb|ELX78606.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Gallinarum str. 9184]
 gb|ELX82581.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Dublin str. HWS51]
 gb|EMG70698.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Newport str. Shandong_3]
 gb|EMG71565.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Newport str. Henan_3]
 gb|EMG72168.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Newport str. SH111077]
 gb|EMG79404.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Newport str. JS09102]
 gb|AGK08326.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Typhimurium str. U288]
 emb|CCQ99968.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 73.H.09]
 emb|CCR04161.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 72.A.52]
 emb|CCR09167.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 71.E.05]
 emb|CCR13783.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 70.E.05]
 emb|CCR17637.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 69.H.06]
 emb|CCR22620.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 68.U.05]
 emb|CCR27297.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 66.F.99]
 emb|CCR31946.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 65.H.72]
 emb|CCR37174.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 64.H.00]
 emb|CCR41835.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 63.H.87]
 emb|CCR46037.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 62.H.72]
 emb|CCR50984.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 61.O.08]
 emb|CCR55205.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 60.O.08]
 emb|CCR60374.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 59.F.08]
 emb|CCR64799.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 58.E.08]
 emb|CCR69455.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 56.O.08]
 emb|CCR74069.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 55.U.08]
 emb|CCR78613.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 54.O.08]
 emb|CCR83163.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 53.F.08]
 emb|CCR88119.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 52.F.08]
 emb|CCR91683.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 51.E.09]
 emb|CCR97133.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 50.E.08]
 emb|CCS01776.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 48.E.08]
 emb|CCS05536.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 46.E.09]
 emb|CCT77520.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 08.A.05]
 emb|CCT81575.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 07.O.05]
 emb|CCT86337.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 06.O.05]
 emb|CCT91126.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 05.O.06]
 emb|CCT95750.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 04.O.05]
 emb|CCU00420.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 03.O.05]
 emb|CCU04970.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 02.O.05]
 emb|CCU09940.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 01.O.05]
 emb|CCU15180.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 10.A.05]
 emb|CCU19909.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 67.H.09]
 emb|CCU26941.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 57.A.08]
 emb|CCU29385.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 49.E.09]
 emb|CCU36502.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 39.O.03]
 emb|CCU38048.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 30.H.04]
 emb|CCU45776.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 26.F.98]
 emb|CCU51420.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 16.H.08]
 gb|AGK66910.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhi str. Ty21a]
 emb|CCS14083.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 45.E.09]
 emb|CCS18558.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 44.E.09]
 emb|CCS20070.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 43.E.09]
 emb|CCS27680.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 42.E.09]
 emb|CCS29240.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 40.E.08]
 emb|CCS36927.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 41.E.09]
 emb|CCS38171.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 38.O.03]
 emb|CCS42303.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 37.F.02]
 emb|CCS47731.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 36.H.00]
 emb|CCS52257.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 35.H.08]
 emb|CCS57086.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 34.H.09]
 emb|CCS61034.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 33.A.05]
 emb|CCS66186.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 32.A.00]
 emb|CCS70984.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 31.H.09]
 emb|CCS74987.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 29.O.08]
 emb|CCS79390.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 28.O.08]
 emb|CCS84011.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 27.O.98]
 emb|CCS89161.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 24.H.04]
 emb|CCS93533.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 23.F.01]
 emb|CCS98230.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 22.H.04]
 emb|CCT02956.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 21.H.10]
 emb|CCT08023.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 20.H.06]
 emb|CCT12160.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 19.F.03]
 emb|CCT17051.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 18.H.07]
 emb|CCT21686.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 17.H.06]
 emb|CCT30924.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 15.H.03]
 emb|CCT36009.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 14.E.05]
 emb|CCT40966.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 13.E.05]
 emb|CCT45540.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 12.A.06]
 emb|CCT50015.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 11.A.05]
 emb|CCT54780.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 09.F.08]
 gb|EPE47322.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. JX05-19]
 gb|EPE50177.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. GZ9A00052]
 gb|EPE56587.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. ZJ98-53]
 gb|EPE58978.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. YN09620]
 gb|AGQ64884.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. 41578]
 gb|AGQ76514.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CFSAN002069]
 gb|AGQ68006.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium var. 5- str. CFSAN001921]
 gb|AGQ59253.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000189]
 gb|AGQ73079.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cubana str. CFSAN002050]
 gb|AGQ86006.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar 4,[5],12:i:- str. 08-1736]
 gb|EQA24415.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. STm7]
 emb|CDF53662.1| hypothetical protein BN855_14850 [Salmonella enterica subsp. 
enterica serovar Bovismorbificans str. 3114]
 gb|ERF88491.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. SARA33]
 gb|ERG01714.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Muenchen str. RKS4129]
