BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045G18

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009603475.1|  PREDICTED: DELLA protein GAI1-like               72.0    2e-24   Nicotiana tomentosiformis
ref|XP_009789076.1|  PREDICTED: DELLA protein GAI1-like               68.2    9e-23   Nicotiana sylvestris
ref|XP_008221422.1|  PREDICTED: DELLA protein GAIP-B                  75.1    5e-22   Prunus mume [ume]
gb|ADH53778.1|  GAI2                                                  72.0    1e-21   Malus domestica [apple tree]
ref|XP_002527794.1|  DELLA protein GAIP-B, putative                   72.4    1e-21   
gb|AAY56751.1|  DELLA protein                                         72.0    2e-21   Malus domestica [apple tree]
gb|ACL68360.1|  DELLA protein                                         72.0    2e-21   Malus domestica [apple tree]
ref|XP_010264458.1|  PREDICTED: DELLA protein GAI1                    73.6    3e-21   Nelumbo nucifera [Indian lotus]
gb|AFJ23219.1|  DELLA protein                                         70.9    4e-21   Pyrus betulifolia
ref|XP_002284648.1|  PREDICTED: DELLA protein GAI1                    72.4    4e-21   Vitis vinifera
gb|AFJ23220.1|  DELLA protein                                         70.5    4e-21   Pyrus x bretschneideri [bai li]
ref|XP_009351505.1|  PREDICTED: DELLA protein GAI-like                70.5    5e-21   Pyrus x bretschneideri [bai li]
emb|CAN67929.1|  hypothetical protein VITISV_007904                   72.4    5e-21   Vitis vinifera
ref|XP_010681882.1|  PREDICTED: DELLA protein GAI-like                70.5    5e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002312450.2|  hypothetical protein POPTR_0008s13090g           72.8    6e-21   
gb|ABG26370.1|  DELLA protein GAI                                     72.0    7e-21   Gossypium barbadense [Egyptian cotton]
ref|XP_004298516.1|  PREDICTED: DELLA protein GAIP                    73.6    8e-21   Fragaria vesca subsp. vesca
gb|KJB15415.1|  hypothetical protein B456_002G177000                  72.0    9e-21   Gossypium raimondii
ref|XP_007045197.1|  GRAS family transcription factor family protein  72.4    1e-20   
gb|AEX97109.1|  spur-type DELLA protein                               70.9    1e-20   Malus domestica [apple tree]
gb|ADW85805.1|  DELLA protein                                         70.9    1e-20   Malus domestica [apple tree]
gb|AGK07287.1|  GAI1                                                  72.8    1e-20   Rosa hybrid cultivar
gb|ACL68359.1|  DELLA protein                                         70.5    1e-20   Malus baccata var. xiaojinensis
gb|AEK06229.1|  GAI1                                                  70.5    2e-20   Vitis vinifera
gb|ABL61270.1|  GAI1                                                  69.7    2e-20   Malus hupehensis
gb|ACR58455.1|  GAI/RGA protein                                       70.5    2e-20   Gossypium hirsutum [American cotton]
ref|XP_011023720.1|  PREDICTED: DELLA protein GAIP-B-like             70.9    3e-20   Populus euphratica
ref|XP_011038614.1|  PREDICTED: DELLA protein GAIP                    70.9    4e-20   Populus euphratica
ref|XP_002314799.2|  hypothetical protein POPTR_0010s12080g           70.9    5e-20   Populus trichocarpa [western balsam poplar]
ref|XP_010274729.1|  PREDICTED: DELLA protein GAI1-like               68.9    7e-20   Nelumbo nucifera [Indian lotus]
ref|XP_006448223.1|  hypothetical protein CICLE_v10017466mg           75.5    8e-20   Citrus clementina [clementine]
ref|XP_009349514.1|  PREDICTED: DELLA protein GAI-like                66.2    1e-19   
gb|AAY56752.1|  DELLA protein                                         68.6    1e-19   Malus domestica [apple tree]
gb|AFP58844.1|  DELLA domain GRAS family transcription factor GAI     69.3    1e-19   Populus tomentosa [Chinese white poplar]
gb|KDP38079.1|  hypothetical protein JCGZ_04722                       70.1    1e-19   Jatropha curcas
dbj|BAF62637.1|  DELLA protein                                        69.7    2e-19   Phaseolus vulgaris [French bean]
ref|XP_007163387.1|  hypothetical protein PHAVU_001G230500g           69.7    2e-19   Phaseolus vulgaris [French bean]
ref|XP_006469195.1|  PREDICTED: DELLA protein GAIP-B-like             75.5    2e-19   Citrus sinensis [apfelsine]
ref|XP_011070609.1|  PREDICTED: DELLA protein GAI1                    68.2    3e-19   Sesamum indicum [beniseed]
dbj|BAM14051.1|  DELLA 1 sprice variant                               69.3    4e-19   Lactuca sativa [cultivated lettuce]
ref|XP_010553798.1|  PREDICTED: DELLA protein GAI-like                68.9    5e-19   Tarenaya hassleriana [spider flower]
dbj|BAG71200.1|  DELLA 1                                              68.9    6e-19   Lactuca sativa [cultivated lettuce]
ref|XP_006826893.1|  hypothetical protein AMTR_s00010p00148880        63.9    8e-19   Amborella trichopoda
gb|AEE69074.2|  GAI-like protein                                      63.9    8e-19   Juglans regia
ref|XP_011021384.1|  PREDICTED: DELLA protein GAI-like                67.8    1e-18   Populus euphratica
gb|AHB17742.1|  GA repressor DELLA                                    62.8    1e-18   Actinidia deliciosa [Chinese gooseberry]
emb|CBI26874.3|  unnamed protein product                              72.0    1e-18   Vitis vinifera
ref|XP_006383329.1|  hypothetical protein POPTR_0005s14540g           67.8    1e-18   Populus trichocarpa [western balsam poplar]
gb|AHB17743.1|  GA repressor DELLA                                    62.8    1e-18   Actinidia deliciosa [Chinese gooseberry]
ref|XP_007033025.1|  GRAS family transcription factor family protein  69.7    2e-18   
ref|XP_002266267.1|  PREDICTED: DELLA protein GAI-like                68.2    3e-18   Vitis vinifera
ref|XP_002305198.1|  hypothetical protein POPTR_0004s08890g           68.6    3e-18   Populus trichocarpa [western balsam poplar]
gb|KDO64603.1|  hypothetical protein CISIN_1g043131mg                 70.5    3e-18   Citrus sinensis [apfelsine]
ref|XP_006482132.1|  PREDICTED: DELLA protein GAI-like                67.8    4e-18   Citrus sinensis [apfelsine]
gb|EPS61323.1|  hypothetical protein M569_13471                       59.3    4e-18   Genlisea aurea
dbj|BAG71201.1|  DELLA 2                                              67.0    5e-18   Lactuca sativa [cultivated lettuce]
ref|XP_010554410.1|  PREDICTED: DELLA protein GAI-like                63.9    5e-18   Tarenaya hassleriana [spider flower]
sp|Q6EI06.1|GAIP_CUCMA  RecName: Full=DELLA protein GAIP; AltName...  69.3    6e-18   Cucurbita maxima [Boston marrow]
sp|Q6EI05.1|GAIPB_CUCMA  RecName: Full=DELLA protein GAIP-B; AltN...  70.1    6e-18   Cucurbita maxima [Boston marrow]
gb|EYU25601.1|  hypothetical protein MIMGU_mgv1a003589mg              61.2    6e-18   Erythranthe guttata [common monkey flower]
ref|XP_011002785.1|  PREDICTED: DELLA protein GAI                     67.4    6e-18   Populus euphratica
ref|XP_006430617.1|  hypothetical protein CICLE_v10011367mg           66.6    7e-18   Citrus clementina [clementine]
ref|XP_004150593.1|  PREDICTED: DELLA protein GAIP-B-like             68.9    7e-18   Cucumis sativus [cucumbers]
ref|XP_010109004.1|  hypothetical protein L484_027201                 67.8    7e-18   
ref|XP_004166672.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...  68.9    7e-18   
emb|CAN59753.1|  hypothetical protein VITISV_036639                   66.6    8e-18   Vitis vinifera
ref|XP_008467128.1|  PREDICTED: DELLA protein GAIP-B                  68.9    1e-17   Cucumis melo [Oriental melon]
gb|ABS50250.1|  DELLA protein                                         60.1    2e-17   Malus hupehensis
ref|XP_008381346.1|  PREDICTED: DELLA protein GAI                     59.7    2e-17   
ref|XP_002534030.1|  DELLA protein GAI, putative                      61.6    2e-17   Ricinus communis
gb|AHB17744.1|  GA repressor DELLA                                    58.5    3e-17   Actinidia deliciosa [Chinese gooseberry]
gb|AFC88481.1|  DELLA protein                                         65.9    3e-17   Rosa lucieae [memorial rose]
emb|CDP11067.1|  unnamed protein product                              63.5    3e-17   Coffea canephora [robusta coffee]
gb|AEB36183.1|  RGA-like 1                                            65.9    3e-17   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36192.1|  RGA-like 1                                            66.2    3e-17   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36201.1|  RGA-like 1                                            66.2    3e-17   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_010032696.1|  PREDICTED: DELLA protein GAI                     66.2    4e-17   Eucalyptus grandis [rose gum]
ref|XP_009796771.1|  PREDICTED: DELLA protein GAI-like                68.9    4e-17   Nicotiana sylvestris
ref|XP_010502135.1|  PREDICTED: DELLA protein RGA-like                58.5    5e-17   Camelina sativa [gold-of-pleasure]
gb|AAY56749.1|  DELLA protein                                         59.7    5e-17   Malus domestica [apple tree]
gb|AEX97110.1|  spur-type DELLA protein                               59.7    5e-17   Malus domestica [apple tree]
ref|XP_010916517.1|  PREDICTED: DELLA protein SLR1 isoform X1         60.8    5e-17   
gb|AFR90188.1|  GIA/RGA-like gibberellin response modulator           64.7    6e-17   Helianthus debilis subsp. debilis
gb|AEB36150.1|  RGA-like 1                                            65.1    6e-17   Helianthus petiolaris
gb|AEB36151.1|  RGA-like 1                                            65.1    6e-17   Helianthus petiolaris
gb|AEB36194.1|  RGA-like 1                                            64.7    7e-17   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36147.1|  RGA-like 1                                            65.1    7e-17   Helianthus petiolaris
gb|AEB36156.1|  RGA-like 1                                            64.7    7e-17   Helianthus petiolaris
gb|AEB36148.1|  RGA-like 1                                            64.7    7e-17   Helianthus petiolaris
gb|AFR90189.1|  GIA/RGA-like gibberellin response modulator           64.7    7e-17   Helianthus annuus
gb|AEB36190.1|  RGA-like 1                                            64.7    7e-17   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36202.1|  RGA-like 1                                            64.7    7e-17   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36149.1|  RGA-like 1                                            64.7    7e-17   Helianthus petiolaris
gb|AEB36313.1|  RGA-like 1                                            65.1    7e-17   Helianthus annuus
gb|ABG35336.1|  GIA/RGA-like gibberellin response modulator           64.7    7e-17   Helianthus annuus
gb|AEB36186.1|  RGA-like 1                                            64.7    7e-17   Helianthus tuberosus [Jerusalem artichoke]
gb|ABG35317.1|  GIA/RGA-like gibberellin response modulator           64.3    7e-17   Helianthus annuus
gb|AEB36200.1|  RGA-like 1                                            64.7    7e-17   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36338.1|  RGA-like 1                                            65.1    7e-17   Helianthus annuus
gb|AEB36307.1|  RGA-like 1                                            65.1    7e-17   Helianthus annuus
gb|AEB36157.1|  RGA-like 1                                            64.7    8e-17   Helianthus petiolaris
gb|AEB36154.1|  RGA-like 1                                            64.7    8e-17   Helianthus petiolaris
gb|AEB36211.1|  RGA-like 1                                            65.1    8e-17   Helianthus argophyllus
gb|AEB36217.1|  RGA-like 1                                            64.7    8e-17   Helianthus argophyllus
gb|AEB36153.1|  RGA-like 1                                            64.7    8e-17   Helianthus petiolaris
gb|ABG35316.1|  GIA/RGA-like gibberellin response modulator           64.3    8e-17   Helianthus annuus
gb|AEB36297.1|  RGA-like 1                                            64.7    8e-17   Helianthus annuus
gb|AEB36179.1|  RGA-like 1                                            65.1    8e-17   Helianthus exilis
gb|AEB36304.1|  RGA-like 1                                            64.7    8e-17   Helianthus annuus
gb|AEB36184.1|  RGA-like 1                                            64.7    8e-17   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36172.1|  RGA-like 1                                            65.1    8e-17   Helianthus exilis
gb|AEB36294.1|  RGA-like 1                                            64.7    8e-17   Helianthus annuus
gb|AEB36315.1|  RGA-like 1                                            64.7    8e-17   Helianthus annuus
gb|AEB36327.1|  RGA-like 1                                            65.1    8e-17   Helianthus annuus
gb|AHB17746.1|  GA repressor DELLA                                    63.2    8e-17   Actinidia deliciosa [Chinese gooseberry]
gb|AEB36175.1|  RGA-like 1                                            64.7    8e-17   Helianthus exilis
gb|AEB36207.1|  RGA-like 1                                            64.7    8e-17   Helianthus argophyllus
gb|AEB36182.1|  RGA-like 1                                            64.7    8e-17   Helianthus exilis
gb|AEB36178.1|  RGA-like 1                                            64.7    8e-17   Helianthus exilis
gb|AEB36334.1|  RGA-like 1                                            64.7    8e-17   Helianthus annuus
gb|AEB36203.1|  RGA-like 1                                            64.7    8e-17   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36189.1|  RGA-like 1                                            64.7    8e-17   Helianthus tuberosus [Jerusalem artichoke]
gb|ABG35338.1|  GIA/RGA-like gibberellin response modulator           64.3    8e-17   Helianthus annuus
gb|AEB36305.1|  RGA-like 1                                            64.7    8e-17   Helianthus annuus
gb|AEB36293.1|  RGA-like 1                                            64.7    8e-17   Helianthus annuus
gb|AEB36219.1|  RGA-like 1                                            64.7    8e-17   Helianthus annuus
gb|ABG35324.1|  GIA/RGA-like gibberellin response modulator           64.3    9e-17   Helianthus annuus
gb|AEB36177.1|  RGA-like 1                                            64.7    9e-17   Helianthus exilis
gb|AEB36330.1|  RGA-like 1                                            64.7    9e-17   Helianthus annuus
gb|ABG35340.1|  GIA/RGA-like gibberellin response modulator           64.3    9e-17   Helianthus annuus
gb|AEB36158.1|  RGA-like 1                                            64.7    9e-17   Helianthus petiolaris
ref|XP_009370101.1|  PREDICTED: DELLA protein GAI-like                58.2    9e-17   
gb|AEB36311.1|  RGA-like 1                                            64.7    9e-17   Helianthus annuus
ref|XP_011097451.1|  PREDICTED: DELLA protein GAI-like                69.3    1e-16   Sesamum indicum [beniseed]
gb|ACM47244.1|  putative gibberellin signaling DELLA protein          63.5    1e-16   Sinningia speciosa [Brazilian gloxinia]
gb|AEB36176.1|  RGA-like 1                                            64.3    1e-16   Helianthus exilis
gb|AEB36205.1|  RGA-like 1                                            64.7    1e-16   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36181.1|  RGA-like 1                                            64.3    1e-16   Helianthus exilis
gb|AEB36206.1|  RGA-like 1                                            64.7    1e-16   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36193.1|  RGA-like 1                                            64.7    1e-16   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36329.1|  RGA-like 1                                            64.3    1e-16   Helianthus annuus
gb|EYU30084.1|  hypothetical protein MIMGU_mgv1a027121mg              58.5    1e-16   Erythranthe guttata [common monkey flower]
gb|AEB36152.1|  RGA-like 1                                            64.7    1e-16   Helianthus petiolaris
gb|AFA35960.1|  ELLA domain GRAS family transcription factor          67.4    1e-16   Nicotiana attenuata
gb|AEB36196.1|  RGA-like 1                                            64.7    1e-16   Helianthus tuberosus [Jerusalem artichoke]
gb|ABG35314.1|  GIA/RGA-like gibberellin response modulator           64.7    1e-16   Helianthus annuus
gb|AFJ42394.1|  DELLA protein DWARF8                                  57.8    2e-16   Andropterum stolzii
ref|XP_007214956.1|  hypothetical protein PRUPE_ppa003206mg           65.9    2e-16   Prunus persica
gb|AEB36155.1|  RGA-like 1                                            64.7    2e-16   Helianthus petiolaris
gb|AEB36171.1|  RGA-like 1                                            63.5    2e-16   Helianthus exilis
gb|AEB36160.1|  RGA-like 1                                            63.2    2e-16   Helianthus paradoxus
gb|AFR90187.1|  GIA/RGA-like gibberellin response modulator           64.7    2e-16   Helianthus floridanus
gb|AEB36159.1|  RGA-like 1                                            63.2    3e-16   Helianthus paradoxus
gb|AEB36204.1|  RGA-like 1                                            64.7    3e-16   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36165.1|  RGA-like 1                                            62.8    3e-16   Helianthus paradoxus
gb|AEB36163.1|  RGA-like 1                                            62.8    3e-16   Helianthus paradoxus
gb|AEB36197.1|  RGA-like 1                                            64.7    3e-16   Helianthus tuberosus [Jerusalem artichoke]
gb|AEB36195.1|  RGA-like 1                                            63.5    3e-16   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_009594460.1|  PREDICTED: DELLA protein GAI-like                66.2    3e-16   Nicotiana tomentosiformis
gb|AHB17745.1|  GA repressor DELLA                                    61.2    3e-16   Actinidia deliciosa [Chinese gooseberry]
gb|AFR90185.1|  GIA/RGA-like gibberellin response modulator           62.4    3e-16   Helianthus annuus
gb|KFK33379.1|  rga1 protein                                          59.7    4e-16   Arabis alpina [alpine rockcress]
ref|XP_004140302.1|  PREDICTED: DELLA protein GAI-like                63.2    4e-16   
ref|XP_010926472.1|  PREDICTED: DELLA protein SLR1-like               59.7    4e-16   Elaeis guineensis
ref|XP_004155733.1|  PREDICTED: DELLA protein GAI-like                63.2    4e-16   
ref|XP_008782281.1|  PREDICTED: DELLA protein SLR1-like               60.1    5e-16   Phoenix dactylifera
ref|XP_010551797.1|  PREDICTED: DELLA protein RGL1-like               56.2    6e-16   Tarenaya hassleriana [spider flower]
ref|XP_003538395.1|  PREDICTED: DELLA protein GAI1                    61.6    7e-16   Glycine max [soybeans]
gb|EYU30908.1|  hypothetical protein MIMGU_mgv1a024641mg              66.2    8e-16   Erythranthe guttata [common monkey flower]
gb|AAY56750.1|  DELLA protein                                         58.9    8e-16   Malus domestica [apple tree]
gb|AEX97111.1|  spur-type DELLA protein                               58.9    8e-16   Malus domestica [apple tree]
ref|XP_010527787.1|  PREDICTED: DELLA protein GAI-like                59.3    8e-16   Tarenaya hassleriana [spider flower]
ref|XP_008343058.1|  PREDICTED: DELLA protein GAI-like                58.9    8e-16   
gb|KEH34625.1|  DELLA domain GRAS family transcription factor GAI     62.8    8e-16   Medicago truncatula
ref|XP_009334448.1|  PREDICTED: DELLA protein GAI-like                58.9    9e-16   Pyrus x bretschneideri [bai li]
ref|XP_006395878.1|  hypothetical protein EUTSA_v10005482mg           57.4    9e-16   Eutrema salsugineum [saltwater cress]
gb|AFC88482.1|  DELLA protein                                         65.9    1e-15   Rosa lucieae [memorial rose]
gb|KHN17945.1|  DELLA protein GAI1                                    61.6    1e-15   Glycine soja [wild soybean]
ref|XP_008809806.1|  PREDICTED: DELLA protein SLR1                    58.9    1e-15   Phoenix dactylifera
gb|AIW50513.1|  dwarf 8 protein                                       57.8    1e-15   Andropterum stolzii
ref|XP_011099949.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...  62.4    1e-15   Sesamum indicum [beniseed]
ref|XP_010513881.1|  PREDICTED: DELLA protein RGA isoform X1          57.4    1e-15   
ref|XP_004503135.1|  PREDICTED: DELLA protein GAI-like                64.3    1e-15   Cicer arietinum [garbanzo]
ref|XP_010424927.1|  PREDICTED: DELLA protein RGA-like                57.4    1e-15   Camelina sativa [gold-of-pleasure]
gb|ABI30654.1|  putative gibberellin signaling DELLA protein LA       63.5    1e-15   Pisum sativum [garden pea]
ref|XP_009590329.1|  PREDICTED: DELLA protein GAI-like                63.5    2e-15   Nicotiana tomentosiformis
ref|XP_008460522.1|  PREDICTED: DELLA protein GAI-like                61.2    2e-15   Cucumis melo [Oriental melon]
ref|XP_009390245.1|  PREDICTED: DELLA protein SLR1-like               62.8    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU45810.1|  hypothetical protein MIMGU_mgv1a003644mg              63.5    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_002890081.1|  hypothetical protein ARALYDRAFT_471680           56.2    2e-15   
gb|ADA84480.1|  GRAS                                                  57.8    2e-15   Antirrhinum majus [garden snapdragon]
gb|ADH53780.1|  GAI1                                                  57.8    2e-15   Malus domestica [apple tree]
ref|XP_006292324.1|  hypothetical protein CARUB_v10018534mg           56.6    2e-15   
ref|XP_010066602.1|  PREDICTED: DELLA protein GAIP-B-like             55.1    2e-15   Eucalyptus grandis [rose gum]
ref|XP_009114228.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...  57.0    2e-15   Brassica rapa
gb|AFD62413.1|  reduced height-2                                      56.6    3e-15   Eragrostis tef [tef]
sp|Q5BN22.1|RGA2_BRACM  RecName: Full=DELLA protein RGA2; AltName...  57.0    3e-15   Brassica rapa
ref|NP_172945.1|  DELLA protein GAI                                   56.2    3e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CAA75492.1|  GAI                                                  56.2    3e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ADD71137.1|  DELLA protein                                         57.0    3e-15   Brassica napus [oilseed rape]
emb|CAA72178.1|  RGA2 protein                                         56.2    3e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAG16380.1|  GRAS family transcription factor                     57.0    3e-15   Brassica rapa var. perviridis [kabuna]
emb|CDY04092.1|  BnaA09g18700D                                        57.0    3e-15   
ref|XP_006307228.1|  hypothetical protein CARUB_v10008833mg           55.5    3e-15   Capsella rubella
ref|XP_009779842.1|  PREDICTED: DELLA protein GAI-like isoform X3     60.1    3e-15   Nicotiana sylvestris
ref|XP_009779840.1|  PREDICTED: DELLA protein GAI-like isoform X1     60.1    4e-15   Nicotiana sylvestris
ref|XP_010496659.1|  PREDICTED: DELLA protein GAI                     57.8    4e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009779843.1|  PREDICTED: DELLA protein GAI-like isoform X4     60.1    4e-15   Nicotiana sylvestris
emb|CDY64837.1|  BnaC09g52270D                                        56.6    4e-15   Brassica napus [oilseed rape]
dbj|BAG16374.1|  GRAS family transcription factor                     56.2    4e-15   Brassica oleracea var. italica [asparagus broccoli]
gb|AFD62419.1|  reduced height-2                                      56.2    4e-15   Eragrostis tef [tef]
gb|AFD62396.1|  reduced height-2                                      56.2    4e-15   Eragrostis tef [tef]
ref|XP_010459010.1|  PREDICTED: DELLA protein GAI-like                57.4    4e-15   Camelina sativa [gold-of-pleasure]
gb|AEI25530.1|  gibberellic acid insensitive protein                  70.5    4e-15   Solanum tuberosum [potatoes]
gb|AIW50502.1|  dwarf 8 protein                                       56.2    4e-15   Eulalia villosa
gb|AFD62391.1|  reduced height-2                                      56.2    4e-15   Eragrostis tef [tef]
gb|AFD62385.1|  reduced height-1                                      56.2    4e-15   Eragrostis tef [tef]
ref|XP_006364643.1|  PREDICTED: DELLA protein GAI-like                70.5    4e-15   
gb|AFD62384.1|  reduced height-1                                      56.2    4e-15   Eragrostis tef [tef]
gb|AFD62360.1|  reduced height-1                                      56.2    5e-15   Eragrostis tef [tef]
gb|AFD62376.1|  reduced height-1                                      56.2    5e-15   Eragrostis tef [tef]
gb|AFD62369.1|  reduced height-1                                      56.2    5e-15   Eragrostis tef [tef]
gb|ABO61516.1|  GAI1                                                  63.9    5e-15   Glycine max [soybeans]