 emb|CCW74131.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. DT104]
 gb|AGX10471.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Thompson str. RM6836]
 emb|CCU68394.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 47.E.09]
 emb|CDG07537.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. DT2]
 gb|ERN64058.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 13562]
 gb|ERN64901.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 29166]
 gb|ERN66451.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 22694]
 gb|ERN77062.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. N312]
 gb|ERN87625.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 20793]
 gb|ERN90900.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. CDC_2009K1288]
 gb|ERN94071.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. CDC_2009K1158]
 gb|ERN98619.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. CDC_2009K1283]
 gb|ERO09104.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. #11-4]
 gb|ERO10070.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. CDC_2009K1277]
 gb|ERO12489.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. #11-3]
 gb|ERO16034.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. #11-2]
 gb|ERO20712.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 36618]
 gb|ERO23060.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 35423]
 gb|ERO27579.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 34502]
 gb|ESB04367.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 460004 2-1]
 gb|ESB05263.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 311387-1]
 gb|ESB07373.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 339787]
 gb|ESB18638.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 447967 2-1]
 gb|ESB29189.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 460004 1-1]
 gb|ESB29587.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 447967 1-1]
 gb|ESB32036.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 409753-6]
 gb|ESB37468.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 442692 2-4]
 gb|ESB41900.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 442692 2-5]
 gb|ESB48414.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 620239]
 gb|ESB48846.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 467481]
 gb|ESB53881.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 557928]
 gb|ESB62405.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Muenster str. 660]
 gb|ESB65571.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 432613]
 gb|ESB69142.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 266757-1]
 gb|ESB79701.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. SA-4]
 gb|ESB83664.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. SA-5]
 gb|ESB86169.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. ATCC BAA-707]
 gb|ESB86380.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. 637564_17]
 gb|ESB97233.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. 361154004]
 gb|ESB99416.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. SARA61]
 gb|ESC01640.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. 423984-1]
 gb|ESC06256.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Saintpaul str. 9712]
 gb|ESC14519.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 0253]
 gb|ESC24511.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 0322]
 gb|ESC28354.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 0292]
 gb|ESC33295.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. SA-1]
 gb|ESC36436.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. SA-3]
 gb|ESC37058.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. SA-2]
 gb|ESC40702.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. RI_10P079]
 gb|ESC46269.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. RI_10P078]
 gb|ESC52761.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. RI_10P068]
 gb|ESC52929.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. RI_10P069]
 gb|ESC60627.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. WA_14885]
 gb|ESC65321.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. WA_14900]
 gb|ESC69405.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. WA_14881]
 gb|ESC70871.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. WA_14882]
 gb|ESC72592.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. VA_R100512572]
 gb|ESC83621.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. VA_R100512570]
 gb|ESC84563.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. NC_MB012510-0038]
 gb|ESE44700.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 24390]
 gb|ESE45019.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 82-2052]
 gb|ESE53253.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. SARA35]
 gb|ESE64359.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. AZ 057]
 gb|ESE70080.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. ST4581]
 gb|ESE72912.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. SARA62]
 gb|ESE74087.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Saintpaul str. SARA26]
 gb|ESF05931.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Muenchen str. ATCC 8388]
 gb|ESF12561.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Thompson str. ATCC 8391]
 gb|ESF19175.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Urbana str. ATCC 9261]
 gb|ESF29713.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Tallahassee str. 0012]
 gb|ESF35128.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. ATCC 8400]
 gb|ESF42459.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Tennessee str. TXSC_TXSC08-21]
 gb|ESF43641.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Sloterdijk str. ATCC 15791]
 gb|ESF45690.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. ATCC 43845]
 gb|ESF51122.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Senftenberg str. 604314]
 gb|ESF54155.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Stanley str. ATCC 7308]
 gb|ESF56396.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Saintpaul str. JO2008]
 gb|ESF65078.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. SARA42]
 gb|ESF66772.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Rubislaw str. ATCC 10717]
 gb|ESF78357.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. ATCC 19940]
 gb|ESF78734.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Soerenga str. 695]
 gb|ESF87496.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. ATCC 8759]
 gb|ESF88247.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. ATCC 10719]
 gb|ESF90266.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. ATCC BAA-1585]
 gb|ESG00626.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A str. ATCC 11511]
 gb|ESG17686.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Oranienburg str. 701]
 gb|ESG18557.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Poona str. ATCC BAA-1673]
 gb|ESG20796.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Oranienburg str. 0250]
 gb|ESG24713.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Meleagridis str. 0047]
 gb|ESG33580.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Minnesota str. ATCC 49284]
 gb|ESG37640.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. 423984-2]
 gb|ESG38409.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 8387]
 gb|ESG44410.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Miami str. 1923]
 gb|ESG52165.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Senftenberg str. 316235162]
 gb|ESG63690.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Muenster str. 420]
 gb|ESG66415.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Muenster str. 0315]
 gb|ESG75127.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Muenchen str. baa1594]
 gb|ESG78091.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Kentucky str. 5349]
 gb|ESG83045.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Javiana str. 10721]
 gb|ESG92624.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Inverness str. ATCC 10720]
 gb|ESG96394.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Javiana str. PRS_2010_0720]
 gb|ESG96927.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Indiana str. ATCC 51959]
 gb|ESH10613.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Give str. 564]
 gb|ESH11090.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Hadar str. ATCC 51956]
 gb|ESH19774.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Cerro str. 818]
 gb|ESH21727.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Derby str. 626]
 gb|ESH33994.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Gaminara str. ATCC BAA-711]
 gb|ESH36452.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. ATCC 9115]
 gb|ESH43585.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Braenderup str. ATCC BAA-664]
 gb|ESH47136.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Berta str. ATCC 8392]
 gb|ESH53874.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. 2780]
 gb|ESH57192.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Bareilly str. CFSAN000200]
 gb|ESH61820.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Bareilly str. CFSAN000189]
 gb|ESH67164.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Bareilly str. CFSAN000197]
 gb|ESH70600.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Bareilly str. CFSAN000183]
 gb|ESH76577.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 648586-1]
 gb|ESH79857.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 419639 2-1]
 gb|ESH93950.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Agona str. 632182-2]
 gb|ESH97145.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Albany str. ATCC 51960]
 gb|ESJ00732.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. ATCC 51957]
 gb|ESJ20029.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Anatum str. USDA 100]
 gb|ESJ29205.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Nchanga str. CFSAN001092]
 gb|ESJ31663.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Nchanga str. CFSAN001091]
 gb|ESJ39825.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Havana str. CFSAN001082]
 gb|ESJ44930.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Cubana str. CFSAN001083]
 gb|ESJ59502.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Ohio str. CFSAN001079]
 gb|ESJ59654.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Manhattan str. CFSAN001078]
 gb|ESJ65080.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Norwich str. CFSAN001077]
 gb|ESJ69984.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Litchfield str. CFSAN001076]
 gb|ESJ78185.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Hartford str. CFSAN001075]
 gb|ESJ82276.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Braenderup str. CFSAN000756]
 gb|ESJ92384.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Stanleyville str. CFSAN000624]
 gb|ESO21869.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 400095 14]
 gb|ESO23864.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 400095 17]
 gb|ESO24495.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 400095 18]
 gb|ESO32173.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 400095 13]
 gb|ESO38460.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 392869-2]
 gb|ESO40631.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 400095 11]
 gb|ESO45169.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 392869-1]
 gb|ESO50086.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 246555-3]
 gb|ESO53210.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 241981]
 gb|ESO56610.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. VA_R100506907]
 gb|ESP73066.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Saintpaul str. S-70]
 gb|ESP77519.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Oranienburg str. S-76]
 gb|ESV50215.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cubana str. CVM42234]
 gb|AHB44323.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Agona str. 24249]
 gb|ETB73452.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001691]
 gb|ETB82922.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001680]
 gb|ETB85128.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Give var. 15 str. CFSAN004343]
 gb|ETB87609.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001690]
 gb|ETB90115.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001674]
 gb|ETB96983.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium var. 5- str. CFSAN004345]
 gb|ETC03348.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001681]
 gb|ETC04309.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001692]
 gb|ETC08816.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001669]
 gb|ETC14798.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001697]
 gb|ETC24437.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001671]
 gb|ETC25719.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001679]
 gb|ETC29816.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001590]
 gb|ETC32070.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Muenster str. CFSAN004344]
 gb|ETC37475.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001673]
 gb|ETC42198.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001587]
 gb|ETC50698.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001670]
 gb|ETC59373.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001589]
 gb|ETC64070.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. CFSAN001588]
 gb|ETC66930.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium var. Copenhagen str. 0084]
 gb|ETC72170.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Enteritidis str. 3402]
 gb|ETC76510.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro str. 5569]
 gb|AHB93434.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CFSAN002064]
 gb|ETE43172.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Infantis str. 335-3]
 gb|ETE49317.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Infantis str. 119944]
 gb|ETZ15532.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhi str. STH2370]
 gb|EXX82420.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Namur str. 05-2929]
 gb|EYE73291.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. N1514]
 gb|EYE75449.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. N1536]
 gb|EYE83821.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 29169]
 gb|EYH52933.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. SARA31]
 gb|EYH54245.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. SARA37]
 gb|EYH55424.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. SARA32]