ref|NP_001240948.1|  DELLA protein GAI 1                              63.9    5e-15   Glycine max [soybeans]
ref|NP_001234365.1|  DELLA protein GAI                                70.5    5e-15   Solanum lycopersicum
gb|AHX57850.1|  DELLA                                                 60.5    5e-15   Prunus mume [ume]
gb|EPS58722.1|  hypothetical protein M569_16090                       60.1    5e-15   Genlisea aurea
ref|XP_003531153.1|  PREDICTED: DELLA protein GAI1-like               63.9    6e-15   Glycine max [soybeans]
pdb|2ZSH|B  Chain B, Structural Basis Of Gibberellin(Ga3)-Induced...  55.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229195.1|  PREDICTED: DELLA protein GAI                     60.5    6e-15   
gb|AIW50653.1|  dwarf 8 protein                                       55.8    7e-15   Eulalia quadrinervis
ref|XP_010511563.1|  PREDICTED: DELLA protein RGL1-like               57.0    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010415179.1|  PREDICTED: DELLA protein RGL1-like               57.0    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010470510.1|  PREDICTED: DELLA protein RGL1 isoform X1         57.0    7e-15   
ref|XP_006302161.1|  hypothetical protein CARUB_v10020171mg           57.0    1e-14   Capsella rubella
ref|XP_002887024.1|  hypothetical protein ARALYDRAFT_475738           57.4    1e-14   
gb|ADH53781.1|  GAI2                                                  56.2    1e-14   Malus baccata var. xiaojinensis
ref|NP_176809.1|  DELLA protein RGL1                                  57.4    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|ADH53779.1|  GAI1                                                  55.1    1e-14   Malus domestica [apple tree]
gb|AFR90186.1|  GIA/RGA-like gibberellin response modulator           60.5    1e-14   Helianthus ciliaris
gb|AIW50676.1|  dwarf 8 protein                                       54.3    1e-14   Saccharum arundinaceum
gb|AIW50533.1|  dwarf 8 protein                                       54.3    1e-14   Plagiantha tenella
emb|CAA12242.1|  RGA-like                                             57.0    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010528540.1|  PREDICTED: DELLA protein RGL1                    53.1    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_002876760.1|  RGA1 protein                                     54.3    2e-14   
gb|AIW50677.1|  dwarf 8 protein                                       54.3    2e-14   Saccharum arundinaceum
gb|AIW50614.1|  dwarf 8 protein                                       54.3    2e-14   Tripidium ravennae
gb|AIW50532.1|  dwarf 8 protein                                       53.9    2e-14   Plagiantha tenella
gb|AIW50605.1|  dwarf 8 protein                                       53.9    3e-14   Chrysopogon zizanioides [cuscus grass]
ref|XP_006416958.1|  hypothetical protein EUTSA_v10007323mg           55.5    3e-14   Eutrema salsugineum [saltwater cress]
ref|XP_003552980.1|  PREDICTED: DELLA protein GAI-like                63.5    3e-14   Glycine max [soybeans]
gb|AIW50499.1|  dwarf 8 protein                                       53.1    4e-14   Tripsacum dactyloides
gb|AIW50530.1|  dwarf 8 protein                                       57.8    4e-14   Paspalum malacophyllum
gb|AIW50534.1|  dwarf 8 protein                                       52.8    4e-14   Plagiantha tenella
gb|AIW50531.1|  dwarf 8 protein                                       57.4    5e-14   Paspalum malacophyllum
gb|AJN00621.1|  dwarf 8 protein                                       52.8    5e-14   Saccharum asperum
ref|XP_008644580.1|  PREDICTED: DELLA protein DWARF8-like             53.1    5e-14   
gb|ABI84226.1|  dwarf plant9                                          53.1    5e-14   Zea mays [maize]
gb|AAM15881.1|AF492563_1  GIA/RGA-like gibberellin response modul...  57.8    6e-14   Dubautia arborea
gb|AIW50554.1|  dwarf 8 protein                                       52.8    6e-14   Andropogon virginicus [broomsedge]
gb|AAM15885.1|  GIA/RGA-like gibberellin response modulator           58.5    6e-14   Dubautia raillardioides
gb|AIW50705.1|  dwarf 8 protein                                       52.4    6e-14   Andropogon glomeratus
gb|AIW50706.1|  dwarf 8 protein                                       52.4    6e-14   Andropogon glomeratus
gb|AJN00613.1|  dwarf 8 protein                                       52.4    6e-14   Saccharum angustifolium
gb|AIW50503.1|  dwarf 8 protein                                       52.0    6e-14   Eulalia villosa
gb|AIW50609.1|  dwarf 8 protein                                       52.0    7e-14   Andropogon sp. Kellogg PI 647883
gb|ABI34432.1|  CRY                                                   68.2    7e-14   Pisum sativum [garden pea]
gb|AJN00620.1|  dwarf 8 protein                                       52.0    7e-14   Saccharum asperum
gb|AAX07462.1|  gibberellic acid-insensitive                          52.8    7e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_004982031.1|  PREDICTED: DELLA protein DWARF8-like             53.1    7e-14   
ref|NP_001051032.1|  Os03g0707600                                     52.8    7e-14   
gb|EAY91579.1|  hypothetical protein OsI_13213                        52.8    7e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_004504565.1|  PREDICTED: DELLA protein GAI1-like               67.8    7e-14   Cicer arietinum [garbanzo]
gb|EEE59780.1|  hypothetical protein OsJ_12286                        52.8    7e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AIW50652.1|  dwarf 8 protein                                       52.0    7e-14   Eulalia quadrinervis
gb|AIW50651.1|  dwarf 8 protein                                       52.0    7e-14   Eulalia quadrinervis
sp|Q8W127.1|SLN1_HORVU  RecName: Full=DELLA protein SLN1; AltName...  54.7    7e-14   Hordeum vulgare [barley]
gb|AIW50681.1|  dwarf 8 protein                                       52.0    7e-14   Narenga porphyrocoma
gb|AIW50682.1|  dwarf 8 protein                                       52.0    8e-14   Narenga porphyrocoma
gb|AIW50665.1|  dwarf 8 protein                                       52.0    8e-14   
gb|AIW50664.1|  dwarf 8 protein                                       52.0    8e-14   
gb|AJN00635.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AIW50464.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AJN00616.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AJN00609.1|  dwarf 8 protein                                       52.0    9e-14   
gb|KHN07547.1|  DELLA protein GAI1                                    62.4    9e-14   
gb|AJN00625.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AJN00624.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AJN00622.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AJN00607.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AJN00612.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AJN00618.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AIW50678.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AIW50636.1|  dwarf 8 protein                                       52.0    9e-14   
gb|AAM15888.1|AF492570_1  GIA/RGA-like gibberellin response modul...  57.8    9e-14   
gb|AAM15884.1|AF492566_1  GIA/RGA-like gibberellin response modul...  57.8    9e-14   
gb|AAM15883.1|AF492565_1  GIA/RGA-like gibberellin response modul...  57.8    9e-14   
gb|AJN00634.1|  dwarf 8 protein                                       51.6    1e-13   
gb|AJN00626.1|  dwarf 8 protein                                       51.6    1e-13   
gb|AAM15880.1|AF492562_1  GIA/RGA-like gibberellin response modul...  57.8    1e-13   
gb|AAM15886.1|AF492568_1  GIA/RGA-like gibberellin response modul...  57.8    1e-13   
gb|AJN00633.1|  dwarf 8 protein                                       51.6    1e-13   
gb|AAM15882.1|AF492564_1  GIA/RGA-like gibberellin response modul...  57.8    1e-13   
gb|AAM15890.1|AF492572_1  GIA/RGA-like gibberellin response modul...  57.8    1e-13   
gb|AAM15889.1|AF492571_1  GIA/RGA-like gibberellin response modul...  57.8    1e-13   
gb|AIW50654.1|  dwarf 8 protein                                       52.0    1e-13   
ref|XP_006391387.1|  hypothetical protein EUTSA_v10018436mg           55.8    1e-13   
gb|AIW50501.1|  dwarf 8 protein                                       51.6    1e-13   
gb|AJN00611.1|  dwarf 8 protein                                       51.6    1e-13   
gb|AIW50621.1|  dwarf 8 protein                                       51.6    1e-13   
gb|AIW50620.1|  dwarf 8 protein                                       51.6    1e-13   
ref|XP_006408301.1|  hypothetical protein EUTSA_v10020431mg           56.2    1e-13   
gb|AAM15895.1|AF492578_1  GIA/RGA-like gibberellin response modul...  55.1    1e-13   
gb|AIW50469.1|  dwarf 8 protein                                       52.0    1e-13   
emb|CDY36236.1|  BnaC07g20900D                                        52.8    1e-13   
gb|AAM15894.1|AF492577_1  GIA/RGA-like gibberellin response modul...  55.8    1e-13   
gb|AIW50622.1|  dwarf 8 protein                                       52.0    1e-13   
gb|AJN00623.1|  dwarf 8 protein                                       52.0    1e-13   
gb|AIW50518.1|  dwarf 8 protein                                       52.0    1e-13   
gb|AIW50466.1|  dwarf 8 protein                                       52.0    1e-13   
gb|AIW50487.1|  dwarf 8 protein                                       52.0    1e-13   
gb|AIW50623.1|  dwarf 8 protein                                       52.0    1e-13   
gb|AJN00631.1|  dwarf 8 protein                                       52.0    2e-13   
gb|AIW50517.1|  dwarf 8 protein                                       52.0    2e-13   
gb|AIW50516.1|  dwarf 8 protein                                       52.0    2e-13   
gb|KJB08563.1|  hypothetical protein B456_001G089400                  63.9    2e-13   
gb|AFJ42395.1|  DELLA protein DWARF8                                  51.6    2e-13   
sp|Q84TQ7.1|GAI_GOSHI  RecName: Full=DELLA protein GAI; AltName: ...  63.9    2e-13   
gb|AIW50671.1|  dwarf 8 protein                                       51.6    2e-13   
gb|AAY28970.1|  GIA/RGA-like gibberellin response modulator           63.9    2e-13   
gb|AFJ42400.1|  DELLA protein DWARF8                                  52.0    2e-13   
gb|AIW50669.1|  dwarf 8 protein                                       51.6    2e-13   
gb|AIW50670.1|  dwarf 8 protein                                       51.6    2e-13   
gb|AIW50490.1|  dwarf 8 protein                                       51.6    2e-13   
gb|AJN00606.1|  dwarf 8 protein                                       51.6    2e-13   
gb|AJN00619.1|  dwarf 8 protein                                       52.0    2e-13   
gb|AGA16543.1|  DELLA protein RGL2                                    55.8    2e-13   
gb|AAL10325.1|  DWARF8                                                51.6    2e-13   
gb|AGG68489.1|  mutant DELLA protein                                  52.4    2e-13   
gb|AIW50672.1|  dwarf 8 protein                                       51.6    2e-13   
ref|XP_006650473.1|  PREDICTED: DELLA protein SLR1-like               52.0    2e-13   
gb|AAL10331.1|  DWARF8                                                51.6    2e-13   
gb|AAL10319.1|  DWARF8                                                51.6    2e-13   
ref|XP_009413642.1|  PREDICTED: DELLA protein SLR1-like               55.5    2e-13   
gb|AIW50520.1|  dwarf 8 protein                                       51.2    2e-13   
gb|AJN00610.1|  dwarf 8 protein                                       52.0    2e-13   
gb|AAZ08571.1|  gibberellic acid-insensitive                          51.6    3e-13   
gb|AIW50702.1|  dwarf 8 protein                                       52.0    3e-13   
gb|AIW50506.1|  dwarf 8 protein                                       51.2    3e-13   
emb|CAA75493.1|  GRS protein                                          51.2    3e-13   
gb|AIW50528.1|  dwarf 8 protein                                       52.0    3e-13   
emb|CAA72177.1|  RGA1 protein                                         50.8    3e-13   
ref|NP_178266.1|  DELLA protein RGA                                   50.8    3e-13   
gb|AAK97709.1|  At2g01570/F2I9.19                                     50.8    3e-13   
gb|AJN00628.1|  dwarf 8 protein                                       51.6    3e-13   
gb|KFK38060.1|  hypothetical protein AALP_AA3G064800                  55.5    3e-13   
gb|AIW50482.1|  dwarf 8 protein                                       52.0    3e-13   
gb|AIW50608.1|  dwarf 8 protein                                       54.3    4e-13   
ref|NP_001130629.1|  DELLA protein DWARF8                             51.6    4e-13   
gb|AAL10307.1|  DWARF8                                                51.6    4e-13   
gb|AAL10335.1|  DWARF8                                                51.6    4e-13   
gb|AAL10358.1|  DWARF8                                                51.6    4e-13   
gb|AJN00608.1|  dwarf 8 protein                                       51.2    4e-13   
gb|AAL10361.1|  DWARF8                                                51.6    4e-13   
gb|AAL10379.1|  DWARF8                                                51.6    4e-13   
gb|AAL10376.1|  DWARF8                                                51.6    4e-13   
gb|AAL10348.1|  DWARF8                                                51.6    4e-13   
gb|AAL10328.1|  DWARF8                                                51.6    4e-13   
gb|AAL10303.1|  DWARF8                                                51.6    4e-13   
gb|AAL10366.1|  DWARF8                                                51.6    4e-13   
gb|AAM15891.1|AF492573_1  GIA/RGA-like gibberellin response modul...  57.8    4e-13   
gb|AAL10304.1|  DWARF8                                                51.6    4e-13   
gb|AAL10302.1|  DWARF8                                                51.6    4e-13   
gb|AAL10318.1|  DWARF8                                                51.6    4e-13   
gb|AAL10382.1|  DWARF8                                                51.6    4e-13   
gb|AIW50663.1|  dwarf 8 protein                                       52.0    4e-13   
gb|AIW50679.1|  dwarf 8 protein                                       52.0    4e-13   
tpg|DAA50919.1|  TPA: dwarf plant8                                    51.6    4e-13   
gb|AAM15896.1|AF492579_1  GIA/RGA-like gibberellin response modul...  58.2    4e-13   
sp|Q9ST48.1|DWRF8_MAIZE  RecName: Full=DELLA protein DWARF8; Shor...  51.2    4e-13   
gb|AAM15899.1|AF492582_1  GIA/RGA-like gibberellin response modul...  57.8    5e-13   
gb|AAM15903.1|AF492586_1  GIA/RGA-like gibberellin response modul...  57.8    5e-13   
gb|AIW50549.1|  dwarf 8 protein                                       51.6    5e-13   
emb|CDY43122.1|  BnaA05g32640D                                        53.9    5e-13   
gb|AIW50550.1|  dwarf 8 protein                                       51.6    5e-13   
tpg|DAA50918.1|  TPA: dwarf plant8                                    51.2    5e-13   
gb|AIW50527.1|  dwarf 8 protein                                       52.0    5e-13   
gb|EPS67815.1|  hypothetical protein M569_06957                       53.1    6e-13   
gb|AIW50634.1|  dwarf 8 protein                                       53.1    6e-13   
gb|AIW50483.1|  dwarf 8 protein                                       50.8    6e-13   
gb|ACH91043.1|  DELLA                                                 51.2    6e-13   
ref|XP_010476569.1|  PREDICTED: DELLA protein GAI-like                58.9    6e-13   
gb|AIW50699.1|  dwarf 8 protein                                       52.0    6e-13   
gb|AIW50694.1|  dwarf 8 protein                                       52.0    6e-13   
emb|CBW30292.1|  RHT-D1 protein                                       52.0    6e-13   
gb|AFJ42401.1|  DELLA protein DWARF8                                  51.6    6e-13   
gb|AIW50615.1|  dwarf 8 protein                                       54.7    6e-13   
gb|AIW50514.1|  dwarf 8 protein                                       52.0    6e-13   
gb|AIW50593.1|  dwarf 8 protein                                       54.3    6e-13   
gb|AIW50594.1|  dwarf 8 protein                                       54.3    6e-13   
gb|AIW50611.1|  dwarf 8 protein                                       52.0    6e-13   
gb|AIW50470.1|  dwarf 8 protein                                       52.0    7e-13   
gb|AFJ42402.1|  DELLA protein DWARF8                                  52.0    7e-13   
gb|ACY74341.1|  putative DELLA protein                                50.4    7e-13   
gb|ACC93921.1|  DELLA                                                 50.4    7e-13   
gb|AIW50505.1|  dwarf 8 protein                                       50.4    7e-13   
gb|KFK26113.1|  hypothetical protein AALP_AA8G204400                  53.1    7e-13   
gb|ACH91044.1|  DELLA                                                 50.8    7e-13   
gb|AIW50704.1|  dwarf 8 protein                                       52.0    7e-13   
gb|AIW50662.1|  dwarf 8 protein                                       52.0    7e-13   
gb|AIW50610.1|  dwarf 8 protein                                       52.0    7e-13   
gb|ACH91048.1|  DELLA                                                 50.8    7e-13   
gb|ACC93913.1|  DELLA                                                 50.4    7e-13   
gb|ACC93912.1|  DELLA                                                 50.4    7e-13   
ref|XP_009101333.1|  PREDICTED: DELLA protein RGA1                    50.4    7e-13   
emb|CDY17662.1|  BnaA06g34810D                                        50.4    7e-13   
gb|AFJ42393.1|  DELLA protein DWARF8                                  51.2    7e-13   
gb|ACH91045.1|  DELLA                                                 50.8    7e-13   
gb|AAM15906.1|AF492589_1  GIA/RGA-like gibberellin response modul...  57.8    7e-13   
gb|ACC93927.1|  DELLA                                                 50.4    7e-13   
gb|AIW50486.1|  dwarf 8 protein                                       52.0    7e-13   
gb|AIW50590.1|  dwarf 8 protein                                       52.0    7e-13   
gb|ACH91040.1|  DELLA                                                 50.8    7e-13   
gb|AIW50485.1|  dwarf 8 protein                                       52.0    8e-13   
ref|XP_009380281.1|  PREDICTED: DELLA protein SLN1-like               50.8    8e-13   
gb|AIW50688.1|  dwarf 8 protein                                       51.6    8e-13   
gb|AIW50624.1|  dwarf 8 protein                                       50.8    8e-13   
gb|AIW50698.1|  dwarf 8 protein                                       50.4    8e-13   
gb|AIW50660.1|  dwarf 8 protein                                       52.0    8e-13   
gb|AIW50644.1|  dwarf 8 protein                                       54.3    8e-13   
ref|XP_009130367.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...  53.5    8e-13   
gb|AIW50548.1|  dwarf 8 protein                                       50.8    9e-13   
gb|AIW50496.1|  dwarf 8 protein                                       50.4    9e-13   
gb|AIW50687.1|  dwarf 8 protein                                       51.6    9e-13   
dbj|BAF62636.1|  DELLA protein                                        62.8    9e-13   
ref|XP_007156503.1|  hypothetical protein PHAVU_003G291500g           62.8    9e-13   
gb|AIW50613.1|  dwarf 8 protein                                       51.6    9e-13   
emb|CDY50707.1|  BnaC05g47760D                                        53.9    1e-12   
gb|KFK41051.1|  hypothetical protein AALP_AA2G079000                  54.3    1e-12   
ref|XP_002466594.1|  hypothetical protein SORBIDRAFT_01g010660        50.4    1e-12   
gb|AHW42470.1|  RGA                                                   51.2    1e-12   
gb|AIW50591.1|  dwarf 8 protein                                       51.2    1e-12   
gb|ACC93914.1|  DELLA                                                 50.1    1e-12   
gb|AIW50643.1|  dwarf 8 protein                                       54.3    1e-12   
gb|AIW50504.1|  dwarf 8 protein                                       52.0    1e-12   
gb|ADM32428.1|  DELLA protein Rht-A1                                  50.8    1e-12   
ref|XP_009409625.1|  PREDICTED: DELLA protein SLR1-like               54.3    1e-12   
emb|CBW30283.1|  RHT-A1 protein                                       50.8    1e-12   
emb|CCD31540.1|  Reduced height-1 protein                             50.8    1e-12   
gb|AGG68464.1|  DELLA protein                                         50.8    1e-12   
gb|AGG68462.1|  DELLA protein                                         50.8    1e-12   
emb|CBW30287.1|  RHT-B1 protein                                       50.8    1e-12   
gb|AIW50655.1|  dwarf 8 protein                                       52.0    1e-12   
gb|AGG68491.1|  DELLA protein                                         50.8    1e-12   
emb|CBW30285.1|  RHT-B1 protein                                       50.8    1e-12   
gb|AGG68490.1|  DELLA protein                                         50.8    1e-12   
emb|CBW30286.1|  RHT-B1 protein                                       50.8    1e-12   
gb|AEV92815.1|  DELLA protein                                         50.8    1e-12   
gb|AGO59331.1|  DELLA protein                                         50.8    1e-12   
emb|CBW30289.1|  RHT-D1 protein                                       50.8    1e-12   
gb|AHK61037.1|  DELLA protein                                         50.8    1e-12   
gb|AIW50612.1|  dwarf 8 protein                                       52.0    1e-12   
emb|CBW30288.1|  RHT-D1 protein                                       50.8    1e-12   
gb|AGG68478.1|  DELLA protein                                         50.8    1e-12   
gb|AGG68476.1|  DELLA protein                                         50.8    1e-12   
emb|CBW30290.1|  RHT-D1 protein                                       50.8    1e-12   
sp|Q9ST59.1|RHT1_WHEAT  RecName: Full=DELLA protein RHT-1; AltNam...  50.8    1e-12   
emb|CBW30291.1|  RHT-D1 protein                                       50.8    1e-12   
gb|ADP02199.1|  Rht-D1a                                               50.8    1e-12   
gb|AIW50683.1|  dwarf 8 protein                                       50.4    2e-12   
gb|AJN00632.1|  dwarf 8 protein                                       52.0    2e-12   
gb|AAM15893.1|AF492576_1  GIA/RGA-like gibberellin response modul...  57.8    2e-12   
gb|AIW50484.1|  dwarf 8 protein                                       52.0    2e-12   
gb|AAM15892.1|AF492575_1  GIA/RGA-like gibberellin response modul...  57.8    2e-12   
gb|AAM15901.1|AF492584_1  GIA/RGA-like gibberellin response modul...  57.8    2e-12   
gb|AFJ42399.1|  DELLA protein DWARF8                                  49.7    2e-12   
gb|AIW50465.1|  dwarf 8 protein                                       50.1    2e-12   
gb|AIW50685.1|  dwarf 8 protein                                       50.1    2e-12   
gb|AIW50607.1|  dwarf 8 protein                                       50.1    2e-12   
gb|AAM15902.1|AF492585_1  GIA/RGA-like gibberellin response modul...  57.8    2e-12   
ref|XP_003560731.1|  PREDICTED: DELLA protein SLN1                    52.4    3e-12   
gb|AIW50661.1|  dwarf 8 protein                                       52.0    3e-12   
ref|XP_002884379.1|  hypothetical protein ARALYDRAFT_477591           51.6    3e-12   
gb|AJN00636.1|  dwarf 8 protein                                       49.7    3e-12   
gb|AAM15907.1|AF492590_1  GIA/RGA-like gibberellin response modul...  57.8    4e-12   
gb|AAM15900.1|AF492583_1  GIA/RGA-like gibberellin response modul...  57.8    4e-12   
gb|AAM15904.1|AF492587_1  GIA/RGA-like gibberellin response modul...  57.8    4e-12   
gb|AAM15898.1|AF492581_1  GIA/RGA-like gibberellin response modul...  57.8    4e-12   
emb|CDY16915.1|  BnaC09g40420D                                        53.5    4e-12   
gb|AIW50689.1|  dwarf 8 protein                                       51.6    4e-12   
ref|XP_009107522.1|  PREDICTED: DELLA protein RGL3                    53.5    5e-12   
emb|CDY38434.1|  BnaA10g17240D                                        53.5    5e-12   
ref|XP_002873832.1|  hypothetical protein ARALYDRAFT_488615           55.8    6e-12   
gb|AIW50627.1|  dwarf 8 protein                                       56.6    6e-12   
gb|AIW50626.1|  dwarf 8 protein                                       56.2    7e-12   
gb|AIW50546.1|  dwarf 8 protein                                       52.0    9e-12   
gb|AIW50603.1|  dwarf 8 protein                                       51.2    9e-12   
gb|AIW50529.1|  dwarf 8 protein                                       50.1    1e-11   
ref|XP_004145854.1|  PREDICTED: DELLA protein GAI-like                51.6    1e-11   
emb|CCG14222.1|  gibberellin DELLA protein                            51.6    1e-11   