 gb|EYH65588.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. N19992]
 gb|EYH67201.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. N418]
 gb|EYH70417.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. SARA 39]
 gb|EYH76054.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. N4496]
 gb|EYH86918.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. N4403]
 gb|EYH97720.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 21381]
 gb|EYI03670.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N4630]
 gb|EYI09551.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N19871]
 gb|EYI14461.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. N4541]
 gb|EYI15192.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N26457]
 gb|EYI23020.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N15757]
 gb|EYI26028.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N18393]
 gb|EYI31358.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41584]
 gb|EYI33673.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41576]
 gb|EYI40047.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 41567]
 gb|EYI48729.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N29341]
 gb|EYI51880.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 32507]
 gb|EYI57062.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N30678]
 gb|EYI63186.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 24393]
 gb|EYI63262.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CVM24391]
 gb|EYI63372.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N20134]
 gb|EYI80355.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CVM20752]
 gb|EYI84447.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N18413]
 gb|EYI85094.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CVM24388]
 gb|EYI86731.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. CVM24359]
 gb|EYI94069.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N18440]
 gb|EYI98027.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. N18453]
 gb|AHN80253.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Tennessee str. TXSC_TXSC08-19]
 gb|EYR76549.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Aqua str. NVSL2001]
 gb|AHW09399.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 507440-20]
 gb|AHW13404.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Anatum str. ATCC BAA-1592]
 gb|AHW19877.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Abaetetuba str. ATCC 35640]
 gb|AHW22030.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bredeney str. CFSAN001080]
 gb|AHW28303.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Abony str. 0014]
 gb|AHX77183.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium]
 gb|KAK07289.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 104772]
 gb|KAK09716.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 98346]
 gb|KAK10179.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 95799]
 gb|KAK20643.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 116045]
 gb|KAK22571.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 108402]
 gb|KCU92324.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Cerro FSL R8-0235]
 gb|KDQ72677.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000968]
 gb|KDQ73185.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000661]
 gb|KDQ80051.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000191]
 gb|KDQ88155.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000203]
 gb|KDQ90049.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000179]
 gb|KDR01390.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000211]
 gb|KDR05805.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000226]
 gb|KDR14626.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001087]
 gb|KDS00567.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. RI-11-013988]
 gb|KDS06559.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Heidelberg str. RI-11-014319]
 gb|KDU70677.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Heidelberg str. 640151-11]
 dbj|BAP07301.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. L-3553]
 emb|CDS67461.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Dublin]
 gb|AIK92666.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Choleraesuis]
 gb|AIL20072.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium]
 gb|KFR22014.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001115]
 gb|KFR23025.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001118]
 gb|KFR28082.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001140]
 gb|KFR30135.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001112]
 gb|KFR37180.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001108]
 gb|KFR42689.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001109]
 gb|KFR46485.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001102]
 gb|KFR50193.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001099]
 gb|KFR54924.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001088]
 gb|KFR61186.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001089]
 gb|KFR64415.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001105]
 gb|KFR64763.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000970]
 gb|KFR72521.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000969]
 gb|KFR75734.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000966]
 gb|KFR78304.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000967]
 gb|KFR83894.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000965]
 gb|KFR86960.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000963]
 gb|KFR92827.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000964]
 gb|KFS01164.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000961]
 gb|KFS04759.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000960]
 gb|KFS09630.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000958]
 gb|KFS14938.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000959]
 gb|KFS15666.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000957]
 gb|KFS20981.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000954]
 gb|KFS26794.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000953]
 gb|KFS29018.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000955]
 gb|KFS32893.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000952]
 gb|KFS34108.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000951]
 gb|KFS39286.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000755]
 gb|KFS46470.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000754]
 gb|KFS46750.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000753]
 gb|KFS55169.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000700]
 gb|KFS57716.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000752]
 gb|KFS62299.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000669]
 gb|KFS64492.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000680]
 gb|KFS73661.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000662]
 gb|KFS81401.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000235]
 gb|KFS83050.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000236]
 gb|KFS86771.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000233]
 gb|KFS89614.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000232]