>ref|XP_009603475.1| PREDICTED: DELLA protein GAI1-like [Nicotiana tomentosiformis]
Length=563

 Score = 72.0 bits (175),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 7/67 (10%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFD  620
            G ++ D+LS LASETVHYNPSDLSSW++SMISELN  DPF      S+S  T+ + Q+++
Sbjct  71   GSVEQDNLSFLASETVHYNPSDLSSWLESMISELNPQDPF------SNSFTTQTTNQVYE  124

Query  621  D-SSFDS  638
            D SSFDS
Sbjct  125  DSSSFDS  131


 Score = 67.0 bits (162),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 39/45 (87%), Gaps = 4/45 (9%)
 Frame = +1

Query  316  KMWEESEQDAGMD-ELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
             MWEE   D G+D ELLAVLGYKVKASDMAEVAQKLEQLE+VMGS
Sbjct  31   NMWEE---DGGVDDELLAVLGYKVKASDMAEVAQKLEQLEKVMGS  72



>ref|XP_009789076.1| PREDICTED: DELLA protein GAI1-like [Nicotiana sylvestris]
Length=587

 Score = 68.2 bits (165),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 38/44 (86%), Positives = 39/44 (89%), Gaps = 4/44 (9%)
 Frame = +1

Query  319  MWEESEQDAGMD-ELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            MWEE   D G+D ELLAVLGYKVKASDMAEVAQKLEQLEEVMGS
Sbjct  35   MWEE---DGGVDDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  75


 Score = 65.9 bits (159),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 49/67 (73%), Gaps = 7/67 (10%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFD  620
            G ++ D+LS LASETVHYNPSDLSSW++SMISELN  DPF +S +         + Q+++
Sbjct  74   GSVEQDNLSFLASETVHYNPSDLSSWLESMISELNPQDPFSNSSSSFP------TNQVYE  127

Query  621  D-SSFDS  638
            D SSFDS
Sbjct  128  DSSSFDS  134



>ref|XP_008221422.1| PREDICTED: DELLA protein GAIP-B [Prunus mume]
Length=633

 Score = 75.1 bits (183),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 2/47 (4%)
 Frame = +1

Query  313  KKMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
             KMWEE  Q  D GMDELLAVLGYKV++SDMAEVAQKLEQLEE MGS
Sbjct  32   NKMWEEDAQRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMGS  78


 Score = 56.2 bits (134),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G +Q D LS LAS+TVHYNPSDLS+W++SMISE+N
Sbjct  77   GSVQEDGLSQLASDTVHYNPSDLSTWLESMISEIN  111



>gb|ADH53778.1| GAI2 [Malus domestica]
Length=636

 Score = 72.0 bits (175),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWE+  Q  D GMDELLAVLGYKV++SDMAEVAQKLEQLEE MG
Sbjct  38   KMWEDESQRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMG  82


 Score = 58.2 bits (139),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSA---ITRNSTQ  611
            G  Q D LS LAS+TVHYNP+DLS+W++SMISE+NL  P     T  + A     +   Q
Sbjct  82   GCAQEDGLSQLASDTVHYNPADLSTWLESMISEINLPPPNFDPLTGGAVAGMHANQQQVQ  141

Query  612  IFDD  623
            + DD
Sbjct  142  LVDD  145



>ref|XP_002527794.1| DELLA protein GAIP-B, putative [Ricinus communis]
 gb|EEF34604.1| DELLA protein GAIP-B, putative [Ricinus communis]
Length=609

 Score = 72.4 bits (176),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 2/46 (4%)
 Frame = +1

Query  316  KMWE--ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WE  E++ D GMDELLAVLGYKV++SDMAEVAQKLEQLEEVMG+
Sbjct  43   KIWEDEEAKGDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMGN  88


 Score = 57.4 bits (137),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQ  572
            G +Q D L  LASETVHYNPSDLS+W++SM+SELN    F  SQ
Sbjct  87   GNVQEDGLCQLASETVHYNPSDLSTWLESMLSELNPNPNFDPSQ  130



>gb|AAY56751.1| DELLA protein [Malus domestica]
Length=639

 Score = 72.0 bits (175),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWE+  Q  D GMDELLAVLGYKV++SDMAEVAQKLEQLEE MG
Sbjct  38   KMWEDESQRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMG  82


 Score = 57.8 bits (138),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNP+DLS+W++SMISE+NL  P
Sbjct  82   GCAQEDGLSQLASDTVHYNPADLSTWLESMISEINLPPP  120



>gb|ACL68360.1| DELLA protein [Malus domestica]
Length=636

 Score = 72.0 bits (175),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 39/45 (87%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWE+  Q  D GMDELLAVLGYKV++SDMAEVAQKLEQLEE MG
Sbjct  38   KMWEDESQRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMG  82


 Score = 57.8 bits (138),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNP+DLS+W++SMISE+NL  P
Sbjct  82   GCAQEDGLSQLASDTVHYNPADLSTWLESMISEINLPPP  120



>ref|XP_010264458.1| PREDICTED: DELLA protein GAI1 [Nelumbo nucifera]
Length=610

 Score = 73.6 bits (179),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 37/45 (82%), Positives = 43/45 (96%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E+EQ DAG+DELLAVLGYKV++SDMAEVAQKLEQL+ VMGS
Sbjct  24   KMWDEAEQQDAGVDELLAVLGYKVRSSDMAEVAQKLEQLDIVMGS  68


 Score = 55.1 bits (131),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 40/64 (63%), Gaps = 6/64 (9%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFD  620
            G  Q D L+ LASETVHYNPSDL++W++SM+SELN   P +   T S  ++ R    + D
Sbjct  67   GSAQEDGLNHLASETVHYNPSDLATWLESMLSELN--APPIFDPTPSQPSLPR----VLD  120

Query  621  DSSF  632
            D   
Sbjct  121  DPRL  124



>gb|AFJ23219.1| DELLA protein [Pyrus betulifolia]
Length=634

 Score = 70.9 bits (172),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWE+     D GMDELLAVLGYKV++SDMAEVAQKLEQLEE MG
Sbjct  36   KMWEDESHRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMG  80


 Score = 57.8 bits (138),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNP+DLS+W++SMISE+NL  P
Sbjct  80   GCAQEDGLSQLASDTVHYNPADLSTWLESMISEINLPPP  118



>ref|XP_002284648.1| PREDICTED: DELLA protein GAI1 [Vitis vinifera]
 sp|Q8S4W7.1|GAI1_VITVI RecName: Full=DELLA protein GAI1; AltName: Full=Gibberellic acid-insensitive 
mutant protein 1; AltName: Full=VvGAI1 [Vitis 
vinifera]
 gb|AAM19210.1|AF378125_1 GAI-like protein 1 [Vitis vinifera]
Length=590

 Score = 72.4 bits (176),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 40/43 (93%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+ + +QDAGMDELLAVLGY VKASDMAEVAQKLEQLEEV+
Sbjct  22   KMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQLEEVI  64


 Score = 55.8 bits (133),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 41/72 (57%), Gaps = 10/72 (14%)
 Frame = +3

Query  450  QGDDLSSLASETVHYNPSDLSSWVDSMISELN------LGDPFLSSQTE----SSSAITR  599
            Q D LS LASETVHYNPSDLS+W+ SM+SE N      L +PFL   +     + S   +
Sbjct  68   QEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYTNCSTQPK  127

Query  600  NSTQIFDDSSFD  635
                IFD  S D
Sbjct  128  QEPSIFDSPSLD  139



>gb|AFJ23220.1| DELLA protein [Pyrus x bretschneideri]
Length=634

 Score = 70.5 bits (171),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWE+     D GMDELLAVLGYKV++SDMAEVAQKLEQLEE MG
Sbjct  36   KMWEDESHRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMG  80


 Score = 57.8 bits (138),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNP+DLS+W++SMISE+NL  P
Sbjct  80   GCAQEDGLSQLASDTVHYNPADLSTWLESMISEINLPPP  118



>ref|XP_009351505.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=634

 Score = 70.5 bits (171),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWE+     D GMDELLAVLGYKV++SDMAEVAQKLEQLEE MG
Sbjct  36   KMWEDESHRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMG  80


 Score = 57.8 bits (138),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNP+DLS+W++SMISE+NL  P
Sbjct  80   GCAQEDGLSQLASDTVHYNPADLSTWLESMISEINLPPP  118



>emb|CAN67929.1| hypothetical protein VITISV_007904 [Vitis vinifera]
Length=558

 Score = 72.4 bits (176),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 40/43 (93%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+ + +QDAGMDELLAVLGY VKASDMAEVAQKLEQLEEV+
Sbjct  22   KMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQLEEVI  64


 Score = 55.8 bits (133),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 41/72 (57%), Gaps = 10/72 (14%)
 Frame = +3

Query  450  QGDDLSSLASETVHYNPSDLSSWVDSMISELN------LGDPFLSSQTE----SSSAITR  599
            Q D LS LASETVHYNPSDLS+W+ SM+SE N      L +PFL   +     + S   +
Sbjct  68   QEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYTNCSTQPK  127

Query  600  NSTQIFDDSSFD  635
                IFD  S D
Sbjct  128  QEPSIFDSPSLD  139



>ref|XP_010681882.1| PREDICTED: DELLA protein GAI-like [Beta vulgaris subsp. vulgaris]
Length=609

 Score = 70.5 bits (171),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMWE+  Q DAG+DELLAVLGYKV++SDMAEVA KLEQLEE MG+
Sbjct  27   KMWEDGAQNDAGVDELLAVLGYKVRSSDMAEVANKLEQLEEYMGN  71


 Score = 57.4 bits (137),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G ++GD L  LASETVHYNPSDLS+W++SM+SE N
Sbjct  70   GNVRGDGLCQLASETVHYNPSDLSTWLESMLSEFN  104



>ref|XP_002312450.2| hypothetical protein POPTR_0008s13090g [Populus trichocarpa]
 gb|EEE89817.2| hypothetical protein POPTR_0008s13090g [Populus trichocarpa]
Length=600

 Score = 72.8 bits (177),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 3/46 (7%)
 Frame = +1

Query  316  KMWEESE---QDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            K+WEE E    D GMDELLAVLGYKV++SDMAEVAQKLEQLEEVMG
Sbjct  39   KIWEEGEGHQADGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMG  84


 Score = 54.7 bits (130),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D LS LAS++VHYNPSDLS+W++SMISELN
Sbjct  84   GHAQEDGLSHLASDSVHYNPSDLSTWLESMISELN  118



>gb|ABG26370.1| DELLA protein GAI [Gossypium barbadense]
Length=616

 Score = 72.0 bits (175),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 2/44 (5%)
 Frame = +1

Query  316  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            K+W+E  ++QD GMDELLAVLGYKVK SDMAEVAQKLEQLEEVM
Sbjct  27   KVWDEESAQQDCGMDELLAVLGYKVKTSDMAEVAQKLEQLEEVM  70


 Score = 55.5 bits (132),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELNLG---DPF  560
            +Q D +S LASETVHYNPSDLS+W++SM+SELN     DPF
Sbjct  73   VQDDGISHLASETVHYNPSDLSTWLESMLSELNPPSTFDPF  113



>ref|XP_004298516.1| PREDICTED: DELLA protein GAIP [Fragaria vesca subsp. vesca]
Length=611

 Score = 73.6 bits (179),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 39/43 (91%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            MWEES+ D GMDELLAVLGYKVK+S MA+VAQK+EQLEE MG+
Sbjct  31   MWEESQHDDGMDELLAVLGYKVKSSSMADVAQKIEQLEEFMGT  73


 Score = 53.9 bits (128),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISEL  542
            G +Q D LS LAS+TVHYNPSDLS+W++SMISE+
Sbjct  72   GTVQQDGLSHLASDTVHYNPSDLSNWLESMISEI  105



>gb|KJB15415.1| hypothetical protein B456_002G177000 [Gossypium raimondii]
Length=617

 Score = 72.0 bits (175),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 2/44 (5%)
 Frame = +1

Query  316  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            K+W+E  ++QD GMDELLAVLGYKVK SDMAEVAQKLEQLEEVM
Sbjct  27   KVWDEEAAQQDCGMDELLAVLGYKVKTSDMAEVAQKLEQLEEVM  70


 Score = 55.5 bits (132),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELNLG---DPF  560
            +Q D +S LASETVHYNPSDLS+W++SM+SELN     DPF
Sbjct  73   VQDDGISHLASETVHYNPSDLSTWLESMLSELNPPSTFDPF  113



>ref|XP_007045197.1| GRAS family transcription factor family protein [Theobroma cacao]
 gb|EOY01029.1| GRAS family transcription factor family protein [Theobroma cacao]
Length=615

 Score = 72.4 bits (176),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 40/44 (91%), Gaps = 2/44 (5%)
 Frame = +1

Query  316  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW++  ++QD GMDELLAVLGYKVK SDMAEVAQKLEQLEEVM
Sbjct  32   KMWQDEVAQQDCGMDELLAVLGYKVKTSDMAEVAQKLEQLEEVM  75


 Score = 54.7 bits (130),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            +Q D +S LASETVHYNPSDLS+W++SM+SELN
Sbjct  78   VQDDGISHLASETVHYNPSDLSTWLESMLSELN  110



>gb|AEX97109.1| spur-type DELLA protein [Malus domestica]
Length=635

 Score = 70.9 bits (172),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWE+  Q  D GMDELLAVLGYKV++SDMA+VAQKLEQLEE MG
Sbjct  37   KMWEDESQRMDGGMDELLAVLGYKVRSSDMADVAQKLEQLEEFMG  81


 Score = 56.2 bits (134),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNPSDLS+W+++MISE+N+  P
Sbjct  81   GCAQEDGLSQLASDTVHYNPSDLSTWLETMISEINVPPP  119



>gb|ADW85805.1| DELLA protein [Malus domestica]
Length=635

 Score = 70.9 bits (172),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWE+  Q  D GMDELLAVLGYKV++SDMA+VAQKLEQLEE MG
Sbjct  37   KMWEDESQRMDGGMDELLAVLGYKVRSSDMADVAQKLEQLEEFMG  81


 Score = 56.2 bits (134),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNPSDLS+W+++MISE+N+  P
Sbjct  81   GCAQEDGLSQLASDTVHYNPSDLSTWLETMISEINVPPP  119



>gb|AGK07287.1| GAI1 [Rosa hybrid cultivar]
Length=618

 Score = 72.8 bits (177),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 41/43 (95%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            +WE+S++D GMDELLAVLGYKVK+S+MA+VAQKLEQLEE MG+
Sbjct  31   IWEDSQRDDGMDELLAVLGYKVKSSNMADVAQKLEQLEEFMGT  73


 Score = 53.9 bits (128),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISEL  542
            G +Q D LS LAS+TVHYNPSDLS+W++SMISE+
Sbjct  72   GTVQEDGLSQLASDTVHYNPSDLSTWLESMISEI  105



>gb|ACL68359.1| DELLA protein [Malus baccata var. xiaojinensis]
Length=636

 Score = 70.5 bits (171),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMW++  Q  D GMDELLAVLGYKV++SDMAEVAQKLEQLEE MG
Sbjct  38   KMWKDESQRIDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEFMG  82


 Score = 56.2 bits (134),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSA-ITRNSTQI  614
            G  Q D LS LAS+ VHYNP+DLS+W++SMISE+NL  P     T  + A +  N  Q+
Sbjct  82   GCAQEDGLSQLASDAVHYNPADLSTWLESMISEINLPPPNFDPLTGGAVAGVQPNQQQV  140



>gb|AEK06229.1| GAI1 [Vitis vinifera]
Length=590

 Score = 70.5 bits (171),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+ + +QDAGMDELLAVLGY VKASDMAEVAQ+LEQLEEV+
Sbjct  22   KMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQELEQLEEVI  64


 Score = 56.2 bits (134),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 41/72 (57%), Gaps = 10/72 (14%)
 Frame = +3

Query  450  QGDDLSSLASETVHYNPSDLSSWVDSMISELN------LGDPFLSSQTE----SSSAITR  599
            Q D LS LASETVHYNPSDLS+W+ SM+SE N      L +PFL   +     + S   +
Sbjct  68   QEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYTNCSTQPK  127

Query  600  NSTQIFDDSSFD  635
                IFD  S D
Sbjct  128  QEPSIFDSPSLD  139



>gb|ABL61270.1| GAI1 [Malus hupehensis]
Length=638

 Score = 69.7 bits (169),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMW++  Q  D GMDELLAVLGYKV++SDMA+VAQKLEQLEE MG
Sbjct  37   KMWDDESQRMDGGMDELLAVLGYKVRSSDMADVAQKLEQLEEFMG  81


 Score = 56.2 bits (134),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNPSDLS+W+++MISE+N+  P
Sbjct  81   GCAQEDGLSQLASDTVHYNPSDLSTWLETMISEINVPPP  119



>gb|ACR58455.1| GAI/RGA protein [Gossypium hirsutum]
Length=616

 Score = 70.5 bits (171),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 40/44 (91%), Gaps = 2/44 (5%)
 Frame = +1

Query  316  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            K+W+E  ++QD GMDELLAVLGYKVK SDMAEVA+KLEQLEEVM
Sbjct  27   KVWDEESAQQDCGMDELLAVLGYKVKTSDMAEVARKLEQLEEVM  70


 Score = 55.5 bits (132),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 3/41 (7%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELNLG---DPF  560
            +Q D +S LASETVHYNPSDLS+W++SM+SELN     DPF
Sbjct  73   VQDDGISHLASETVHYNPSDLSTWLESMLSELNPPSTFDPF  113



>ref|XP_011023720.1| PREDICTED: DELLA protein GAIP-B-like [Populus euphratica]
Length=602

 Score = 70.9 bits (172),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +1

Query  316  KMWEESE---QDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            K+W E E    D GMDELLAVLGYKV++SDMAEVAQKLEQLEEVMG
Sbjct  41   KIWAEGEGHQADGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMG  86


 Score = 54.7 bits (130),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D LS LAS++VHYNPSDLS+W++SMISELN
Sbjct  86   GHAQEDGLSHLASDSVHYNPSDLSTWLESMISELN  120



>ref|XP_011038614.1| PREDICTED: DELLA protein GAIP [Populus euphratica]
Length=602

 Score = 70.9 bits (172),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +1

Query  316  KMWEE---SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            K WEE    + D GMDELLAVLGYKV++SDMAEVAQKLEQLEEVMG
Sbjct  40   KTWEEEKGRQADGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMG  85


 Score = 53.9 bits (128),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPF  560
            G  Q D LS LAS++VHYNPSDLS+W++SM+SELN    F
Sbjct  85   GHAQEDGLSHLASDSVHYNPSDLSTWLESMLSELNPNHHF  124