 gb|KFS91675.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000231]
 gb|KFS95293.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000230]
 gb|KFS97216.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000228]
 gb|KFT03351.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000225]
 gb|KFT10821.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000223]
 gb|KFT14418.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000227]
 gb|KFT18515.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000224]
 gb|KFT23130.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000219]
 gb|KFT23956.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000222]
 gb|KFT30705.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000218]
 gb|KFT35451.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000221]
 gb|KFT36839.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000217]
 gb|KFT42398.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000216]
 gb|KFT43756.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000215]
 gb|KFT53741.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000214]
 gb|KFT62110.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000213]
 gb|KFT62177.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000212]
 gb|KFT66531.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000209]
 gb|KFT68806.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000210]
 gb|KFT78838.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000207]
 gb|KFT81357.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000206]
 gb|KFT82890.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000208]
 gb|KFT89893.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000202]
 gb|KFT91366.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000205]
 gb|KFT93674.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000204]
 gb|KFT99472.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000199]
 gb|KFU05680.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000201]
 gb|KFU07496.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000198]
 gb|KFU08533.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000196]
 gb|KFU17244.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000194]
 gb|KFU20382.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000193]
 gb|KFU24517.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000195]
 gb|KFU28707.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000192]
 gb|KFU36147.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000188]
 gb|KFU36749.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000190]
 gb|KFU40597.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000187]
 gb|KFU46804.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000185]
 gb|KFU47108.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000186]
 gb|KFU57148.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000182]
 gb|KFU58001.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000184]
 gb|KFU65762.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000181]
 gb|KFU66163.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000178]
 gb|KFU70874.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000180]
 gb|KGE30151.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000956]
 gb|KGE30864.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001090]
 gb|KGE39289.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000962]
 gb|KGE42792.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000229]
 gb|KGE48867.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN000220]
 gb|AIT47419.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM N18486]
 gb|AIT49664.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 21554]
 emb|CEH21472.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Manhattan str. 111113]
 gb|KGR29190.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHD83191.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 86-0368]
 gb|KHK48344.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Gallinarum]
 emb|CEI42713.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Infantis]
 gb|KHO67558.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHO71408.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHO77571.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHO82531.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHO85192.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHO89845.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHO94817.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHO95950.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP07684.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP09934.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP16755.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP21092.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP29802.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP35355.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP40368.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP43713.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP50104.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP52885.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP55816.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP61627.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP63257.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP70630.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP71806.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP76850.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP82914.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP87033.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP88615.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHP94018.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHQ00738.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHQ06664.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHQ08621.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KHQ13927.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|AJB08223.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 22462]
 gb|AJE01246.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A]
 gb|AJD95537.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi A]
 gb|KIO82682.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Bareilly str. CFSAN001591]
 gb|KIV44640.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
 gb|KIV44837.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_000168618.1| tyrosyl-tRNA synthetase [Salmonella bongori]
 emb|CCC30361.1| tyrosyl-tRNA synthetase [Salmonella bongori NCTC 12419]
 gb|AID24784.1| tyrosyl-tRNA synthetase [Salmonella bongori serovar 48:z41:-- 
str. RKS3044]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_023232826.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|ESH17845.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Chester str. ATCC 11997]
 gb|ESJ27576.1| tyrosyl-tRNA ligase [Salmonella enterica subsp. enterica serovar 
Eastbourne str. CFSAN001084]
 gb|KAJ99202.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar 9,12:l,v:- str. 94293]
 gb|KHP28832.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_023209468.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|ESF78545.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi B str. ATCC 51962]
Length=424

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|AHM74144.1| Tyrosyl-tRNA synthetase [Yersinia enterocolitica LC20]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_026742637.1| tyrosyl-tRNA synthetase [Lonsdalea quercina]
Length=425

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+V+ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLVKQLQERGLVAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_039854143.1| tyrosyl-tRNA synthetase [Providencia rustigianii]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_000168627.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|EJA92748.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 4176]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|EHC36772.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Gaminara str. A4-567]
Length=428

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  57



>ref|WP_041030274.1| tyrosyl-tRNA synthetase, partial [Salmonella enterica]
 gb|AHR08686.1| tyrosyl-tRNA synthetase, partial [Salmonella enterica subsp. 
enterica serovar Enteritidis str. EC20120200]
Length=263

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPVALYCGFDPTADSLHLGHLV  53



>ref|WP_038251393.1| tyrosyl-tRNA synthetase [Yersinia ruckeri]
 gb|KGA51377.1| tyrosine--tRNA ligase [Yersinia ruckeri ATCC 29473]
 emb|CEK27642.1| Tyrosyl-tRNA synthetase [Yersinia ruckeri]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_000168625.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|EDZ00637.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Virchow str. SL491]
 gb|ESF00440.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Virchow str. ATCC 51955]
 gb|ETO89934.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Virchow str. SVQ1]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>ref|WP_033761546.1| tyrosyl-tRNA synthetase [Pantoea agglomerans]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIQQLQERGLIAQVTDE--AALTEKLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_023891828.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 gb|ETC30319.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. CFSAN004346]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|EFE94325.1| tyrosine--tRNA ligase [Serratia odorifera DSM 4582]
Length=428

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIQQLQERGLVAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  57