>ref|XP_002314799.2| hypothetical protein POPTR_0010s12080g [Populus trichocarpa]
 gb|EEF00970.2| hypothetical protein POPTR_0010s12080g [Populus trichocarpa]
Length=602

 Score = 70.9 bits (172),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 3/46 (7%)
 Frame = +1

Query  316  KMWEE---SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            K WEE    + D GMDELLAVLGYKV++SDMAEVAQKLEQLEEVMG
Sbjct  40   KTWEEEKGRQADGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMG  85


 Score = 53.9 bits (128),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPF  560
            G  Q D LS LAS++VHYNPSDLS+W++SM+SELN    F
Sbjct  85   GHAQEDGLSHLASDSVHYNPSDLSTWLESMLSELNPNHHF  124



>ref|XP_010274729.1| PREDICTED: DELLA protein GAI1-like [Nelumbo nucifera]
Length=602

 Score = 68.9 bits (167),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 42/45 (93%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E EQ DAG+DELLAVLGYKV++S+MAEVAQKLEQL+ V+GS
Sbjct  28   KMWDELEQQDAGVDELLAVLGYKVRSSEMAEVAQKLEQLDMVLGS  72


 Score = 55.5 bits (132),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D LS LASETVHYNPSDL +W++SM+SELN
Sbjct  71   GSAQEDGLSHLASETVHYNPSDLGTWLESMLSELN  105



>ref|XP_006448223.1| hypothetical protein CICLE_v10017466mg [Citrus clementina]
 gb|ESR61463.1| hypothetical protein CICLE_v10017466mg [Citrus clementina]
Length=594

 Score = 75.5 bits (184),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSF  450
            KMWEE + D GMDELLAVLGY V++SDM EVAQK+EQLEE MG+F
Sbjct  29   KMWEEEQTDGGMDELLAVLGYNVRSSDMVEVAQKIEQLEEAMGAF  73


 Score = 48.5 bits (114),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 20/71 (28%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN------LG-DPFLSSQTESSSAITR  599
            G  Q D ++ LAS+TVHY+PS+L +W++SM++E N      LG DP              
Sbjct  71   GAFQADGINHLASDTVHYDPSNLCTWLESMLTEFNPTMPAGLGLDPV-------------  117

Query  600  NSTQIFDDSSF  632
             +  +FDDSSF
Sbjct  118  PAPSVFDDSSF  128



>ref|XP_009349514.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=634

 Score = 66.2 bits (160),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 37/45 (82%), Gaps = 2/45 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWE+     D GMDELLAVLGYKV +S+MAEVAQKLEQLEE MG
Sbjct  36   KMWEDESHRIDGGMDELLAVLGYKVWSSNMAEVAQKLEQLEEFMG  80


 Score = 57.4 bits (137),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNP+DLS+W++SMISE+NL  P
Sbjct  80   GCAQEDGLSQLASDTVHYNPADLSTWLESMISEINLPPP  118



>gb|AAY56752.1| DELLA protein [Malus domestica]
Length=635

 Score = 68.6 bits (166),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 2/44 (5%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMWE+  Q  D GMDELLAVLGYKV++SDMA+VAQKLEQLEE M
Sbjct  37   KMWEDESQRMDGGMDELLAVLGYKVRSSDMADVAQKLEQLEEFM  80


 Score = 55.1 bits (131),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  450  QGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            Q D LS LAS+TVHYNPSDLS+W+++MISE+N+  P
Sbjct  84   QEDGLSQLASDTVHYNPSDLSTWLETMISEINVPPP  119



>gb|AFP58844.1| DELLA domain GRAS family transcription factor GAI [Populus tomentosa]
Length=603

 Score = 69.3 bits (168),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 3/44 (7%)
 Frame = +1

Query  322  WEE---SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            WEE    + D GMDELLAVLGYKV++SDMAEVAQKLEQLEEVMG
Sbjct  42   WEEEKGRQADGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVMG  85


 Score = 54.3 bits (129),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D LS LAS++VHYNPSDLS+W+ SMISELN
Sbjct  85   GHAQEDGLSHLASDSVHYNPSDLSTWLQSMISELN  119



>gb|KDP38079.1| hypothetical protein JCGZ_04722 [Jatropha curcas]
Length=623

 Score = 70.1 bits (170),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            K+WE E++ D GMDELLAVLGYKV++SDMAEVAQKLEQLEEVM
Sbjct  41   KIWEDEAQGDGGMDELLAVLGYKVRSSDMAEVAQKLEQLEEVM  83


 Score = 53.1 bits (126),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            +Q D LS L+SETVHYNPSD+S+W++SM+SELN
Sbjct  86   VQEDGLSHLSSETVHYNPSDISTWLESMLSELN  118



>dbj|BAF62637.1| DELLA protein [Phaseolus vulgaris]
Length=596

 Score = 69.7 bits (169),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 2/46 (4%)
 Frame = +1

Query  316  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMWEE   +Q  GMDELLA LGYKV+ASDMA+VAQKLEQLE VMGS
Sbjct  27   KMWEEDRHQQGGGMDELLAALGYKVRASDMADVAQKLEQLEMVMGS  72


 Score = 53.1 bits (126),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 8/73 (11%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN-----LGDP--FLSSQTESSSAITR  599
            G  Q + +S L+S TVHY+P+DL SWV SM+SELN     + DP  FL      SS I  
Sbjct  71   GSAQEEGISHLSSYTVHYDPTDLHSWVQSMLSELNPEPTTILDPSSFLIDNPVHSSPILT  130

Query  600  NSTQIF-DDSSFD  635
             ++++F DDS +D
Sbjct  131  TTSRVFNDDSEYD  143



>ref|XP_007163387.1| hypothetical protein PHAVU_001G230500g [Phaseolus vulgaris]
 gb|ESW35381.1| hypothetical protein PHAVU_001G230500g [Phaseolus vulgaris]
Length=596

 Score = 69.7 bits (169),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 39/46 (85%), Gaps = 2/46 (4%)
 Frame = +1

Query  316  KMWEE--SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMWEE   +Q  GMDELLA LGYKV+ASDMA+VAQKLEQLE VMGS
Sbjct  27   KMWEEDRHQQGGGMDELLAALGYKVRASDMADVAQKLEQLEMVMGS  72


 Score = 53.1 bits (126),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 8/73 (11%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN-----LGDP--FLSSQTESSSAITR  599
            G  Q + +S L+S TVHY+P+DL SWV SM+SELN     + DP  FL      SS I  
Sbjct  71   GSAQEEGISHLSSYTVHYDPTDLHSWVQSMLSELNPEPTTILDPSSFLIDNPVHSSPILT  130

Query  600  NSTQIF-DDSSFD  635
             ++++F DDS +D
Sbjct  131  TTSRVFNDDSEYD  143



>ref|XP_006469195.1| PREDICTED: DELLA protein GAIP-B-like [Citrus sinensis]
Length=594

 Score = 75.5 bits (184),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSF  450
            KMWEE + D GMDELLAVLGY V++SDM EVAQK+EQLEE MG+F
Sbjct  29   KMWEEEQTDGGMDELLAVLGYNVRSSDMVEVAQKIEQLEEAMGAF  73


 Score = 47.8 bits (112),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D ++ LAS+TVHY+PS+L +W++SM++E N
Sbjct  71   GAFQADGINHLASDTVHYDPSNLCTWLESMLTEFN  105



>ref|XP_011070609.1| PREDICTED: DELLA protein GAI1 [Sesamum indicum]
Length=569

 Score = 68.2 bits (165),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW    ++AG+DEL AVLGY VK+SDMAEVAQK++QLEEVMGS
Sbjct  24   KMWSCEAEEAGVDELFAVLGYNVKSSDMAEVAQKIQQLEEVMGS  67


 Score = 53.9 bits (128),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMIS  536
            G +Q D LS LASETVHYNPSDLSSW++SMIS
Sbjct  66   GSVQHDGLSHLASETVHYNPSDLSSWLESMIS  97



>dbj|BAM14051.1| DELLA 1 sprice variant [Lactuca sativa]
Length=353

 Score = 69.3 bits (168),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E  EQDAG+DELLAVLGYKVK+SDMA+VAQK+E LE V+G+
Sbjct  41   KMWDEVEEQDAGVDELLAVLGYKVKSSDMADVAQKIEHLEGVLGN  85


 Score = 52.4 bits (124),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELN  545
            +G L  DD LS LAS++VHYNPSDLSSW++SMI ELN
Sbjct  80   EGVLGNDDGLSQLASDSVHYNPSDLSSWLESMICELN  116



>ref|XP_010553798.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=611

 Score = 68.9 bits (167),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSF  450
            E+D GMDELLAVLGYKVK+S+MAEVAQKLEQLEE+MG F
Sbjct  31   EEDGGMDELLAVLGYKVKSSEMAEVAQKLEQLEEMMGHF  69


 Score = 52.8 bits (125),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D LS  A+ETVHYNPS+L +W+DSM+SE N
Sbjct  67   GHFQEDGLSHFATETVHYNPSELYTWLDSMLSEFN  101



>dbj|BAG71200.1| DELLA 1 [Lactuca sativa]
Length=569

 Score = 68.9 bits (167),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E  EQDAG+DELLAVLGYKVK+SDMA+VAQK+E LE V+G+
Sbjct  41   KMWDEVEEQDAGVDELLAVLGYKVKSSDMADVAQKIEHLEGVLGN  85


 Score = 52.0 bits (123),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELN  545
            +G L  DD LS LAS++VHYNPSDLSSW++SMI ELN
Sbjct  80   EGVLGNDDGLSQLASDSVHYNPSDLSSWLESMICELN  116



>ref|XP_006826893.1| hypothetical protein AMTR_s00010p00148880 [Amborella trichopoda]
 gb|ERM94130.1| hypothetical protein AMTR_s00010p00148880 [Amborella trichopoda]
Length=556

 Score = 63.9 bits (154),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
             QDAG+DELLA LGY V+ASDMAEVAQKLEQLE VMG+
Sbjct  25   PQDAGVDELLASLGYNVRASDMAEVAQKLEQLEMVMGT  62


 Score = 56.6 bits (135),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 4/44 (9%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISEL----NLGDPF  560
            G  Q D +S LASETVHYNPSD+++W++SM++EL    NLG P+
Sbjct  61   GTAQEDGISHLASETVHYNPSDIATWIESMLTELNFPPNLGAPY  104



>gb|AEE69074.2| GAI-like protein [Juglans regia]
Length=613

 Score = 63.9 bits (154),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = +1

Query  313  KKMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K  WE E + D GMDELLAVLGY+V++SDMAEVAQKLE LE++MG+
Sbjct  31   KMCWEDEVQPDGGMDELLAVLGYQVRSSDMAEVAQKLELLEDLMGN  76


 Score = 57.0 bits (136),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  QGD LS LA++TVHYNPSDLS+W+ SM+SELN
Sbjct  75   GNAQGDGLSQLATDTVHYNPSDLSTWLQSMLSELN  109



>ref|XP_011021384.1| PREDICTED: DELLA protein GAI-like [Populus euphratica]
Length=608

 Score = 67.8 bits (164),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+W E +QDAG MDELLAVLGYK+K+S+MA+VAQKLEQLE V+GS
Sbjct  33   KLWVEDDQDAGGMDELLAVLGYKIKSSEMADVAQKLEQLEMVLGS  77


 Score = 52.0 bits (123),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISELN  545
            D +S LAS+TVHYNPSDLS WV SM+SELN
Sbjct  79   DGISHLASDTVHYNPSDLSGWVQSMLSELN  108



>gb|AHB17742.1| GA repressor DELLA [Actinidia deliciosa]
Length=551

 Score = 62.8 bits (151),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 5/43 (12%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWEE++     DELLAVLGY VKASDM EVAQKLE LEEVMG
Sbjct  29   KMWEEND-----DELLAVLGYNVKASDMNEVAQKLEHLEEVMG  66


 Score = 57.0 bits (136),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G+ Q D L+ LASE+VHYNPSDLSSW++SMISELN
Sbjct  66   GQAQEDGLTHLASESVHYNPSDLSSWLESMISELN  100



>emb|CBI26874.3| unnamed protein product [Vitis vinifera]
Length=408

 Score = 72.0 bits (175),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 40/43 (93%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+ + +QDAGMDELLAVLGY VKASDMAEVAQKLEQLEEV+
Sbjct  31   KMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQLEEVI  73


 Score = 47.8 bits (112),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  450  QGDDLSSLASETVHYNPSDLSSWVDSMISE  539
            Q D LS LASETVHYNPSDLS+W+ SM+S+
Sbjct  77   QEDGLSHLASETVHYNPSDLSNWLGSMLSD  106



>ref|XP_006383329.1| hypothetical protein POPTR_0005s14540g [Populus trichocarpa]
 gb|ERP61126.1| hypothetical protein POPTR_0005s14540g [Populus trichocarpa]
Length=619

 Score = 67.8 bits (164),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 41/45 (91%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+W E +QDAG MDELLAVLGYK+K+S+MA+VAQKLEQLE V+GS
Sbjct  33   KLWVEDDQDAGGMDELLAVLGYKIKSSEMADVAQKLEQLEMVLGS  77


 Score = 52.0 bits (123),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISELN  545
            D +S LAS+TVHYNPSDLS WV SM+SELN
Sbjct  79   DGISHLASDTVHYNPSDLSGWVQSMLSELN  108



>gb|AHB17743.1| GA repressor DELLA [Actinidia deliciosa]
Length=550

 Score = 62.8 bits (151),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 5/43 (12%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWEE++     DELLAVLGY VKASDM EVAQKLE LEEVMG
Sbjct  29   KMWEEND-----DELLAVLGYNVKASDMNEVAQKLEHLEEVMG  66


 Score = 57.0 bits (136),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G+ Q D L+ LASE+VHYNPSDLSSW++SMISELN
Sbjct  66   GQAQEDGLTHLASESVHYNPSDLSSWLESMISELN  100



>ref|XP_007033025.1| GRAS family transcription factor family protein [Theobroma cacao]
 gb|EOY03951.1| GRAS family transcription factor family protein [Theobroma cacao]
Length=655

 Score = 69.7 bits (169),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WEE ++  GMDELLAVLGYKV+ SDMA+VAQKLEQLE VMG+
Sbjct  34   KLWEEEQEAGGMDELLAVLGYKVRYSDMADVAQKLEQLEMVMGT  77


 Score = 49.7 bits (117),  Expect(2) = 2e-18, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D +S L+ +T+HYNPSDLS WV SM++ELN
Sbjct  76   GTAQEDGISHLSCDTIHYNPSDLSGWVQSMLTELN  110



>ref|XP_002266267.1| PREDICTED: DELLA protein GAI-like [Vitis vinifera]
Length=613

 Score = 68.2 bits (165),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW++ +Q DAGMDELLAVLGY V++SDM +VAQKLEQLE VMG+
Sbjct  33   KMWDDGQQQDAGMDELLAVLGYNVRSSDMVDVAQKLEQLEMVMGN  77


 Score = 50.8 bits (120),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D +S L+S TVHYNPSDLS WV SM++ELN
Sbjct  76   GNAQEDGISHLSSGTVHYNPSDLSGWVQSMLTELN  110



>ref|XP_002305198.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
 gb|EEE85709.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
Length=607

 Score = 68.6 bits (166),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K W E +QDAG MDELLAVLGYK+K+SDMA+VAQKLEQLE V+GS
Sbjct  30   KSWVEDDQDAGGMDELLAVLGYKIKSSDMADVAQKLEQLEMVLGS  74


 Score = 50.4 bits (119),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISELN  545
            D +S LAS+TVHYNPSDLS WV SM+SE N
Sbjct  76   DGISHLASDTVHYNPSDLSGWVQSMLSEFN  105



>gb|KDO64603.1| hypothetical protein CISIN_1g043131mg [Citrus sinensis]
Length=592

 Score = 70.5 bits (171),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = +1

Query  316  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSF  450
            KMWEE + D G MDELLAVLGY V++SDM EVAQK+EQLEE MG+F
Sbjct  26   KMWEEEQTDGGGMDELLAVLGYNVRSSDMVEVAQKIEQLEEAMGAF  71


 Score = 47.8 bits (112),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 20/71 (28%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN------LG-DPFLSSQTESSSAITR  599
            G  Q D ++ LA++TVHY+PS+L +W++SM++E N      LG DP              
Sbjct  69   GAFQADGINHLATDTVHYDPSNLCTWLESMLTEFNPTMPAGLGLDPV-------------  115

Query  600  NSTQIFDDSSF  632
             +  +FDDSSF
Sbjct  116  PAPSVFDDSSF  126



>ref|XP_006482132.1| PREDICTED: DELLA protein GAI-like [Citrus sinensis]
 gb|KDO50841.1| hypothetical protein CISIN_1g008153mg [Citrus sinensis]
Length=576

 Score = 67.8 bits (164),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMWEE +   GMDELL VLGYKV++S+MA+VAQKLEQLE VMG+
Sbjct  31   KMWEEEQDTGGMDELLEVLGYKVRSSEMADVAQKLEQLEMVMGT  74


 Score = 50.8 bits (120),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (56%), Gaps = 12/77 (16%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN----------LGDPFLSSQTESS-S  587
            G  Q D +S LA++TVHYNPSD+S WV SM+  LN          + DP  SS   S   
Sbjct  73   GTAQEDGISHLATDTVHYNPSDVSGWVQSMLEGLNNTGFDSQARPIQDPAESSTVNSILG  132

Query  588  AITRNSTQIF-DDSSFD  635
              T N ++IF DDS +D
Sbjct  133  QQTSNQSRIFNDDSEYD  149



>gb|EPS61323.1| hypothetical protein M569_13471, partial [Genlisea aurea]
Length=549

 Score = 59.3 bits (142),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  340  DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            D+G+DEL AVLGY V++SDMAEVAQK++QLEE MG+
Sbjct  4    DSGVDELFAVLGYNVRSSDMAEVAQKIQQLEEAMGN  39


 Score = 58.9 bits (141),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 38/55 (69%), Gaps = 7/55 (13%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNL-------GDPFLSSQTESS  584
            G +Q D LS LAS+T+HYNPSDLSSW++SMIS LN         DPFL S T +S
Sbjct  38   GNVQRDGLSQLASDTIHYNPSDLSSWLESMISGLNPLPDFDSSADPFLDSSTVTS  92



>dbj|BAG71201.1| DELLA 2 [Lactuca sativa]
Length=590

 Score = 67.0 bits (162),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = +1

Query  313  KKMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K MW+E  +QDAG+DELLAVLGYKVK+SDM +VAQK+E LE V+G+
Sbjct  48   KNMWDEFDDQDAGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLGN  93


 Score = 51.2 bits (121),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 31/37 (84%), Gaps = 1/37 (3%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELN  545
            +G L  DD LS +AS++VHYNPSDLSSW++SMI ELN
Sbjct  88   EGVLGNDDGLSQIASDSVHYNPSDLSSWLESMICELN  124



>ref|XP_010554410.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=609

 Score = 63.9 bits (154),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KM +E +   GMDELLAVLGYKV++S+MA+VAQKLEQLEE+MG+
Sbjct  28   KMVKEEDDGGGMDELLAVLGYKVRSSEMADVAQKLEQLEEMMGN  71


 Score = 53.9 bits (128),  Expect(2) = 5e-18, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSA  590
            G +Q D LS LA+ETVH+NPS+L +W+DSM++ELN   P  S+ T +  A
Sbjct  70   GNVQEDGLSHLATETVHHNPSELCTWLDSMLTELN---PLPSASTSAVGA  116



>sp|Q6EI06.1|GAIP_CUCMA RecName: Full=DELLA protein GAIP; AltName: Full=CmGAIP; Short=GAIP; 
AltName: Full=Gibberellic acid-insensitive phloem protein 
[Cucurbita maxima]
 gb|AAQ96164.1| gibberellic acid insensitive phloem [Cucurbita maxima]
Length=579

 Score = 69.3 bits (168),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            K+WEE  Q D GMDELLAVLGYKVK+SDMAEVAQKLEQLEE M
Sbjct  33   KLWEEEVQLDGGMDELLAVLGYKVKSSDMAEVAQKLEQLEEAM  75


 Score = 48.5 bits (114),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  444  ELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            ++Q   LS LA +TVHYNPSDLS+WV+SM++EL+
Sbjct  77   QVQDTGLSHLAFDTVHYNPSDLSTWVESMLTELH  110



>sp|Q6EI05.1|GAIPB_CUCMA RecName: Full=DELLA protein GAIP-B; AltName: Full=CmGAIP-B; Short=GAIP-B; 
AltName: Full=Gibberellic acid-insensitive phloem 
protein B [Cucurbita maxima]
 gb|AAQ96165.1| gibberellic acid insensitive phloem B [Cucurbita maxima]
Length=587

 Score = 70.1 bits (170),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/43 (84%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            K+WEE  Q D GMDELLAVLGYKVK+SDMAEVAQKLEQLEE M
Sbjct  33   KLWEEDAQLDGGMDELLAVLGYKVKSSDMAEVAQKLEQLEEAM  75


 Score = 47.4 bits (111),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  444  ELQGDDLSSLASETVHYNPSDLSSWVDSMISEL  542
            ++Q   LS LA +TVHYNPSDLS+W++SMI+EL
Sbjct  77   QVQDTGLSHLAFDTVHYNPSDLSTWLESMITEL  109



>gb|EYU25601.1| hypothetical protein MIMGU_mgv1a003589mg [Erythranthe guttata]
Length=576

 Score = 61.2 bits (147),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  316  KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMW  E+E  AG DEL AVLGYKV  SDMAEVA K++QLEE MG
Sbjct  25   KMWSSEAEDSAGFDELFAVLGYKVNTSDMAEVALKIKQLEEAMG  68


 Score = 56.6 bits (135),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 35/50 (70%), Gaps = 7/50 (14%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN----LG---DPFLSSQT  575
            + G  LS LAS+TVHYNPSDLSSW+DSMIS LN     G   DPFL S T
Sbjct  67   MGGGGLSQLASDTVHYNPSDLSSWLDSMISGLNPVPEFGSSSDPFLDSST  116



>ref|XP_011002785.1| PREDICTED: DELLA protein GAI [Populus euphratica]
Length=603

 Score = 67.4 bits (163),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K W E +QDAG MDELLAVLGYK+K+SDMA VAQKLEQLE V+GS
Sbjct  30   KSWVEDDQDAGGMDELLAVLGYKIKSSDMAGVAQKLEQLEMVLGS  74


 Score = 50.4 bits (119),  Expect(2) = 6e-18, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISELN  545
            D +S LAS+TVHYNPSDLS WV SM+SE N
Sbjct  76   DGISHLASDTVHYNPSDLSGWVQSMLSEFN  105



>ref|XP_006430617.1| hypothetical protein CICLE_v10011367mg [Citrus clementina]
 gb|ESR43857.1| hypothetical protein CICLE_v10011367mg [Citrus clementina]
Length=576

 Score = 66.6 bits (161),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMWEE +   GMDELL VLGYKV++S+MA+VAQKLEQLE VMG+
Sbjct  31   KMWEEEQDTEGMDELLEVLGYKVRSSEMADVAQKLEQLEMVMGT  74


 Score = 50.8 bits (120),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (56%), Gaps = 12/77 (16%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN----------LGDPFLSSQTESS-S  587
            G  Q D +S LA++TVHYNPSD+S WV SM+  LN          + DP  SS   S   
Sbjct  73   GTAQEDGISHLATDTVHYNPSDVSGWVQSMLEGLNNTGFDSQARPIQDPAESSTVNSILG  132

Query  588  AITRNSTQIF-DDSSFD  635
              T N ++IF DDS +D
Sbjct  133  QQTSNQSRIFNDDSEYD  149



>ref|XP_004150593.1| PREDICTED: DELLA protein GAIP-B-like [Cucumis sativus]
 emb|CBX88046.1| gibberellin DELLA protein, partial [Cucumis sativus]
 gb|KGN51488.1| DELLA protein GAIP-B [Cucumis sativus]
Length=586

 Score = 68.9 bits (167),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            K+WEE  Q D GMDELLAVLGYKVK+SDMA+VAQKLEQLEE M
Sbjct  33   KLWEEEAQLDGGMDELLAVLGYKVKSSDMADVAQKLEQLEEAM  75


 Score = 48.5 bits (114),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 20/82 (24%)
 Frame = +3

Query  444  ELQGDDLSSLASETVHYNPSDLSSWVDSMISELN-------------LGDPFLSSQTESS  584
            ++Q   LS LA +TVHYNPSDLS+W++SM++EL+             L DP   +  ESS
Sbjct  77   QVQDTGLSHLAFDTVHYNPSDLSTWLESMLTELHPMPNFATPPPPSQLDDPSFLAPAESS  136

Query  585  SAIT-------RNSTQIFDDSS  629
            +  +       + S++IF++SS
Sbjct  137  TITSIDYDPQRQTSSRIFEESS  158



>ref|XP_010109004.1| hypothetical protein L484_027201 [Morus notabilis]
 gb|EXC20644.1| hypothetical protein L484_027201 [Morus notabilis]
Length=584

 Score = 67.8 bits (164),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 2/46 (4%)
 Frame = +1

Query  316  KMW-EESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW +E EQ+AG MDELLAVLGYKV++SDMAEVAQKLEQLE V+GS
Sbjct  40   KMWTQEEEQEAGGMDELLAVLGYKVRSSDMAEVAQKLEQLEMVLGS  85


 Score = 49.7 bits (117),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 42/68 (62%), Gaps = 4/68 (6%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN--LGDPFLSSQTESSSAITRNSTQI  614
            G  Q D +S L S+TVHYNPSDLS WV SM+SELN  + D  L S  ++ +     S  +
Sbjct  84   GSAQEDGISQL-SDTVHYNPSDLSGWVQSMLSELNPQIDDNTLLSNNQTPNTNHNQSHVV  142

Query  615  F-DDSSFD  635
            F DDS +D
Sbjct  143  FHDDSEYD  150



>ref|XP_004166672.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAIP-B-like [Cucumis 
sativus]
Length=586

 Score = 68.9 bits (167),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            K+WEE  Q D GMDELLAVLGYKVK+SDMA+VAQKLEQLEE M
Sbjct  33   KLWEEEAQLDGGMDELLAVLGYKVKSSDMADVAQKLEQLEEAM  75


 Score = 48.5 bits (114),  Expect(2) = 7e-18, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 48/82 (59%), Gaps = 20/82 (24%)
 Frame = +3

Query  444  ELQGDDLSSLASETVHYNPSDLSSWVDSMISELN-------------LGDPFLSSQTESS  584
            ++Q   LS LA +TVHYNPSDLS+W++SM++EL+             L DP   +  ESS
Sbjct  77   QVQDTGLSHLAFDTVHYNPSDLSTWLESMLTELHPMPNFATPPPPSQLDDPSFLAPAESS  136

Query  585  SAIT-------RNSTQIFDDSS  629
            +  +       + S++IF++SS
Sbjct  137  TITSIDYDPQRQTSSRIFEESS  158



>emb|CAN59753.1| hypothetical protein VITISV_036639 [Vitis vinifera]
Length=580

 Score = 66.6 bits (161),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  319  MWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            MW++ +Q DAGMDELLAVLGY V++SDM +VAQKLEQLE VMG+
Sbjct  1    MWDDGQQQDAGMDELLAVLGYNVRSSDMVDVAQKLEQLEMVMGN  44


 Score = 50.8 bits (120),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D +S L+S TVHYNPSDLS WV SM++ELN
Sbjct  43   GNAQEDGISHLSSGTVHYNPSDLSGWVQSMLTELN  77



>ref|XP_008467128.1| PREDICTED: DELLA protein GAIP-B [Cucumis melo]
Length=586

 Score = 68.9 bits (167),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            K+WEE  Q D GMDELLAVLGYKVK+SDMA+VAQKLEQLEE M
Sbjct  33   KLWEEEAQLDGGMDELLAVLGYKVKSSDMADVAQKLEQLEEAM  75


 Score = 47.8 bits (112),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 4/52 (8%)
 Frame = +3

Query  444  ELQGDDLSSLASETVHYNPSDLSSWVDSMISEL----NLGDPFLSSQTESSS  587
            ++Q   LS LA +TVHYNPSDLS+W++SM++EL    N   P   SQ + SS
Sbjct  77   QVQDTGLSHLAFDTVHYNPSDLSTWLESMLTELHPMPNFATPPPPSQLDDSS  128



>gb|ABS50250.1| DELLA protein [Malus hupehensis]
Length=580

 Score = 60.1 bits (144),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +1

Query  316  KMWEESEQDAG---MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WE+ +  +G   MDELLAVLGYKV+  DMA+VA+KLEQLE VMGS
Sbjct  34   KIWEDEQGYSGGGDMDELLAVLGYKVRTDDMADVAEKLEQLEMVMGS  80


 Score = 56.2 bits (134),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 45/77 (58%), Gaps = 13/77 (17%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGD-------PFL----SSQTESSS  587
            G  Q D +S L S+TVHYNPSDLS WV SM+SELN GD       P L    SS   S+S
Sbjct  79   GSAQEDGVSQL-SDTVHYNPSDLSGWVQSMLSELNTGDDMPSINGPLLAPGESSTITSTS  137

Query  588  AITRNSTQIF-DDSSFD  635
                  T++F DDS +D
Sbjct  138  FCNSQRTRVFSDDSEYD  154



>ref|XP_008381346.1| PREDICTED: DELLA protein GAI [Malus domestica]
Length=580

 Score = 59.7 bits (143),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +1

Query  316  KMWEESEQDAG---MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WE+ +  +G   MDELLAVLGYKV+  DMA+VA+KLEQLE VMGS
Sbjct  34   KIWEDEQGYSGGGDMDELLAVLGYKVRTDDMADVAEKLEQLEMVMGS  80


 Score = 56.2 bits (134),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 45/77 (58%), Gaps = 13/77 (17%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGD-------PFL----SSQTESSS  587
            G  Q D +S L S+TVHYNPSDLS WV SM+SELN GD       P L    SS   S+S
Sbjct  79   GSAQEDGVSQL-SDTVHYNPSDLSGWVQSMLSELNTGDDMPSINGPLLAPGESSTITSTS  137

Query  588  AITRNSTQIF-DDSSFD  635
                  T++F DDS +D
Sbjct  138  FCNSQRTRVFSDDSEYD  154



>ref|XP_002534030.1| DELLA protein GAI, putative [Ricinus communis]
 gb|EEF28350.1| DELLA protein GAI, putative [Ricinus communis]
Length=567

 Score = 61.6 bits (148),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 30/34 (88%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  343  AGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
             GMDELLAVLGYKV++SDMAEVAQKLEQLE VMG
Sbjct  37   GGMDELLAVLGYKVRSSDMAEVAQKLEQLEMVMG  70


 Score = 53.9 bits (128),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 48/70 (69%), Gaps = 8/70 (11%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPF--LSSQTESSSAITRNSTQ-  611
            G  Q D +S L S+TVHYNPSDLS WV SM+SELN  +P   + +Q +SSS I+  ++Q 
Sbjct  70   GIAQEDGISHL-SDTVHYNPSDLSGWVQSMLSELN--NPLDTIQNQQDSSSVISFGNSQS  126

Query  612  -IF-DDSSFD  635
             IF DDS +D
Sbjct  127  GIFNDDSEYD  136



>gb|AHB17744.1| GA repressor DELLA [Actinidia deliciosa]
Length=550

 Score = 58.5 bits (140),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 34/43 (79%), Gaps = 5/43 (12%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWEE++     DELLAVLGY VKASDM  VA+KLE LEEVMG
Sbjct  29   KMWEEND-----DELLAVLGYNVKASDMNVVARKLEHLEEVMG  66


 Score = 57.0 bits (136),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G+ Q D L+ LASE+VHYNPSDLSSW++SMISELN
Sbjct  66   GQAQEDGLTHLASESVHYNPSDLSSWLESMISELN  100



>gb|AFC88481.1| DELLA protein [Rosa lucieae]
Length=562

 Score = 65.9 bits (159),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WEE ++   MDELLAVLGYKV++ DMA+VA+KLEQLE VMGS
Sbjct  27   KIWEEEQESGSMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGS  70


 Score = 49.7 bits (117),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 4/66 (6%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQ---  611
            G  Q D +S L S+TVHYNPSDLS W+ +M+SELN  D  LS+  +      +  TQ   
Sbjct  69   GSAQQDGISQL-SDTVHYNPSDLSGWLQTMLSELNPIDDVLSNSQQQKQKQKQIETQPRV  127

Query  612  IFDDSS  629
            I+DD+S
Sbjct  128  IYDDNS  133



>emb|CDP11067.1| unnamed protein product [Coffea canephora]
Length=195

 Score = 63.5 bits (153),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW + E D   DELLAVLGYKVKASDMAEVAQK+EQLEEV G+
Sbjct  72   KMWVD-ESDRQDDELLAVLGYKVKASDMAEVAQKIEQLEEVFGN  114


 Score = 51.6 bits (122),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISEL  542
            G  + D LS L SETVHYNPSDLSSW+ SMISE 
Sbjct  113  GNAENDSLSHLVSETVHYNPSDLSSWLGSMISEF  146



>gb|AEB36183.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 65.9 bits (159),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36192.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 66.2 bits (160),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 40/46 (87%), Gaps = 1/46 (2%)
 Frame = +1

Query  313  KKMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
             KMW+E +EQDAG+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  31   SKMWDEFNEQDAGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTIA  121



>gb|AEB36201.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 66.2 bits (160),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTIA  121



>ref|XP_010032696.1| PREDICTED: DELLA protein GAI [Eucalyptus grandis]
 gb|KCW52149.1| hypothetical protein EUGRSUZ_J01594 [Eucalyptus grandis]
Length=628

 Score = 66.2 bits (160),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 38/49 (78%), Gaps = 6/49 (12%)
 Frame = +1

Query  319  MWEESEQDAG------MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            MW E +QD        MDELLAVLGYKV++SDMAEVAQKLEQLE VMGS
Sbjct  48   MWGEDDQDPSGGGGGGMDELLAVLGYKVRSSDMAEVAQKLEQLEMVMGS  96


 Score = 48.9 bits (115),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 8/61 (13%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN-------LGDPFLSSQTESSSAITR  599
            G  Q D +S L+ + VHYNPSDLSSWV SM+ ELN       + D  L++  ESSS I +
Sbjct  95   GSAQEDGISHLSYDAVHYNPSDLSSWVQSMLFELNPPPPPQQVADAVLAA-AESSSTIAQ  153

Query  600  N  602
            +
Sbjct  154  H  154



>ref|XP_009796771.1| PREDICTED: DELLA protein GAI-like [Nicotiana sylvestris]
Length=568

 Score = 68.9 bits (167),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K++EE + DAGMDELLAVLGYKVK+SDMAEVAQKLEQLE  M +
Sbjct  20   KIFEEEQPDAGMDELLAVLGYKVKSSDMAEVAQKLEQLEMAMCT  63


 Score = 45.8 bits (107),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISELN  545
            D +S L+++TVH NPSDLS WV SM+SELN
Sbjct  67   DGISHLSTDTVHKNPSDLSGWVQSMLSELN  96



>ref|XP_010502135.1| PREDICTED: DELLA protein RGA-like [Camelina sativa]
Length=615

 Score = 58.5 bits (140),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M +E E  A MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  36   MVKEEEDGANMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  78


 Score = 56.2 bits (134),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 43/64 (67%), Gaps = 2/64 (3%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFD  620
            G +Q D LS LA++TVHYNPS+L SW+D+M++ELN   P  SS       +T  S +I +
Sbjct  77   GNVQEDGLSQLATDTVHYNPSELYSWLDNMLTELNPPPPGASSNVCLDPILT--SPEIVN  134

Query  621  DSSF  632
            ++SF
Sbjct  135  NNSF  138



>gb|AAY56749.1| DELLA protein [Malus domestica]
Length=580

 Score = 59.7 bits (143),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +1

Query  316  KMWEESEQDAG---MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WE+ +  +G   MDELLAVLGYKV+  DMA+VA+KLEQLE VMGS
Sbjct  34   KIWEDEQGYSGGGDMDELLAVLGYKVRTDDMADVAEKLEQLEMVMGS  80


 Score = 55.1 bits (131),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 45/77 (58%), Gaps = 13/77 (17%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGD-------PFL----SSQTESSS  587
            G  Q D +S L S+TVHYNPSDLS WV +M+SELN GD       P L    SS   S+S
Sbjct  79   GSAQEDGVSQL-SDTVHYNPSDLSGWVQNMLSELNTGDDMPSINGPLLAPGESSTITSTS  137

Query  588  AITRNSTQIF-DDSSFD  635
                  T++F DDS +D
Sbjct  138  FCNSQRTRVFSDDSEYD  154



>gb|AEX97110.1| spur-type DELLA protein [Malus domestica]
Length=580

 Score = 59.7 bits (143),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 3/47 (6%)
 Frame = +1

Query  316  KMWEESEQDAG---MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WE+ +  +G   MDELLAVLGYKV+  DMA+VA+KLEQLE VMGS
Sbjct  34   KIWEDEQGYSGGGDMDELLAVLGYKVRTDDMADVAEKLEQLEMVMGS  80


 Score = 54.7 bits (130),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 45/77 (58%), Gaps = 13/77 (17%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGD-------PFL----SSQTESSS  587
            G  Q D +S L S+TVHYNPSDLS WV +M+SELN GD       P L    SS   S+S
Sbjct  79   GSAQEDGVSQL-SDTVHYNPSDLSGWVQNMLSELNTGDDMPSINGPLLAPGESSTITSTS  137

Query  588  AITRNSTQIF-DDSSFD  635
                  T++F DDS +D
Sbjct  138  FCNSQRTRVFSDDSEYD  154



>ref|XP_010916517.1| PREDICTED: DELLA protein SLR1 isoform X1 [Elaeis guineensis]
 ref|XP_010916518.1| PREDICTED: DELLA protein SLR1 isoform X2 [Elaeis guineensis]
 ref|XP_010916519.1| PREDICTED: DELLA protein SLR1 isoform X3 [Elaeis guineensis]
Length=647

 Score = 60.8 bits (146),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KM    EQD G+DELLA LGYKV++SDMA+VA KLEQLE  MGS
Sbjct  27   KMTAMEEQDGGVDELLAALGYKVRSSDMADVALKLEQLEMAMGS  70


 Score = 53.5 bits (127),  Expect(2) = 5e-17, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQT  575
            LS LAS+TVHYNPSDLS+W++SM+SELN   P L S +
Sbjct  79   LSHLASDTVHYNPSDLSTWLESMLSELNTPPPPLPSAS  116



>gb|AFR90188.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
debilis subsp. debilis]
Length=225

 Score = 64.7 bits (156),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.7 bits (117),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36150.1| RGA-like 1, partial [Helianthus petiolaris]
Length=193

 Score = 65.1 bits (157),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 49.3 bits (116),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36151.1| RGA-like 1, partial [Helianthus petiolaris]
Length=192

 Score = 65.1 bits (157),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 49.3 bits (116),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36194.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.7 bits (117),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36147.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 65.1 bits (157),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36156.1| RGA-like 1, partial [Helianthus petiolaris]
Length=195

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36148.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AFR90189.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|AFR90190.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=225

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.7 bits (117),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36190.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36202.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTIA  121



>gb|AEB36149.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36313.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36314.1| RGA-like 1, partial [Helianthus annuus]
Length=191

 Score = 65.1 bits (157),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|ABG35336.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35337.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=228

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.7 bits (117),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36186.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTIA  121



>gb|ABG35317.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35344.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35345.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 64.3 bits (155),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.7 bits (117),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36200.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 4/53 (8%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAI  593
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTI  120



>gb|AEB36338.1| RGA-like 1, partial [Helianthus annuus]
Length=185

 Score = 65.1 bits (157),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 48.9 bits (115),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36307.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36308.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36336.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36337.1| RGA-like 1, partial [Helianthus annuus]
Length=185

 Score = 65.1 bits (157),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 49.3 bits (116),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36157.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36154.1| RGA-like 1, partial [Helianthus petiolaris]
Length=193

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36211.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36212.1| RGA-like 1, partial [Helianthus argophyllus]
Length=187

 Score = 65.1 bits (157),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 48.9 bits (115),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 4/53 (8%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAI  593
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTI  120



>gb|AEB36217.1| RGA-like 1, partial [Helianthus argophyllus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 4/53 (8%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAI  593
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTI  120



>gb|AEB36153.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSRTIA  121



>gb|ABG35316.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35318.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35319.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35320.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35321.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35322.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35323.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35326.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35327.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35328.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35329.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35330.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35331.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35332.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35334.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35335.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35342.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35343.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35346.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35347.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35348.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35349.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35350.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35351.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35352.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35353.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35354.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35355.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35356.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35357.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35358.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35359.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35360.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35361.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35362.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35363.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35364.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35365.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35366.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35367.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35368.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35369.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35370.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35371.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35372.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35373.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35374.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35375.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35376.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35377.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 64.3 bits (155),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.7 bits (117),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36297.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36298.1| RGA-like 1, partial [Helianthus annuus]
Length=192

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36179.1| RGA-like 1, partial [Helianthus exilis]
Length=182

 Score = 65.1 bits (157),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36304.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36309.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36184.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36185.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36187.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36188.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36191.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36198.1| RGA-like 1, partial [Helianthus tuberosus]
 gb|AEB36199.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 4/53 (8%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAI  593
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTI  120



>gb|AEB36172.1| RGA-like 1, partial [Helianthus exilis]
 gb|AEB36174.1| RGA-like 1, partial [Helianthus exilis]
Length=182

 Score = 65.1 bits (157),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 48.9 bits (115),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36294.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36315.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36316.1| RGA-like 1, partial [Helianthus annuus]
Length=193

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36327.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36328.1| RGA-like 1, partial [Helianthus annuus]
Length=187

 Score = 65.1 bits (157),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 48.9 bits (115),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AHB17746.1| GA repressor DELLA [Actinidia deliciosa]
Length=581

 Score = 63.2 bits (152),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEESEQD-AGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW   + D  GMDELLAVLGYKVKASDM EVAQKLEQLE VM
Sbjct  24   KMWTAEQADVGGMDELLAVLGYKVKASDMLEVAQKLEQLEMVM  66


 Score = 50.4 bits (119),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            ++ D +S L+S+TVHYNPSDLS WV SM+SELN
Sbjct  66   MEDDGISHLSSDTVHYNPSDLSGWVQSMLSELN  98



>gb|AEB36175.1| RGA-like 1, partial [Helianthus exilis]
 gb|AEB36180.1| RGA-like 1, partial [Helianthus exilis]
Length=182

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36207.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36208.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36209.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36210.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36213.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36214.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36215.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36216.1| RGA-like 1, partial [Helianthus argophyllus]
 gb|AEB36218.1| RGA-like 1, partial [Helianthus argophyllus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTIA  121



>gb|AEB36182.1| RGA-like 1, partial [Helianthus exilis]
Length=194

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36178.1| RGA-like 1, partial [Helianthus exilis]
Length=194

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36334.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36203.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTIA  121



>gb|AEB36189.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTIA  121



>gb|ABG35338.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35339.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 64.3 bits (155),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.7 bits (117),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36305.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36293.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36219.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36220.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36221.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36222.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36223.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36224.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36225.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36226.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36227.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36228.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36229.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36230.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36231.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36232.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36233.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36234.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36235.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36236.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36237.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36238.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36239.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36240.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36241.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36242.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36243.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36244.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36245.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36246.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36247.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36248.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36249.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36250.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36251.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36252.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36253.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36254.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36255.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36256.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36257.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36258.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36259.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36260.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36261.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36262.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36263.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36264.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36265.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36266.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36267.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36268.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36269.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36270.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36271.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36272.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36273.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36274.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36275.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36276.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36277.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36278.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36279.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36280.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36281.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36282.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36283.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36284.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36285.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36286.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36287.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36288.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36289.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36290.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36291.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36292.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36295.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36296.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36299.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36300.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36301.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36302.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36303.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36306.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36310.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36317.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36318.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36319.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36320.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36321.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36322.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36323.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36332.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36335.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|ABG35324.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35325.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35333.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 64.3 bits (155),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36177.1| RGA-like 1, partial [Helianthus exilis]
Length=194

 Score = 64.7 bits (156),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36330.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|ABG35340.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35341.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 64.3 bits (155),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTIA  121



>gb|AEB36158.1| RGA-like 1, partial [Helianthus petiolaris]
Length=187

 Score = 64.7 bits (156),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>ref|XP_009370101.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=580

 Score = 58.2 bits (139),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +1

Query  346  GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            GMDELLAVLGYKV+  DMA+VA+KLEQLE VMGS
Sbjct  47   GMDELLAVLGYKVRTDDMADVAEKLEQLEMVMGS  80


 Score = 55.8 bits (133),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 13/77 (17%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGD-------PFLSSQTESSSAITR  599
            G  Q D +S L S+TVHYNPSDLS WV SM+SELN GD       P L+    S+   T+
Sbjct  79   GSAQEDGISQL-SDTVHYNPSDLSGWVQSMLSELNTGDDMPSINGPLLAPGESSTRTSTK  137