>sp|C0Q5T3.1|SYY_SALPC RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. enterica 
serovar Paratyphi C str. RKS4594]
 gb|ACN46399.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Paratyphi C str. RKS4594]
 gb|EFY83443.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. 446600]
 gb|EFZ06077.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SCSA50]
 gb|ADX17149.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. ST4/74]
 gb|EGE34252.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Gallinarum str. SG9]
 gb|EHB41897.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Infantis str. SARB27]
 gb|EHC36406.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Adelaide str. A4-669]
 gb|EHC49823.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Give str. S5-487]
 gb|EHC51350.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Hvittingfoss str. A4-620]
 gb|EHC67443.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Minnesota str. A4-603]
 gb|EHC71411.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Mississippi str. A4-633]
 gb|EHC91720.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Uganda str. R8-3404]
 gb|EHD02778.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Wandsworth str. A4-580]
 gb|EHD03451.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Urbana str. R8-2977]
 gb|EHJ82316.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Baildon str. R6-199]
 gb|EHL37871.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. LQC 10]
 gb|AFD58377.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. 798]
 gb|EIZ96157.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 21539]
 gb|EJA80519.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. CVM 19470]
 gb|EMR49689.1| tyrosine--tRNA ligase [Salmonella enterica subsp. enterica serovar 
Dublin str. UC16]
 gb|EPI63761.1| tyrosine--tRNA ligase [Salmonella enterica subsp. enterica serovar 
Dublin str. DG22]
 gb|AGS29488.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. USMARC-S3124.1]
 gb|ESH32846.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. ATCC 10708]
 gb|ETA88568.1| tyrosine--tRNA ligase [Salmonella enterica subsp. enterica serovar 
Cubana str. 76814]
 gb|AIE05314.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium]
 gb|AJQ64962.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Anatum str. USDA-ARS-USMARC-1764]
 gb|AJQ69456.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Newport str. USDA-ARS-USMARC-1927]
 gb|AJQ73968.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Montevideo str. USDA-ARS-USMARC-1903]
 gb|AJQ78452.1| Tyrosyl-tRNA synthetase [Salmonella enterica subsp. enterica 
serovar Typhimurium str. USDA-ARS-USMARC-1899]
Length=428

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  57



>ref|WP_004910453.1| tyrosyl-tRNA synthetase [Providencia rettgeri]
 gb|EKT56574.1| tyrosyl-tRNA ligase [Providencia rettgeri Dmel1]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_026740282.1| tyrosyl-tRNA synthetase [Lonsdalea quercina]
Length=425

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+V+ L+ERGL+  VT E   ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLVKQLQERGLVAQVTDE--EALAERLAQGPIALYCGFDPTADSLHLGHLV  53



>gb|EFB73889.1| tyrosine--tRNA ligase [Providencia rustigianii DSM 4541]
Length=428

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  57



>ref|WP_012210189.1| tyrosyl-tRNA synthetase [Salmonella enterica]
 ref|YP_001570571.1| tyrosyl-tRNA synthetase [Salmonella enterica subsp. arizonae 
serovar 62:z4,z23:- str. RSK2980]
 sp|A9MEH2.1|SYY_SALAR RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Salmonella enterica subsp. arizonae 
serovar 62:z4,z23:-]
 gb|ABX21429.1| hypothetical protein SARI_01533 [Salmonella enterica subsp. arizonae 
serovar 62:z4,z23:-]
Length=428

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  9    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  57



>gb|AJJ11368.1| tyrosine--tRNA ligase [Yersinia rohdei]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_038275972.1| tyrosyl-tRNA synthetase [Yersinia ruckeri]
 gb|KGX81272.1| tyrosyl-tRNA synthetase [Yersinia ruckeri]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPISLYCGFDPTADSLHLGHLV  53



>ref|WP_039292531.1| tyrosyl-tRNA synthetase [Cedecea neteri]
 gb|AIR61920.1| tyrosyl-tRNA synthetase [Cedecea neteri]
Length=424

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 2/51 (4%)
 Frame = +2

Query  473  NVVEILEERGLLESVTSENLRSICSDPNLPPLXVYCGFDPTAESLHLGNLL  625
            N+++ L+ERGL+  VT E+  ++       P+ +YCGFDPTA+SLHLG+L+
Sbjct  5    NLIKQLQERGLVAQVTDED--ALAERLAQGPIALYCGFDPTADSLHLGHLV  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875