Query  600  ----NSTQIF-DDSSFD  635
                  T++F DDS +D
Sbjct  138  FCNSQRTRVFNDDSEYD  154



>gb|AEB36311.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36312.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36324.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36325.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36326.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36333.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 48.9 bits (115),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTIA  121



>ref|XP_011097451.1| PREDICTED: DELLA protein GAI-like [Sesamum indicum]
Length=565

 Score = 69.3 bits (168),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            MW E + DAGMDEL AVLGYKVK+SDMA+VA+KLEQLE  MGS
Sbjct  21   MWAEQQPDAGMDELFAVLGYKVKSSDMADVAEKLEQLEMAMGS  63


 Score = 44.3 bits (103),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 19/29 (66%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISEL  542
            D  S L+++TVHYNPSDLS WV+SM++EL
Sbjct  67   DGSSVLSTDTVHYNPSDLSGWVESMLTEL  95



>gb|ACM47244.1| putative gibberellin signaling DELLA protein [Sinningia speciosa]
Length=562

 Score = 63.5 bits (153),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 38/48 (79%), Gaps = 4/48 (8%)
 Frame = +1

Query  316  KMW----EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW    +  + D+G+DEL AVLGY VK+SDMA +AQK+EQLEEVMGS
Sbjct  21   KMWCSEPDGQQNDSGVDELFAVLGYNVKSSDMASLAQKIEQLEEVMGS  68


 Score = 50.4 bits (119),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  441  GELQGDD--LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQI  614
            G +Q +D  LS LAS+TVH+NPSDL+SWV+SMIS  N    F SS +         STQ+
Sbjct  67   GSVQQEDGHLSQLASDTVHHNPSDLNSWVESMISGYNPLPEFDSSSSTVVQDQFLESTQM  126

Query  615  FDDSSFDS  638
              DS F S
Sbjct  127  VVDSDFGS  134



>gb|AEB36176.1| RGA-like 1, partial [Helianthus exilis]
Length=182

 Score = 64.3 bits (155),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36205.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGTIA  121



>gb|AEB36181.1| RGA-like 1, partial [Helianthus exilis]
Length=194

 Score = 64.3 bits (155),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36206.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S ++ 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSVA  121



>gb|AEB36193.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPVSGSIA  121



>gb|AEB36329.1| RGA-like 1, partial [Helianthus annuus]
 gb|AEB36331.1| RGA-like 1, partial [Helianthus annuus]
Length=197

 Score = 64.3 bits (155),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMIDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|EYU30084.1| hypothetical protein MIMGU_mgv1a027121mg [Erythranthe guttata]
Length=588

 Score = 58.5 bits (140),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 35/49 (71%), Gaps = 5/49 (10%)
 Frame = +1

Query  316  KMWEESEQDAG-----MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW     D G     +DEL AVLGY VK+SDMAEVA K+EQLEEVMGS
Sbjct  26   KMWPCDADDGGGGGGGVDELFAVLGYNVKSSDMAEVAHKIEQLEEVMGS  74


 Score = 54.7 bits (130),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 8/49 (16%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN--------LGDPFL  563
            G ++ D LS LAS+TVHYNPSDLSSW++SMIS LN        L +PFL
Sbjct  73   GSVRQDGLSQLASDTVHYNPSDLSSWLESMISGLNPMPDFDSSLDNPFL  121



>gb|AEB36152.1| RGA-like 1, partial [Helianthus petiolaris]
Length=191

 Score = 64.7 bits (156),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS+++H NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSIHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AFA35960.1| ELLA domain GRAS family transcription factor [Nicotiana attenuata]
Length=561

 Score = 67.4 bits (163),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K++EE + DAGMDELLAVLGYKVK+SDMAEVA+KLEQLE  M +
Sbjct  20   KIYEEEQPDAGMDELLAVLGYKVKSSDMAEVAKKLEQLEMAMCT  63


 Score = 45.8 bits (107),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISELN  545
            D +S L+++TVH NPSDLS WV SM+SELN
Sbjct  67   DGISHLSTDTVHKNPSDLSGWVQSMLSELN  96



>gb|AEB36196.1| RGA-like 1, partial [Helianthus tuberosus]
Length=192

 Score = 64.7 bits (156),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 48.5 bits (114),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 35/52 (67%), Gaps = 4/52 (8%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSA  590
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S A
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSIA  119



>gb|ABG35314.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
 gb|ABG35315.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=227

 Score = 64.7 bits (156),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 48.9 bits (115),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW+ SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLQSMICELN---PVVQVQLPGSGSIA  121



>gb|AFJ42394.1| DELLA protein DWARF8, partial [Andropterum stolzii]
Length=360

 Score = 57.8 bits (138),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KM   +EQ+  MDE+LA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  22   KMMAAAEQEEEMDEMLAALGYKVRSSDMADVAQKLEQLEMAMG  64


 Score = 55.1 bits (131),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  426  VRGSDGELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            V G+    +G  +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  68   VGGAVATAEGGFISHLATDTVHYNPSDLSSWVESMLSELN  107



>ref|XP_007214956.1| hypothetical protein PRUPE_ppa003206mg [Prunus persica]
 gb|EMJ16155.1| hypothetical protein PRUPE_ppa003206mg [Prunus persica]
Length=593

 Score = 65.9 bits (159),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (84%), Gaps = 6/49 (12%)
 Frame = +1

Query  316  KMWEESEQDA-----GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WE+ +QD      GMDELLAVLGYKV+ASDMAEVA+KLEQLE VMGS
Sbjct  32   KIWEQ-DQDGCGGSGGMDELLAVLGYKVRASDMAEVAEKLEQLEMVMGS  79


 Score = 47.0 bits (110),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 17/81 (21%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN------LGDP-FLSSQTES------  581
            G  Q D +S L S+TVHYNPSDLS WV SM+SE N      + DP F+++ + S      
Sbjct  78   GSAQEDGISQL-SDTVHYNPSDLSGWVQSMLSEFNTVDGSAIDDPLFVAADSSSITSIHF  136

Query  582  --SSAITRNSTQIF-DDSSFD  635
              S  I   ++++F DDS +D
Sbjct  137  SNSHRIENPASRVFHDDSEYD  157



>gb|AEB36155.1| RGA-like 1, partial [Helianthus petiolaris]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 48.1 bits (113),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPS+LSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSELSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36171.1| RGA-like 1, partial [Helianthus exilis]
 gb|AEB36173.1| RGA-like 1, partial [Helianthus exilis]
Length=182

 Score = 63.5 bits (153),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW E +EQDAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWGEFNEQDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 48.9 bits (115),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36160.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36161.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36162.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36168.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36170.1| RGA-like 1, partial [Helianthus paradoxus]
Length=197

 Score = 63.2 bits (152),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 38/43 (88%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW+E +E+DAG DELLAVLGYKVK+SDM +VAQK+E LE V+
Sbjct  32   KMWDEFNEKDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVL  74


 Score = 49.3 bits (116),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AFR90187.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
floridanus]
Length=223

 Score = 64.7 bits (156),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 47.8 bits (112),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELN  545
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN  107



>gb|AEB36159.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36164.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36166.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36169.1| RGA-like 1, partial [Helianthus paradoxus]
Length=197

 Score = 63.2 bits (152),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +E+DAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEKDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36204.1| RGA-like 1, partial [Helianthus tuberosus]
Length=197

 Score = 64.7 bits (156),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 47.4 bits (111),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +      S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVHLPGSGSIA  121



>gb|AEB36165.1| RGA-like 1, partial [Helianthus paradoxus]
Length=197

 Score = 62.8 bits (151),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +E+DAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEKDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36163.1| RGA-like 1, partial [Helianthus paradoxus]
 gb|AEB36167.1| RGA-like 1, partial [Helianthus paradoxus]
Length=197

 Score = 62.8 bits (151),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +E+DAG DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEKDAGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.3 bits (116),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|AEB36197.1| RGA-like 1, partial [Helianthus tuberosus]
Length=195

 Score = 64.7 bits (156),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDTGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 47.4 bits (111),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 1/37 (3%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELN  545
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN  107



>gb|AEB36195.1| RGA-like 1, partial [Helianthus tuberosus]
Length=194

 Score = 63.5 bits (153),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 39/45 (87%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQD G+DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDDGVDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 48.5 bits (114),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 35/54 (65%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S  I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PAVQVQLPGSGTIA  121



>ref|XP_009594460.1| PREDICTED: DELLA protein GAI-like [Nicotiana tomentosiformis]
Length=567

 Score = 66.2 bits (160),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSF  450
            K++EE + DAGMDELLAVLGYKVK+SD+AEVAQ+LEQLE  M + 
Sbjct  20   KIFEEEQPDAGMDELLAVLGYKVKSSDLAEVAQQLEQLEMAMCTI  64


 Score = 45.8 bits (107),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISELN  545
            D +S L+++TVH NPSDLS WV SM+SELN
Sbjct  67   DGISHLSTDTVHKNPSDLSGWVQSMLSELN  96



>gb|AHB17745.1| GA repressor DELLA [Actinidia deliciosa]
Length=579

 Score = 61.2 bits (147),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = +1

Query  316  KMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KMW   + D G MDELLAVLGYK+KASDM EVA KLEQLE VM
Sbjct  22   KMWAAEQADGGGMDELLAVLGYKIKASDMLEVAHKLEQLEMVM  64


 Score = 50.8 bits (120),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            ++ D +S L+S+TVHYNPSDLS WV SM+SELN
Sbjct  64   MEEDGISHLSSDTVHYNPSDLSGWVQSMLSELN  96



>gb|AFR90185.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
annuus]
Length=225

 Score = 62.4 bits (150),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+E +EQDAG DEL AVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDEFNEQDAGDDELPAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 49.7 bits (117),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 4/54 (7%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            +G L  DD LS +AS++VH NPSDLSSW++SMI ELN   P +  Q   S +I 
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICELN---PVVQVQLPGSGSIA  121



>gb|KFK33379.1| rga1 protein [Arabis alpina]
Length=590

 Score = 59.7 bits (143),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSS  569
            G +Q D LS LA++T+HYNPS+L SW+DSM+SELN  DP L S
Sbjct  71   GNVQEDGLSHLATDTIHYNPSELYSWLDSMLSELNPSDPMLVS  113


 Score = 52.0 bits (123),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +1

Query  352  DELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            DELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  41   DELLAVLGYKVRSSEMAEVALKLEQLETMMGN  72



>ref|XP_004140302.1| PREDICTED: DELLA protein GAI-like [Cucumis sativus]
Length=597

 Score = 63.2 bits (152),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 10/54 (19%)
 Frame = +1

Query  316  KMWEESEQD----------AGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+  E+D           GMDELLAVLGYKV++SDMA+VA KLEQLE VMG+
Sbjct  33   KMWQPHEEDEGKDAKDGAAGGMDELLAVLGYKVRSSDMADVALKLEQLEMVMGT  86


 Score = 48.1 bits (113),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LAS+TVHYNPSDLSSWV +M+SE N
Sbjct  92   ISHLASDTVHYNPSDLSSWVQNMLSEFN  119



>ref|XP_010926472.1| PREDICTED: DELLA protein SLR1-like [Elaeis guineensis]
Length=651

 Score = 59.7 bits (143),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KM    E+D G+DELLA LGYKV+ASDMA+VAQKLEQLE  M S
Sbjct  28   KMMGMEEEDGGVDELLAALGYKVRASDMADVAQKLEQLEMAMTS  71


 Score = 51.6 bits (122),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            LS LAS+TVHYNPSDLS+W++SM+SELN
Sbjct  80   LSHLASDTVHYNPSDLSTWLESMLSELN  107



>ref|XP_004155733.1| PREDICTED: DELLA protein GAI-like [Cucumis sativus]
 emb|CCG14221.1| gibberellin DELLA protein [Cucumis sativus]
 gb|KGN51056.1| hypothetical protein Csa_5G421370 [Cucumis sativus]
Length=603

 Score = 63.2 bits (152),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 10/54 (19%)
 Frame = +1

Query  316  KMWEESEQD----------AGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW+  E+D           GMDELLAVLGYKV++SDMA+VA KLEQLE VMG+
Sbjct  33   KMWQPHEEDEGKDAKDGAAGGMDELLAVLGYKVRSSDMADVALKLEQLEMVMGT  86


 Score = 48.1 bits (113),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LAS+TVHYNPSDLSSWV +M+SE N
Sbjct  92   ISHLASDTVHYNPSDLSSWVQNMLSEFN  119



>ref|XP_008782281.1| PREDICTED: DELLA protein SLR1-like [Phoenix dactylifera]
Length=649

 Score = 60.1 bits (144),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KM    ++D G+DELLA LGYKV++SDMA+VAQKLEQLE  MGS
Sbjct  28   KMVGMEDEDGGVDELLAALGYKVRSSDMADVAQKLEQLEMAMGS  71


 Score = 51.6 bits (122),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            LS LAS+TVHYNPSDLS+W++SM+SELN
Sbjct  80   LSHLASDTVHYNPSDLSTWLESMLSELN  107



>ref|XP_010551797.1| PREDICTED: DELLA protein RGL1-like [Tarenaya hassleriana]
Length=553

 Score = 56.2 bits (134),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 40/63 (63%), Gaps = 15/63 (24%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFD  620
            G +Q D LS L+++TVHYNPSDLS WVDSM+S+L   DP            TRN  ++++
Sbjct  76   GSVQNDGLSYLSNDTVHYNPSDLSGWVDSMLSDL---DP------------TRNQCRVYE  120

Query  621  DSS  629
            D S
Sbjct  121  DHS  123


 Score = 54.7 bits (130),  Expect(2) = 6e-16, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +1

Query  313  KKMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K +  E ++  G+DELL VLGYKV++S MA+VA+KLEQLE V+GS
Sbjct  33   KLLRSEDKETTGVDELLVVLGYKVRSSAMADVAEKLEQLEMVLGS  77



>ref|XP_003538395.1| PREDICTED: DELLA protein GAI1 [Glycine max]
Length=595

 Score = 61.6 bits (148),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 38/54 (70%), Gaps = 10/54 (19%)
 Frame = +1

Query  316  KMWEE----------SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMWEE           +Q  GMDELLA LGYKV+ASDMA+VAQKLEQLE VMG 
Sbjct  33   KMWEEEQQQQQQQQQQQQQQGMDELLAALGYKVRASDMADVAQKLEQLEMVMGC  86


 Score = 48.9 bits (115),  Expect(2) = 7e-16, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D +S LAS+TVHY+P+DL SWV SM++ELN
Sbjct  85   GCAQEDGISHLASDTVHYDPTDLYSWVQSMLTELN  119



>gb|EYU30908.1| hypothetical protein MIMGU_mgv1a024641mg [Erythranthe guttata]
Length=532

 Score = 66.2 bits (160),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 39/44 (89%), Gaps = 2/44 (5%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW  +E DAGMDELLAVLGYKVK+SDMA+VA+KLEQLE  MG+
Sbjct  24   KMW--AEADAGMDELLAVLGYKVKSSDMADVAEKLEQLEVAMGT  65


 Score = 44.3 bits (103),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 28/32 (88%), Gaps = 1/32 (3%)
 Frame = +3

Query  456  DDLSSLASET-VHYNPSDLSSWVDSMISELNL  548
            D +SSL+++T VHYNPSDLS WV SM+SEL++
Sbjct  70   DGVSSLSTDTTVHYNPSDLSGWVGSMLSELSV  101



>gb|AAY56750.1| DELLA protein [Malus domestica]
Length=584

 Score = 58.9 bits (141),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 6/49 (12%)
 Frame = +1

Query  316  KMWEESEQD---AG--MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WE+ +QD   AG  MDELLAVLGYKV++ DMA+VA+KLEQLE VMGS
Sbjct  36   KIWED-DQDGYSAGGDMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGS  83


 Score = 51.6 bits (122),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGD  554
            G  Q D +S L S+TVHYNPSDLS WV SM+SELN GD
Sbjct  82   GSAQEDGISQL-SDTVHYNPSDLSGWVQSMLSELNTGD  118



>gb|AEX97111.1| spur-type DELLA protein [Malus domestica]
Length=584

 Score = 58.9 bits (141),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 6/49 (12%)
 Frame = +1

Query  316  KMWEESEQD---AG--MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WE+ +QD   AG  MDELLAVLGYKV++ DMA+VA+KLEQLE VMGS
Sbjct  36   KIWED-DQDGYSAGGDMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGS  83


 Score = 51.6 bits (122),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGD  554
            G  Q D +S L S+TVHYNPSDLS WV SM+SELN GD
Sbjct  82   GSAQEDGISQL-SDTVHYNPSDLSGWVQSMLSELNTGD  118



>ref|XP_010527787.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=609

 Score = 59.3 bits (142),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVM  441
            KM +  +  AGMDELLAVLGYKV +SDMAEVA KLEQLE++M
Sbjct  26   KMLKVEDDGAGMDELLAVLGYKVMSSDMAEVAHKLEQLEQMM  67


 Score = 51.2 bits (121),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 2/47 (4%)
 Frame = +3

Query  444  ELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLG--DPFLSSQTE  578
             +Q D LS L++ETVHYNP++L +W+DS++SEL  G   P LSS  E
Sbjct  69   HVQDDGLSLLSTETVHYNPAELYTWLDSILSELKPGGLGPLLSSPPE  115



>ref|XP_008343058.1| PREDICTED: DELLA protein GAI-like [Malus domestica]
Length=584

 Score = 58.9 bits (141),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 6/49 (12%)
 Frame = +1

Query  316  KMWEESEQD---AG--MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WE+ +QD   AG  MDELLAVLGYKV++ DMA+VA+KLEQLE VMGS
Sbjct  36   KIWED-DQDGYSAGGDMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGS  83


 Score = 51.6 bits (122),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGD  554
            G  Q D +S L S+TVHYNPSDLS WV SM+SELN GD
Sbjct  82   GSAQEDGISQL-SDTVHYNPSDLSGWVQSMLSELNTGD  118



>gb|KEH34625.1| DELLA domain GRAS family transcription factor GAI [Medicago truncatula]
Length=547

 Score = 62.8 bits (151),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 2/45 (4%)
 Frame = +1

Query  319  MWEESEQD--AGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            MW E ++    GMDELLA LGYKV++SDMA+VAQKLEQLE VMGS
Sbjct  1    MWREEKETNGGGMDELLAALGYKVRSSDMADVAQKLEQLEMVMGS  45


 Score = 47.8 bits (112),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 43/70 (61%), Gaps = 9/70 (13%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN-----LGDPFLSSQTESSSAITRNS  605
            G  Q + ++ L+S+TVHY+P+DL SWV +M++ELN     + DP  S    SSS I  N+
Sbjct  44   GSAQEEGINHLSSDTVHYDPTDLYSWVQTMLTELNPDSSQINDPLAS--LGSSSEILNNT  101

Query  606  TQIFDDSSFD  635
                DDS +D
Sbjct  102  FN--DDSEYD  109



>ref|XP_009334448.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=584

 Score = 58.9 bits (141),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 41/49 (84%), Gaps = 6/49 (12%)
 Frame = +1

Query  316  KMWEESEQD---AG--MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WE+ +QD   AG  MDELLAVLGYKV++ DMA+VA+KLEQLE VMGS
Sbjct  36   KIWED-DQDGYSAGGDMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGS  83


 Score = 51.6 bits (122),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 1/38 (3%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGD  554
            G  Q D +S L S+TVHYNPSDLS WV SM+SELN GD
Sbjct  82   GSAQEDGISQL-SDTVHYNPSDLSGWVQSMLSELNTGD  118



>ref|XP_006395878.1| hypothetical protein EUTSA_v10005482mg [Eutrema salsugineum]
 dbj|BAJ33650.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33164.1| hypothetical protein EUTSA_v10005482mg [Eutrema salsugineum]
Length=616

 Score = 57.4 bits (137),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +1

Query  313  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  42   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  87


 Score = 53.1 bits (126),  Expect(2) = 9e-16, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G +Q D LS LA++TVHYNPS+L SW+D+M+SELN
Sbjct  86   GNVQEDGLSHLATDTVHYNPSELYSWLDNMLSELN  120



>gb|AFC88482.1| DELLA protein [Rosa lucieae]
Length=564

 Score = 65.9 bits (159),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WEE ++   MDELLAVLGYKV++ DMA+VA+KLEQLE VMGS
Sbjct  27   KIWEEEQESGSMDELLAVLGYKVRSDDMADVAEKLEQLEMVMGS  70


 Score = 44.3 bits (103),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 40/70 (57%), Gaps = 8/70 (11%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSS-------QTESSSAITR  599
            G  Q D +S L S+TVHYNPSDLS W+ +M+ ELN  D  LS+       Q +    I  
Sbjct  69   GSAQQDGISQL-SDTVHYNPSDLSGWLQTMLMELNPIDDDLSNSQQQKQKQKQKQKQIET  127

Query  600  NSTQIFDDSS  629
             S  I+DD+S
Sbjct  128  QSRVIYDDNS  137



>gb|KHN17945.1| DELLA protein GAI1 [Glycine soja]
Length=288

 Score = 61.6 bits (148),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 38/53 (72%), Gaps = 10/53 (19%)
 Frame = +1

Query  316  KMWEE----------SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KMWEE           +Q  GMDELLA LGYKV+ASDMA+VAQKLEQLE VMG
Sbjct  8    KMWEEEQQQQQQQQQQQQQQGMDELLAALGYKVRASDMADVAQKLEQLEMVMG  60


 Score = 48.5 bits (114),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D +S LAS+TVHY+P+DL SWV SM++ELN
Sbjct  60   GCAQEDGISHLASDTVHYDPTDLYSWVQSMLTELN  94



>ref|XP_008809806.1| PREDICTED: DELLA protein SLR1 [Phoenix dactylifera]
Length=656

 Score = 58.9 bits (141),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  328  ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            E E D G+DELLA LGYKV++SDMA+VA KLEQLE  MGS
Sbjct  32   EEEHDGGVDELLAALGYKVRSSDMADVALKLEQLEMAMGS  71


 Score = 51.2 bits (121),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            LS LAS+TVHYNPSDLS+W++SM+SELN
Sbjct  80   LSHLASDTVHYNPSDLSTWLESMLSELN  107



>gb|AIW50513.1| dwarf 8 protein, partial [Andropterum stolzii]
Length=353

 Score = 57.8 bits (138),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            KM   +EQ+  MDE+LA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  16   KMMAAAEQEEEMDEMLAALGYKVRSSDMADVAQKLEQLEMAMG  58


 Score = 52.0 bits (123),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  74   ISHLATDTVHYNPSDLSSWVESMLSELN  101



>ref|XP_011099949.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI [Sesamum indicum]
Length=565

 Score = 62.4 bits (150),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 2/46 (4%)
 Frame = +1

Query  316  KMWEESEQ--DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KM  E +Q  DAGMDEL AVLGYKVK+SDMA+VA+KLEQLE  MG+
Sbjct  25   KMLAEQQQQPDAGMDELFAVLGYKVKSSDMADVAEKLEQLEMAMGT  70


 Score = 47.4 bits (111),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 20/29 (69%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISEL  542
            D +S L+++TVHYNPSDLS WV+SM+SEL
Sbjct  74   DGVSVLSTDTVHYNPSDLSGWVESMLSEL  102



>ref|XP_010513881.1| PREDICTED: DELLA protein RGA isoform X1 [Camelina sativa]
 ref|XP_010513882.1| PREDICTED: DELLA protein RGA isoform X2 [Camelina sativa]
Length=611

 Score = 57.4 bits (137),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +1

Query  313  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  29   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  74


 Score = 52.4 bits (124),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G +Q D LS LA++TVHYNPS+L SW+D+M++ELN
Sbjct  73   GNVQEDGLSQLATDTVHYNPSELYSWLDNMLTELN  107



>ref|XP_004503135.1| PREDICTED: DELLA protein GAI-like [Cicer arietinum]
Length=622

 Score = 64.3 bits (155),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  316  KMW-EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
             MW EE E   GMDE LA LGYKV++SDMA+VAQKLEQLE VMG
Sbjct  49   NMWREEKENSGGMDEFLAALGYKVRSSDMADVAQKLEQLEMVMG  92


 Score = 45.4 bits (106),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q D ++ L+S+TVHY+P+DL SWV +M++ELN
Sbjct  92   GCAQEDGINHLSSDTVHYDPADLYSWVQTMLTELN  126



>ref|XP_010424927.1| PREDICTED: DELLA protein RGA-like [Camelina sativa]
Length=605

 Score = 57.4 bits (137),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +1

Query  313  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  33   KMMMVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  78


 Score = 52.4 bits (124),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN----LGDPFLSS  569
            G +Q D LS L ++TVHYNPS+L SW+D+M++ELN      DP L+S
Sbjct  77   GNVQEDGLSQLGTDTVHYNPSELYSWLDNMLTELNPPPGASDPILTS  123



>gb|ABI30654.1| putative gibberellin signaling DELLA protein LA [Pisum sativum]
Length=592

 Score = 63.5 bits (153),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 37/46 (80%), Gaps = 1/46 (2%)
 Frame = +1

Query  313  KKMW-EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            + +W EE E   GMDELLA LGYKV++SDM +VAQKLEQLE VMGS
Sbjct  47   QSLWSEEKENSGGMDELLAALGYKVRSSDMLDVAQKLEQLEMVMGS  92


 Score = 45.8 bits (107),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G  Q + ++ LAS+TVHY+P+DL SWV +M++ELN
Sbjct  91   GSAQEEGINHLASDTVHYDPTDLYSWVQTMLTELN  125



>ref|XP_009590329.1| PREDICTED: DELLA protein GAI-like [Nicotiana tomentosiformis]
Length=560

 Score = 63.5 bits (153),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K++EE + DAGMDELLAVLGYKVK SDMAEVAQKLEQLE  M +
Sbjct  20   KIFEE-QPDAGMDELLAVLGYKVKYSDMAEVAQKLEQLEMAMCT  62


 Score = 45.8 bits (107),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISELN  545
            D +S L+++TVH NPSDLS WV SM+SELN
Sbjct  66   DGISHLSTDTVHKNPSDLSGWVQSMLSELN  95



>ref|XP_008460522.1| PREDICTED: DELLA protein GAI-like [Cucumis melo]
Length=603

 Score = 61.2 bits (147),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 10/54 (19%)
 Frame = +1

Query  316  KMW----EESEQDA------GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW    EE+ +DA      GMDELLAVLGYKV++SDMA+VA KLEQLE VMG+
Sbjct  33   KMWHLQEEEAGEDAKDGAAGGMDELLAVLGYKVRSSDMADVALKLEQLEMVMGT  86


 Score = 48.1 bits (113),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LAS+TVHYNPSDLSSWV +M+SE N
Sbjct  92   ISHLASDTVHYNPSDLSSWVQNMLSEFN  119



>ref|XP_009390245.1| PREDICTED: DELLA protein SLR1-like [Musa acuminata subsp. malaccensis]
Length=612

 Score = 62.8 bits (151),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 36/39 (92%), Gaps = 0/39 (0%)
 Frame = +1

Query  331  SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            +E+D G+DELLA LGYKV++SDMA+VAQKLEQLE+ MGS
Sbjct  12   AEEDGGVDELLAALGYKVRSSDMADVAQKLEQLEKAMGS  50


 Score = 46.6 bits (109),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
             S LAS+TVHYNPSD+ +WVD+++SELN
Sbjct  60   FSHLASDTVHYNPSDIFTWVDNILSELN  87



>gb|EYU45810.1| hypothetical protein MIMGU_mgv1a003644mg [Erythranthe guttata]
Length=572

 Score = 63.5 bits (153),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  319  MWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            MW E  Q DAGMDEL AVLGYK+K++DMA+VA+KLEQLE  MGS
Sbjct  28   MWAEQPQPDAGMDELFAVLGYKMKSTDMADVAEKLEQLEMAMGS  71


 Score = 45.8 bits (107),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISELN  545
            D  S L+++TVHYNPSDLS WV+SM+SEL 
Sbjct  75   DGASVLSNDTVHYNPSDLSGWVESMLSELG  104



>ref|XP_002890081.1| hypothetical protein ARALYDRAFT_471680 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66340.1| hypothetical protein ARALYDRAFT_471680 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score = 56.2 bits (134),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M  E +   GMDELLAVLGYKV++S+MA+VAQKLEQLE +M +
Sbjct  17   MMNEEDDANGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSN  59


 Score = 53.1 bits (126),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            +Q DDLS LA+ETVHYNP++L +W+DSM+S+LN
Sbjct  60   VQEDDLSQLATETVHYNPAELYTWLDSMLSDLN  92



>gb|ADA84480.1| GRAS [Antirrhinum majus]
Length=528

 Score = 57.8 bits (138),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = +1

Query  313  KKMWEESEQDAG--MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K MW  S  +A   +DEL AVLGYKVK SDMA+VA K++QLE+VMG+
Sbjct  24   KNMWPSSSCEATDEVDELFAVLGYKVKPSDMADVAIKIQQLEQVMGN  70


 Score = 51.2 bits (121),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  453  GDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  +S LAS+TVHYNPSDLSSW++SMI+ LN  DP
Sbjct  71   GAAVSDLASDTVHYNPSDLSSWLESMITGLNQFDP  105



>gb|ADH53780.1| GAI1 [Malus domestica]
Length=570

 Score = 57.8 bits (138),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSA---ITRNSTQ  611
            G  Q D LS LAS+TVHYNP+DLS+W++SMISE+NL  P     T  + A     +   Q
Sbjct  27   GCAQEDGLSQLASDTVHYNPADLSTWLESMISEINLPPPNFDPLTGGAVAGMQPNQQQVQ  86

Query  612  IFDD  623
            + DD
Sbjct  87   LVDD  90


 Score = 51.2 bits (121),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  364  AVLGYKVKASDMAEVAQKLEQLEEVMG  444
            AVLGYKV++SDMAEVAQKLEQLEE MG
Sbjct  1    AVLGYKVRSSDMAEVAQKLEQLEEFMG  27



>ref|XP_006292324.1| hypothetical protein CARUB_v10018534mg [Capsella rubella]
 gb|EOA25222.1| hypothetical protein CARUB_v10018534mg [Capsella rubella]
Length=648

 Score = 56.6 bits (135),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M +E E    MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  34   MVKEEEDGNNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  76


 Score = 52.4 bits (124),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            G +Q D LS LA++TVHYNPS+L SW+D+M++ELN
Sbjct  75   GNVQEDGLSHLATDTVHYNPSELYSWLDNMLTELN  109



>ref|XP_010066602.1| PREDICTED: DELLA protein GAIP-B-like [Eucalyptus grandis]
 gb|KCW64558.1| hypothetical protein EUGRSUZ_G02163 [Eucalyptus grandis]
Length=634

 Score = 55.1 bits (131),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  450  QGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            Q D LS LASETVHYNPSDLSSW++SM+SE N
Sbjct  72   QEDGLSHLASETVHYNPSDLSSWLESMLSEFN  103


 Score = 54.3 bits (129),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 29/30 (97%), Gaps = 0/30 (0%)
 Frame = +1

Query  358  LLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            LLAVLGYKV++SDMAEVAQKLEQLEEVM S
Sbjct  41   LLAVLGYKVRSSDMAEVAQKLEQLEEVMFS  70



>ref|XP_009114228.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein RGA2-like [Brassica 
rapa]
Length=569

 Score = 57.0 bits (136),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M +E E    MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  34   MVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  76


 Score = 52.0 bits (123),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G +Q D LS+LA++TVHYNPS+L SW+D+M++E N   P
Sbjct  75   GNVQEDGLSNLATDTVHYNPSELYSWLDNMLTEFNPPPP  113



>gb|AFD62413.1| reduced height-2 [Eragrostis tef]
 gb|AFD62414.1| reduced height-2 [Eragrostis tef]
 gb|AFD62415.1| reduced height-2 [Eragrostis tef]
 gb|AFD62416.1| reduced height-2 [Eragrostis tef]
 gb|AFD62417.1| reduced height-2 [Eragrostis tef]
 gb|AFD62418.1| reduced height-2 [Eragrostis tef]
Length=617

 Score = 56.6 bits (135),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  32   EQDEDVDELLAALGYKVRSSDMADVAQKLEQLEMAMG  68


 Score = 52.0 bits (123),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +3

Query  432  GSDGELQGDD--LSSLASETVHYNPSDLSSWVDSMISELN  545
            G  G    DD  +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  68   GMGGVPAADDGFVSHLAADTVHYNPSDLSSWVESMLSELN  107



>sp|Q5BN22.1|RGA2_BRACM RecName: Full=DELLA protein RGA2; AltName: Full=BrRGA2; AltName: 
Full=RGA-like protein 2 [Brassica rapa]
 gb|AAX33298.1| DELLA protein [Brassica rapa]
Length=579

 Score = 57.0 bits (136),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M +E E    MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  34   MVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  76


 Score = 51.6 bits (122),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G +Q D LS+LA++TVHYNPS+L SW+D+M++E N   P
Sbjct  75   GNVQEDGLSNLATDTVHYNPSELYSWLDNMLTEFNPPPP  113



>ref|NP_172945.1| DELLA protein GAI [Arabidopsis thaliana]
 sp|Q9LQT8.1|GAI_ARATH RecName: Full=DELLA protein GAI; AltName: Full=GRAS family protein 
3; Short=AtGRAS-3; AltName: Full=Gibberellic acid-insensitive 
mutant protein; AltName: Full=Restoration of growth 
on ammonia protein 2 [Arabidopsis thaliana]
 gb|AAF79228.1|AC006917_13 F10B6.34 [Arabidopsis thaliana]
 gb|AAL25607.1| At1g14920/F10B6_15 [Arabidopsis thaliana]
 gb|AAM98266.1| At1g14920/F10B6_15 [Arabidopsis thaliana]
 gb|AEE29242.1| DELLA protein GAI [Arabidopsis thaliana]
Length=533

 Score = 56.2 bits (134),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M  E +   GMDELLAVLGYKV++S+MA+VAQKLEQLE +M +
Sbjct  17   MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSN  59


 Score = 52.4 bits (124),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            +Q DDLS LA+ETVHYNP++L +W+DSM+++LN
Sbjct  60   VQEDDLSQLATETVHYNPAELYTWLDSMLTDLN  92



>emb|CAA75492.1| GAI [Arabidopsis thaliana]
Length=532

 Score = 56.2 bits (134),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M  E +   GMDELLAVLGYKV++S+MA+VAQKLEQLE +M +
Sbjct  16   MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSN  58


 Score = 52.4 bits (124),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            +Q DDLS LA+ETVHYNP++L +W+DSM+++LN
Sbjct  59   VQEDDLSQLATETVHYNPAELYTWLDSMLTDLN  91



>gb|ADD71137.1| DELLA protein [Brassica napus]
Length=579

 Score = 57.0 bits (136),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M +E E    MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  34   MVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  76


 Score = 51.6 bits (122),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G +Q D LS+LA++TVHYNPS+L SW+D+M++E N   P
Sbjct  75   GNVQEDGLSNLATDTVHYNPSELYSWLDNMLTEFNPPPP  113



>emb|CAA72178.1| RGA2 protein [Arabidopsis thaliana]
Length=532

 Score = 56.2 bits (134),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M  E +   GMDELLAVLGYKV++S+MA+VAQKLEQLE +M +
Sbjct  16   MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSN  58


 Score = 52.4 bits (124),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            +Q DDLS LA+ETVHYNP++L +W+DSM+++LN
Sbjct  59   VQEDDLSQLATETVHYNPAELYTWLDSMLTDLN  91



>dbj|BAG16380.1| GRAS family transcription factor [Brassica rapa var. perviridis]
Length=570

 Score = 57.0 bits (136),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M +E E    MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  25   MVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  67


 Score = 51.6 bits (122),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G +Q D LS+LA++TVHYNPS+L SW+D+M++E N   P
Sbjct  66   GNVQEDGLSNLATDTVHYNPSELYSWLDNMLTEFNPPPP  104



>emb|CDY04092.1| BnaA09g18700D [Brassica napus]
Length=534

 Score = 57.0 bits (136),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            M +E E    MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  34   MVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  76


 Score = 52.0 bits (123),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G +Q D LS+LA++TVHYNPS+L SW+D+M++E N   P
Sbjct  75   GNVQEDGLSNLATDTVHYNPSELYSWLDNMLTEFNPPPP  113



>ref|XP_006307228.1| hypothetical protein CARUB_v10008833mg [Capsella rubella]
 gb|EOA40126.1| hypothetical protein CARUB_v10008833mg [Capsella rubella]
Length=528

 Score = 55.5 bits (132),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            +E +   GMDELLAVLGYKV++S+MA+VAQKLEQLE +M +
Sbjct  17   DEDDGSNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSN  57


 Score = 53.1 bits (126),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            +Q DDLS LA+ETVHYNP++L +W+DSM+S+LN
Sbjct  58   VQEDDLSQLATETVHYNPAELYTWLDSMLSDLN  90



>ref|XP_009779842.1| PREDICTED: DELLA protein GAI-like isoform X3 [Nicotiana sylvestris]
Length=567

 Score = 60.1 bits (144),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            + DAGMDELLAVLGYKVK+SD+AEVAQ+LEQLE  M +
Sbjct  26   QPDAGMDELLAVLGYKVKSSDLAEVAQQLEQLEMAMCT  63


 Score = 48.5 bits (114),  Expect(2) = 3e-15, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  453  GDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            GD +S L+++TVH NPSDLS WV SM+SELN
Sbjct  66   GDGISHLSTDTVHKNPSDLSGWVQSMLSELN  96



>ref|XP_009779840.1| PREDICTED: DELLA protein GAI-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009779841.1| PREDICTED: DELLA protein GAI-like isoform X2 [Nicotiana sylvestris]
Length=567

 Score = 60.1 bits (144),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            + DAGMDELLAVLGYKVK+SD+AEVAQ+LEQLE  M +
Sbjct  26   QPDAGMDELLAVLGYKVKSSDLAEVAQQLEQLEMAMCT  63


 Score = 48.1 bits (113),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  453  GDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            GD +S L+++TVH NPSDLS WV SM+SELN
Sbjct  66   GDGISHLSTDTVHKNPSDLSGWVQSMLSELN  96



>ref|XP_010496659.1| PREDICTED: DELLA protein GAI [Camelina sativa]
Length=531

 Score = 57.8 bits (138),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            EE + + GMDELLAVLGYKV++S+MA+VAQKLEQLE +M +
Sbjct  12   EEDDCNNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSN  52


 Score = 50.4 bits (119),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            +Q  DLS LA+ETVHYNP++L +W+DSM+S+LN
Sbjct  53   VQEHDLSHLATETVHYNPAELYTWLDSMLSDLN  85



>ref|XP_009779843.1| PREDICTED: DELLA protein GAI-like isoform X4 [Nicotiana sylvestris]
Length=572

 Score = 60.1 bits (144),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            + DAGMDELLAVLGYKVK+SD+AEVAQ+LEQLE  M +
Sbjct  26   QPDAGMDELLAVLGYKVKSSDLAEVAQQLEQLEMAMCT  63


 Score = 48.1 bits (113),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +3

Query  453  GDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            GD +S L+++TVH NPSDLS WV SM+SELN
Sbjct  66   GDGISHLSTDTVHKNPSDLSGWVQSMLSELN  96



>emb|CDY64837.1| BnaC09g52270D [Brassica napus]
Length=542

 Score = 56.6 bits (135),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +1

Query  313  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  31   KMMKVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  76


 Score = 52.0 bits (123),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G +Q D LS+LA++TVHYNPS+L SW+D+M++E N   P
Sbjct  75   GNVQEDGLSNLATDTVHYNPSELYSWLDNMLTEFNPPPP  113



>dbj|BAG16374.1| GRAS family transcription factor [Brassica oleracea var. italica]
Length=569

 Score = 56.2 bits (134),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = +1

Query  313  KKMWEESEQDAG-MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K M  + E+D G MDELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  31   KMMKVKEEEDGGNMDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  76


 Score = 52.0 bits (123),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G +Q D LS+LA++TVHYNPS+L SW+D+M++E N   P
Sbjct  75   GNVQEDGLSNLATDTVHYNPSELYSWLDNMLTEFNPPPP  113



>gb|AFD62419.1| reduced height-2 [Eragrostis tef]
 gb|AFD62420.1| reduced height-2 [Eragrostis tef]
 gb|AFD62421.1| reduced height-2 [Eragrostis tef]
Length=617

 Score = 56.2 bits (134),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  32   EQDEEVDELLAALGYKVRSSDMADVAQKLEQLEMAMG  68


 Score = 52.0 bits (123),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +3

Query  432  GSDGELQGDD--LSSLASETVHYNPSDLSSWVDSMISELN  545
            G  G    DD  +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  68   GMGGVPAADDGFVSHLAADTVHYNPSDLSSWVESMLSELN  107



>gb|AFD62396.1| reduced height-2 [Eragrostis tef]
 gb|AFD62397.1| reduced height-2 [Eragrostis tef]
 gb|AFD62398.1| reduced height-2 [Eragrostis tef]
 gb|AFD62399.1| reduced height-2 [Eragrostis tef]
 gb|AFD62400.1| reduced height-2 [Eragrostis tef]
 gb|AFD62401.1| reduced height-2 [Eragrostis tef]
 gb|AFD62402.1| reduced height-2 [Eragrostis tef]
 gb|AFD62403.1| reduced height-2 [Eragrostis tef]
 gb|AFD62404.1| reduced height-2 [Eragrostis tef]
 gb|AFD62405.1| reduced height-2 [Eragrostis tef]
 gb|AFD62406.1| reduced height-2 [Eragrostis tef]
 gb|AFD62407.1| reduced height-2 [Eragrostis tef]
 gb|AFD62408.1| reduced height-2 [Eragrostis tef]
 gb|AFD62409.1| reduced height-2 [Eragrostis tef]
 gb|AFD62410.1| reduced height-2 [Eragrostis tef]
 gb|AFD62411.1| reduced height-2 [Eragrostis tef]
 gb|AFD62412.1| reduced height-2 [Eragrostis tef]
Length=617

 Score = 56.2 bits (134),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  32   EQDEEVDELLAALGYKVRSSDMADVAQKLEQLEMAMG  68


 Score = 52.0 bits (123),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +3

Query  432  GSDGELQGDD--LSSLASETVHYNPSDLSSWVDSMISELN  545
            G  G    DD  +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  68   GMGGVPAADDGFVSHLAADTVHYNPSDLSSWVESMLSELN  107



>ref|XP_010459010.1| PREDICTED: DELLA protein GAI-like [Camelina sativa]
Length=535

 Score = 57.4 bits (137),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +1

Query  325  EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            EE + + GMDELLAVLGYKV++S+MA+VAQKLEQLE +M +
Sbjct  14   EEDDCNKGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSN  54


 Score = 50.4 bits (119),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            +Q  DLS LA+ETVHYNP++L +W+DSM+S+LN
Sbjct  55   VQEHDLSHLATETVHYNPAELYTWLDSMLSDLN  87



>gb|AEI25530.1| gibberellic acid insensitive protein [Solanum tuberosum]
Length=588

 Score = 70.5 bits (171),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 3/47 (6%)
 Frame = +1

Query  316  KMWEESEQ---DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WEE E+   DAGMDELLAVLGYKVK+SDMA+VAQKLEQLE  MG+
Sbjct  28   KIWEEDEEETPDAGMDELLAVLGYKVKSSDMADVAQKLEQLEMAMGT  74


 Score = 37.7 bits (86),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISEL  542
            D ++ L+++TVH NPSD++ WV SM+S +
Sbjct  78   DGITHLSTDTVHKNPSDMAGWVQSMLSSI  106



>gb|AIW50502.1| dwarf 8 protein, partial [Eulalia villosa]
Length=358

 Score = 56.2 bits (134),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  331  SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLE  432
            +EQ+ GMDE+LA LGYKV++SDMA+VAQKLEQLE
Sbjct  23   AEQEDGMDEMLAALGYKVRSSDMADVAQKLEQLE  56


 Score = 52.0 bits (123),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  76   ISHLATDTVHYNPSDLSSWVESMLSELN  103



>gb|AFD62391.1| reduced height-2 [Eragrostis tef]
 gb|AFD62392.1| reduced height-2 [Eragrostis tef]
 gb|AFD62393.1| reduced height-2 [Eragrostis tef]
 gb|AFD62394.1| reduced height-2 [Eragrostis tef]
 gb|AFD62395.1| reduced height-2 [Eragrostis tef]
Length=617

 Score = 56.2 bits (134),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  32   EQDEEVDELLAALGYKVRSSDMADVAQKLEQLEMAMG  68


 Score = 52.0 bits (123),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +3

Query  432  GSDGELQGDD--LSSLASETVHYNPSDLSSWVDSMISELN  545
            G  G    DD  +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  68   GMGGVPAADDGFVSHLAADTVHYNPSDLSSWVESMLSELN  107



>gb|AFD62385.1| reduced height-1 [Eragrostis tef]
 gb|AFD62386.1| reduced height-1 [Eragrostis tef]
 gb|AFD62387.1| reduced height-1 [Eragrostis tef]
 gb|AFD62388.1| reduced height-1 [Eragrostis tef]
Length=618

 Score = 56.2 bits (134),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  32   EQDEEVDELLAALGYKVRSSDMADVAQKLEQLEMAMG  68


 Score = 52.0 bits (123),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +3

Query  432  GSDGELQGDD--LSSLASETVHYNPSDLSSWVDSMISELN  545
            G  G    DD  +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  68   GMGGVPAADDGFVSHLATDTVHYNPSDLSSWVESMLSELN  107



>ref|XP_006364643.1| PREDICTED: DELLA protein GAI-like [Solanum tuberosum]
Length=588

 Score = 70.5 bits (171),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 3/47 (6%)
 Frame = +1

Query  316  KMWEESEQ---DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K+WEE E+   DAGMDELLAVLGYKVK+SDMA+VAQKLEQLE  MG+
Sbjct  28   KIWEEDEEETPDAGMDELLAVLGYKVKSSDMADVAQKLEQLEMAMGT  74


 Score = 37.7 bits (86),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISEL  542
            D ++ L+++TVH NPSD++ WV SM+S +
Sbjct  78   DGITHLSTDTVHKNPSDMAGWVQSMLSSI  106



>gb|AFD62384.1| reduced height-1 [Eragrostis tef]
 gb|AFD62389.1| reduced height-1 [Eragrostis tef]
 gb|AFD62390.1| reduced height-1 [Eragrostis tef]
Length=618

 Score = 56.2 bits (134),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  32   EQDEEVDELLAALGYKVRSSDMADVAQKLEQLEMAMG  68


 Score = 52.0 bits (123),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +3

Query  432  GSDGELQGDD--LSSLASETVHYNPSDLSSWVDSMISELN  545
            G  G    DD  +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  68   GMGGVPAADDGFVSHLATDTVHYNPSDLSSWVESMLSELN  107



>gb|AFD62360.1| reduced height-1 [Eragrostis tef]
 gb|AFD62361.1| reduced height-1 [Eragrostis tef]
 gb|AFD62362.1| reduced height-1 [Eragrostis tef]
 gb|AFD62363.1| reduced height-1 [Eragrostis tef]
 gb|AFD62364.1| reduced height-1 [Eragrostis tef]
 gb|AFD62365.1| reduced height-1 [Eragrostis tef]
 gb|AFD62366.1| reduced height-1 [Eragrostis tef]
 gb|AFD62367.1| reduced height-1 [Eragrostis tef]
 gb|AFD62368.1| reduced height-1 [Eragrostis tef]
 gb|AFD62379.1| reduced height-1 [Eragrostis tef]
 gb|AFD62380.1| reduced height-1 [Eragrostis tef]
 gb|AFD62381.1| reduced height-1 [Eragrostis tef]
 gb|AFD62382.1| reduced height-1 [Eragrostis tef]
 gb|AFD62383.1| reduced height-1 [Eragrostis tef]
Length=618

 Score = 56.2 bits (134),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  32   EQDEEVDELLAALGYKVRSSDMADVAQKLEQLEMAMG  68


 Score = 52.0 bits (123),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +3

Query  432  GSDGELQGDD--LSSLASETVHYNPSDLSSWVDSMISELN  545
            G  G    DD  +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  68   GMGGVPAADDGFVSHLATDTVHYNPSDLSSWVESMLSELN  107



>gb|AFD62376.1| reduced height-1 [Eragrostis tef]
 gb|AFD62377.1| reduced height-1 [Eragrostis tef]
 gb|AFD62378.1| reduced height-1 [Eragrostis tef]
Length=618

 Score = 56.2 bits (134),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  32   EQDEEVDELLAALGYKVRSSDMADVAQKLEQLEMAMG  68


 Score = 52.0 bits (123),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +3

Query  432  GSDGELQGDD--LSSLASETVHYNPSDLSSWVDSMISELN  545
            G  G    DD  +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  68   GMGGVPAADDGFVSHLATDTVHYNPSDLSSWVESMLSELN  107



>gb|AFD62369.1| reduced height-1 [Eragrostis tef]
 gb|AFD62370.1| reduced height-1 [Eragrostis tef]
 gb|AFD62371.1| reduced height-1 [Eragrostis tef]
 gb|AFD62372.1| reduced height-1 [Eragrostis tef]
 gb|AFD62373.1| reduced height-1 [Eragrostis tef]
 gb|AFD62374.1| reduced height-1 [Eragrostis tef]
 gb|AFD62375.1| reduced height-1 [Eragrostis tef]
Length=618

 Score = 56.2 bits (134),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE  MG
Sbjct  32   EQDEEVDELLAALGYKVRSSDMADVAQKLEQLEMAMG  68


 Score = 52.0 bits (123),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 2/40 (5%)
 Frame = +3

Query  432  GSDGELQGDD--LSSLASETVHYNPSDLSSWVDSMISELN  545
            G  G    DD  +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  68   GMGGVPAADDGFVSHLATDTVHYNPSDLSSWVESMLSELN  107



>gb|ABO61516.1| GAI1 [Glycine max]
Length=523

 Score = 63.9 bits (154),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 3/44 (7%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
             +WEE   + GMDELLAV+GYKV++SDMAEVAQKLE+LEE MG+
Sbjct  25   NLWEE---EGGMDELLAVVGYKVRSSDMAEVAQKLERLEEAMGN  65


 Score = 44.3 bits (103),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 4/50 (8%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSA  590
            G +Q DDL+ L+++ VHYNPSD+S+W+ +M+S     DP  S + E  SA
Sbjct  64   GNVQ-DDLTDLSNDAVHYNPSDISNWLQTMLSNF---DPLPSEEPEKDSA  109



>ref|NP_001240948.1| DELLA protein GAI 1 [Glycine max]
 gb|ACA24488.1| gibberellin insensitive-like protein [Glycine max]
Length=523

 Score = 63.9 bits (154),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 3/44 (7%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
             +WEE   + GMDELLAV+GYKV++SDMAEVAQKLE+LEE MG+
Sbjct  25   NLWEE---EGGMDELLAVVGYKVRSSDMAEVAQKLERLEEAMGN  65


 Score = 44.3 bits (103),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 4/50 (8%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSA  590
            G +Q DDL+ L+++ VHYNPSD+S+W+ +M+S     DP  S + E  SA
Sbjct  64   GNVQ-DDLTDLSNDAVHYNPSDISNWLQTMLSNF---DPLPSEEPEKDSA  109



>ref|NP_001234365.1| DELLA protein GAI [Solanum lycopersicum]
 sp|Q7Y1B6.1|GAI_SOLLC RecName: Full=DELLA protein GAI; AltName: Full=Gibberellic acid-insensitive 
mutant protein [Solanum lycopersicum]
 gb|AAP22369.1| GAI-like protein [Solanum lycopersicum]
Length=588

 Score = 70.5 bits (171),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 3/48 (6%)
 Frame = +1

Query  313  KKMWEESEQ---DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
             K+WEE E+   DAGMDELLAVLGYKVK+SDMA+VAQKLEQLE  MG+
Sbjct  26   SKIWEEDEEEKPDAGMDELLAVLGYKVKSSDMADVAQKLEQLEMAMGT  73


 Score = 37.7 bits (86),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISEL  542
            D ++ L+++TVH NPSD++ WV SM+S +
Sbjct  77   DGITHLSTDTVHKNPSDMAGWVQSMLSSI  105



>gb|AHX57850.1| DELLA [Prunus mume]
Length=597

 Score = 60.5 bits (145),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  349  MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            MDELLAVLGYKV+ASDMAEVA+KLEQLE VMGS
Sbjct  51   MDELLAVLGYKVRASDMAEVAEKLEQLEMVMGS  83


 Score = 47.4 bits (111),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 17/81 (21%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN------LGDP-FLSSQTESSSAIT-  596
            G  Q D +S L S+TVHYNPSDLS WV SM+SE N      + DP F+++ + S ++I  
Sbjct  82   GSAQEDGISQL-SDTVHYNPSDLSGWVQSMLSEFNTVDGSAIDDPLFVAAGSSSITSIHF  140

Query  597  RNSTQI--------FDDSSFD  635
             NS QI         DDS +D
Sbjct  141  SNSHQIENPASRVFHDDSEYD  161



>gb|EPS58722.1| hypothetical protein M569_16090, partial [Genlisea aurea]
Length=520

 Score = 60.1 bits (144),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = +3

Query  456  DDLSSLAS-ETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT  596
            D LS L+S ETVHYNPSDLSSW++SMISELN  DPFL S T  + A T
Sbjct  61   DGLSQLSSSETVHYNPSDLSSWLESMISELNPPDPFLDSSTADNRAGT  108


 Score = 47.8 bits (112),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +1

Query  352  DELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            DEL AVLGY V++SDM +VAQK+++LEE MG
Sbjct  28   DELFAVLGYSVRSSDMEDVAQKIQKLEEAMG  58



>ref|XP_003531153.1| PREDICTED: DELLA protein GAI1-like [Glycine max]
Length=517

 Score = 63.9 bits (154),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 3/44 (7%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
             +WEE   + GMDELLAV+GYKV++SDMAEVAQKLE+LEE MG+
Sbjct  25   NLWEE---EGGMDELLAVVGYKVRSSDMAEVAQKLERLEEAMGN  65


 Score = 43.9 bits (102),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 4/50 (8%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSA  590
            G +Q DDL  ++++ VHYNPSD+S+W+++M+S     DP  S + E  SA
Sbjct  64   GNVQ-DDLPEISNDVVHYNPSDISNWLETMLSNF---DPLPSEEPEKDSA  109



>pdb|2ZSH|B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition 
By The Gibberellin Receptor
 pdb|2ZSI|B Chain B, Structural Basis Of Gibberellin(Ga4)-Induced Della Recognition 
By The Gibberellin Receptor
Length=110

 Score = 55.8 bits (133),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +1

Query  319  MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSF  450
            M  E +   GMDELLAVLGYKV++S+MA+VAQKLEQLE +M + 
Sbjct  14   MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNV  57


 Score = 52.0 bits (123),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            +Q DDLS LA+ETVHYNP++L +W+DSM+++LN
Sbjct  57   VQEDDLSQLATETVHYNPAELYTWLDSMLTDLN  89



>ref|XP_008229195.1| PREDICTED: DELLA protein GAI [Prunus mume]
Length=597

 Score = 60.5 bits (145),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +1

Query  349  MDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            MDELLAVLGYKV+ASDMAEVA+KLEQLE VMGS
Sbjct  51   MDELLAVLGYKVRASDMAEVAEKLEQLEMVMGS  83


 Score = 47.4 bits (111),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 17/81 (21%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELN------LGDP-FLSSQTESSSAI--  593
            G  Q D +S L S+TVHYNPSDLS WV SM+SE N      + DP F+++ + S ++I  
Sbjct  82   GSAQEDGISQL-SDTVHYNPSDLSGWVQSMLSEFNTVDGSAIDDPLFVAAGSSSITSIHF  140

Query  594  -----TRN-STQIF-DDSSFD  635
                 T N ++++F DDS +D
Sbjct  141  SNSHQTENPASRVFHDDSEYD  161



>gb|AIW50653.1| dwarf 8 protein, partial [Eulalia quadrinervis]
Length=357

 Score = 55.8 bits (133),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLE  432
            EQ+ GMDE+LA LGYKV++SDMA+VAQKLEQLE
Sbjct  24   EQEDGMDEMLAALGYKVRSSDMADVAQKLEQLE  56


 Score = 51.6 bits (122),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  73   ISHLATDTVHYNPSDLSSWVESMLSELN  100



>ref|XP_010511563.1| PREDICTED: DELLA protein RGL1-like [Camelina sativa]
Length=508

 Score = 57.0 bits (136),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+G
Sbjct  24   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVLG  60


 Score = 50.1 bits (118),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            L GD +S+L+ ETVHYNPSDLS WV+SM+S+L+
Sbjct  59   LGGDGVSNLSDETVHYNPSDLSGWVESMLSDLD  91



>ref|XP_010415179.1| PREDICTED: DELLA protein RGL1-like [Camelina sativa]
Length=508

 Score = 57.0 bits (136),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+G
Sbjct  24   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVLG  60


 Score = 50.1 bits (118),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            L GD +S+L+ ETVHYNPSDLS WV+SM+S+L+
Sbjct  59   LGGDGVSNLSDETVHYNPSDLSGWVESMLSDLD  91



>ref|XP_010470510.1| PREDICTED: DELLA protein RGL1 isoform X1 [Camelina sativa]
 ref|XP_010470511.1| PREDICTED: DELLA protein RGL1 isoform X2 [Camelina sativa]
Length=508

 Score = 57.0 bits (136),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+G
Sbjct  24   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVLG  60


 Score = 50.1 bits (118),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  447  LQGDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            L GD +S+L+ ETVHYNPSDLS WV+SM+S+L+
Sbjct  59   LGGDGVSNLSDETVHYNPSDLSGWVESMLSDLD  91



>ref|XP_006302161.1| hypothetical protein CARUB_v10020171mg [Capsella rubella]
 gb|EOA35059.1| hypothetical protein CARUB_v10020171mg [Capsella rubella]
Length=505

 Score = 57.0 bits (136),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+G
Sbjct  26   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVLG  62


 Score = 50.1 bits (118),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 31/44 (70%), Gaps = 3/44 (7%)
 Frame = +3

Query  453  GDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESS  584
            GD +S+L  ETVHYNPSDLS WV+SM+S+L   DP  S +   S
Sbjct  62   GDGISNLCDETVHYNPSDLSGWVESMLSDL---DPTRSQEKPGS  102



>ref|XP_002887024.1| hypothetical protein ARALYDRAFT_475738 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63283.1| hypothetical protein ARALYDRAFT_475738 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score = 57.4 bits (137),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+G
Sbjct  26   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVLG  62


 Score = 49.3 bits (116),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  453  GDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            GD +S+L+ ETVHYNPSDLS WV+SM+S+L+
Sbjct  62   GDGISNLSDETVHYNPSDLSGWVESMLSDLD  92



>gb|ADH53781.1| GAI2 [Malus baccata var. xiaojinensis]
Length=570

 Score = 56.2 bits (134),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNPSDLS+W+++MISE+N+  P
Sbjct  27   GCAQEDGLSQLASDTVHYNPSDLSTWLETMISEINVPPP  65


 Score = 50.1 bits (118),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  364  AVLGYKVKASDMAEVAQKLEQLEEVMG  444
            AVLGYKV++SDMA+VAQKLEQLEE MG
Sbjct  1    AVLGYKVRSSDMADVAQKLEQLEEFMG  27



>ref|NP_176809.1| DELLA protein RGL1 [Arabidopsis thaliana]
 sp|Q9C8Y3.1|RGL1_ARATH RecName: Full=DELLA protein RGL1; AltName: Full=GRAS family protein 
9; Short=AtGRAS-9; AltName: Full=RGA-like protein 1; 
Short=RGA-like protein [Arabidopsis thaliana]
 gb|AAG52171.1|AC020665_16 gibberellin regulatory protein, putative; 49974-51509 [Arabidopsis 
thaliana]
 gb|AAL05911.1| RGL1 protein [Arabidopsis thaliana]
 gb|AAL49792.1| putative gibberellin regulatory protein [Arabidopsis thaliana]
 gb|AAM20156.1| putative gibberellin regulatory protein [Arabidopsis thaliana]
 gb|AEE34499.1| DELLA protein RGL1 [Arabidopsis thaliana]
Length=511

 Score = 57.4 bits (137),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+G
Sbjct  26   EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVLG  62


 Score = 49.3 bits (116),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  453  GDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            GD +S+L+ ETVHYNPSDLS WV+SM+S+L+
Sbjct  62   GDGISNLSDETVHYNPSDLSGWVESMLSDLD  92



>gb|ADH53779.1| GAI1 [Malus domestica]
Length=570

 Score = 55.1 bits (131),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G  Q D LS LAS+TVHYNP+DLS+W++SMISE+N   P
Sbjct  27   GCAQEDGLSQLASDTVHYNPADLSTWLESMISEINPPPP  65


 Score = 51.2 bits (121),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 0/27 (0%)
 Frame = +1

Query  364  AVLGYKVKASDMAEVAQKLEQLEEVMG  444
            AVLGYKV++SDMAEVAQKLEQLEE MG
Sbjct  1    AVLGYKVRSSDMAEVAQKLEQLEEFMG  27



>gb|AFR90186.1| GIA/RGA-like gibberellin response modulator, partial [Helianthus 
ciliaris]
Length=223

 Score = 60.5 bits (145),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  316  KMWEE-SEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            KMW++ +E D G DELLAVLGYKVK+SDM +VAQK+E LE V+ +
Sbjct  32   KMWDQFNEHDTGDDELLAVLGYKVKSSDMVDVAQKIEHLEGVLSN  76


 Score = 46.2 bits (108),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 4/52 (8%)
 Frame = +3

Query  438  DGELQGDD-LSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSA  590
            +G L  DD LS +AS++VH NPSDLSSW++SMI +LN   P +  Q   S A
Sbjct  71   EGVLSNDDGLSQMASDSVHQNPSDLSSWLESMICDLN---PVVQFQLPGSIA  119



>gb|AIW50676.1| dwarf 8 protein, partial [Saccharum arundinaceum]
Length=354

 Score = 54.3 bits (129),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLE  432
            EQD  MDE+LA LGYKV++SDMA+VAQKLEQLE
Sbjct  24   EQDEEMDEMLAALGYKVRSSDMADVAQKLEQLE  56


 Score = 52.0 bits (123),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  76   ISHLATDTVHYNPSDLSSWVESMLSELN  103



>gb|AIW50533.1| dwarf 8 protein, partial [Plagiantha tenella]
Length=354

 Score = 54.3 bits (129),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLE  432
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE
Sbjct  24   EQDEDVDELLAALGYKVRSSDMADVAQKLEQLE  56


 Score = 52.0 bits (123),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LAS+TVHYNPSDLSSWV+SM+SELN
Sbjct  76   VSHLASDTVHYNPSDLSSWVESMLSELN  103



>emb|CAA12242.1| RGA-like [Arabidopsis thaliana]
Length=662

 Score = 57.0 bits (136),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG  444
            E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+G
Sbjct  177  EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVLG  213


 Score = 49.3 bits (116),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +3

Query  453  GDDLSSLASETVHYNPSDLSSWVDSMISELN  545
            GD +S+L+ ETVHYNPSDLS WV+SM+S+L+
Sbjct  213  GDGISNLSDETVHYNPSDLSGWVESMLSDLD  243



>ref|XP_010528540.1| PREDICTED: DELLA protein RGL1 [Tarenaya hassleriana]
Length=546

 Score = 53.1 bits (126),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  328  ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            E ++  G+DELL VLGYKV +SDMA+VA+KLE+LE V+GS
Sbjct  42   EEKETTGVDELLVVLGYKVLSSDMADVAEKLEELEMVLGS  81


 Score = 53.1 bits (126),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 39/63 (62%), Gaps = 15/63 (24%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFD  620
            G +Q D +S L+++TVHYNPSDLS WVD+M+++L+                TRN  ++F+
Sbjct  80   GSVQDDGISHLSNDTVHYNPSDLSGWVDTMLADLD---------------ATRNHCRVFE  124

Query  621  DSS  629
            D S
Sbjct  125  DHS  127



>ref|XP_002876760.1| RGA1 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53019.1| RGA1 protein [Arabidopsis lyrata subsp. lyrata]
Length=580

 Score = 54.3 bits (129),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 2/47 (4%)
 Frame = +1

Query  313  KKMWEESEQDAGM--DELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            K M  + E+D G   DELLAVLGYKV++S+MAEVA KLEQLE +MG+
Sbjct  26   KMMMVKKEEDGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMGN  72


 Score = 52.0 bits (123),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +3

Query  441  GELQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDP  557
            G +Q D LS LA++TVHYNPS+L SW+D+M+S+LN   P
Sbjct  71   GNVQEDGLSHLATDTVHYNPSELYSWLDNMLSDLNPPPP  109



>gb|AIW50677.1| dwarf 8 protein, partial [Saccharum arundinaceum]
Length=354

 Score = 54.3 bits (129),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLE  432
            EQD  MDE+LA LGYKV++SDMA+VAQKLEQLE
Sbjct  24   EQDEEMDEMLAALGYKVRSSDMADVAQKLEQLE  56


 Score = 52.0 bits (123),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  76   ISHLATDTVHYNPSDLSSWVESMLSELN  103



>gb|AIW50614.1| dwarf 8 protein, partial [Tripidium ravennae]
Length=354

 Score = 54.3 bits (129),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLE  432
            EQD  MDE+LA LGYKV++SDMA+VAQKLEQLE
Sbjct  24   EQDEEMDEMLAALGYKVRSSDMADVAQKLEQLE  56


 Score = 52.0 bits (123),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  76   ISHLATDTVHYNPSDLSSWVESMLSELN  103



>gb|AIW50532.1| dwarf 8 protein, partial [Plagiantha tenella]
Length=353

 Score = 53.9 bits (128),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  334  EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLE  432
            EQD  +DELLA LGYKV++SDMA+VAQKLEQLE
Sbjct  24   EQDEDVDELLAALGYKVRSSDMADVAQKLEQLE  56


 Score = 52.0 bits (123),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LAS+TVHYNPSDLSSWV+SM+SELN
Sbjct  76   VSHLASDTVHYNPSDLSSWVESMLSELN  103



>gb|AIW50605.1| dwarf 8 protein, partial [Chrysopogon zizanioides]
Length=348

 Score = 53.9 bits (128),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +1

Query  316  KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLE  432
            KM   +EQ+  +DELLA LGYKV++SDMA+VAQKLEQLE
Sbjct  16   KMMAAAEQEEEVDELLAALGYKVRSSDMADVAQKLEQLE  54


 Score = 51.6 bits (122),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +3

Query  462  LSSLASETVHYNPSDLSSWVDSMISELN  545
            +S LA++TVHYNPSDLSSWV+SM+SELN
Sbjct  74   VSHLATDTVHYNPSDLSSWVESMLSELN  101



>ref|XP_006416958.1| hypothetical protein EUTSA_v10007323mg [Eutrema salsugineum]
 dbj|BAJ34426.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35311.1| hypothetical protein EUTSA_v10007323mg [Eutrema salsugineum]
Length=535

 Score = 55.5 bits (132),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = +1

Query  346  GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGS  447
            GMDELLAVLGYKV++S+MAEVAQKLEQLE +M +
Sbjct  20   GMDELLAVLGYKVQSSEMAEVAQKLEQLEVMMSN  53


 Score = 49.7 bits (117),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +3

Query  456  DDLSSLASETVHYNPSDLSSWVDSMISELN  545
            DDLS LA+ TVHYNPS L +W+DSM+S+LN
Sbjct  57   DDLSQLATRTVHYNPSQLYTWLDSMLSDLN  86



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125