BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045F20

Length=605
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    193   3e-55   Solanum lycopersicum
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   7e-55   Solanum tuberosum [potatoes]
ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   1e-54   Nicotiana sylvestris
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   3e-54   Nicotiana tomentosiformis
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   1e-51   
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    183   3e-51   Nicotiana sylvestris
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   4e-51   Sesamum indicum [beniseed]
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg                181   8e-51   Erythranthe guttata [common monkey flower]
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   1e-50   Solanum lycopersicum
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   6e-50   Solanum tuberosum [potatoes]
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    178   2e-49   Sesamum indicum [beniseed]
gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg                178   2e-49   Erythranthe guttata [common monkey flower]
gb|KDP28482.1|  hypothetical protein JCGZ_14253                         177   6e-49   Jatropha curcas
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg             167   1e-45   
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg             167   2e-45   Citrus clementina [clementine]
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    167   3e-45   Citrus sinensis [apfelsine]
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg                165   1e-44   Erythranthe guttata [common monkey flower]
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    165   2e-44   Populus euphratica
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   2e-44   
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   2e-44   
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   4e-44   Populus euphratica
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...    163   8e-44   Ricinus communis
emb|CDP08669.1|  unnamed protein product                                163   9e-44   Coffea canephora [robusta coffee]
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   9e-44   
ref|XP_002320868.1|  aspartyl protease family protein                   163   9e-44   Populus trichocarpa [western balsam poplar]
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   1e-42   
emb|CDY15187.1|  BnaC05g00660D                                          159   2e-42   Brassica napus [oilseed rape]
ref|XP_002302634.2|  aspartyl protease family protein                   159   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    158   5e-42   Eucalyptus grandis [rose gum]
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             158   5e-42   Eutrema salsugineum [saltwater cress]
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    158   5e-42   Pyrus x bretschneideri [bai li]
gb|EPS66029.1|  hypothetical protein M569_08742                         157   9e-42   Genlisea aurea
ref|XP_002892074.1|  aspartyl protease family protein                   157   1e-41   
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   1e-41   Cucumis sativus [cucumbers]
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                  157   1e-41   Morus notabilis
emb|CBI40559.3|  unnamed protein product                                156   1e-41   Vitis vinifera
gb|KEH24641.1|  eukaryotic aspartyl protease family protein             156   2e-41   Medicago truncatula
gb|KJB49569.1|  hypothetical protein B456_008G125700                    156   3e-41   Gossypium raimondii
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    156   3e-41   Vitis vinifera
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   4e-40   Camelina sativa [gold-of-pleasure]
emb|CDX90023.1|  BnaA10g00590D                                          151   2e-39   
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    151   2e-39   Brassica rapa
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein          150   4e-39   Phaseolus vulgaris [French bean]
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g             150   5e-39   Phaseolus vulgaris [French bean]
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor             149   6e-39   Phaseolus vulgaris [French bean]
ref|NP_171637.1|  aspartyl protease family protein                      149   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g             150   9e-39   Phaseolus vulgaris [French bean]
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative      149   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   1e-38   Malus domestica [apple tree]
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   2e-38   Camelina sativa [gold-of-pleasure]
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                    148   2e-38   Arabis alpina [alpine rockcress]
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    146   9e-38   Cucumis melo [Oriental melon]
emb|CDX89133.1|  BnaA04g00530D                                          145   3e-37   
ref|XP_002878415.1|  aspartyl protease family protein                   145   4e-37   
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   5e-37   Tarenaya hassleriana [spider flower]
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   6e-37   Fragaria vesca subsp. vesca
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   6e-37   Glycine max [soybeans]
emb|CDY43952.1|  BnaC04g21580D                                          144   6e-37   Brassica napus [oilseed rape]
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   6e-37   Brassica rapa
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                    144   7e-37   Arabis alpina [alpine rockcress]
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg             143   1e-36   Capsella rubella
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...    143   2e-36   
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    142   3e-36   Cucumis sativus [cucumbers]
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                       142   3e-36   Cucumis sativus [cucumbers]
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...    142   5e-36   
emb|CDY25081.1|  BnaC06g18230D                                          141   7e-36   Brassica napus [oilseed rape]
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    141   8e-36   Camelina sativa [gold-of-pleasure]
gb|AAK64003.1|  AT3g61820/F15G16_210                                    139   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    140   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_191741.1|  aspartyl protease                                     139   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   1e-34   Glycine max [soybeans]
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   1e-34   Phoenix dactylifera
emb|CDX67868.1|  BnaA07g19080D                                          137   1e-34   
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   2e-34   Brassica rapa
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    137   2e-34   Tarenaya hassleriana [spider flower]
gb|KJB09628.1|  hypothetical protein B456_001G154400                    135   5e-34   Gossypium raimondii
gb|KJB09626.1|  hypothetical protein B456_001G154400                    135   7e-34   Gossypium raimondii
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    135   9e-34   Elaeis guineensis
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   5e-33   Camelina sativa [gold-of-pleasure]
gb|KJB41527.1|  hypothetical protein B456_007G108800                    132   1e-32   Gossypium raimondii
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   2e-32   Elaeis guineensis
gb|ABK24467.1|  unknown                                                 132   2e-32   Picea sitchensis
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660          124   6e-30   Amborella trichopoda
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg             124   9e-30   Eutrema salsugineum [saltwater cress]
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   2e-29   
ref|NP_001043485.1|  Os01g0598600                                       123   2e-29   
gb|EAZ12575.1|  hypothetical protein OsJ_02481                          122   3e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011461997.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   6e-29   Fragaria vesca subsp. vesca
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   6e-28   Setaria italica
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   8e-28   Glycine max [soybeans]
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   1e-26   Brachypodium distachyon [annual false brome]
ref|XP_002440367.1|  hypothetical protein SORBIDRAFT_09g030430          115   1e-26   
dbj|BAJ86414.1|  predicted protein                                      114   4e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011007544.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   1e-25   Populus euphratica
ref|XP_011031192.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   1e-25   Populus euphratica
gb|KEH44446.1|  aspartic protease in GUARD CELL-like protein            111   3e-25   Medicago truncatula
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358              111   3e-25   
gb|ABK24480.1|  unknown                                                 111   4e-25   Picea sitchensis
ref|XP_002306246.2|  hypothetical protein POPTR_0005s06390g             111   5e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010248951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   9e-25   Nelumbo nucifera [Indian lotus]
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g             110   9e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   1e-24   Pyrus x bretschneideri [bai li]
ref|XP_009351765.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   1e-24   
gb|KJB77420.1|  hypothetical protein B456_012G135900                    109   2e-24   Gossypium raimondii
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970          109   2e-24   
gb|KDP40474.1|  hypothetical protein JCGZ_24473                         108   3e-24   Jatropha curcas
ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   4e-24   Solanum tuberosum [potatoes]
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   4e-24   Prunus mume [ume]
ref|XP_004497254.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   5e-24   Cicer arietinum [garbanzo]
ref|XP_009629151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   5e-24   Nicotiana tomentosiformis
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   5e-24   Populus euphratica
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg             108   5e-24   Eutrema salsugineum [saltwater cress]
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g             107   6e-24   Phaseolus vulgaris [French bean]
gb|ABK25248.1|  unknown                                                 107   6e-24   Picea sitchensis
gb|KDO69941.1|  hypothetical protein CISIN_1g011042mg                   107   1e-23   Citrus sinensis [apfelsine]
gb|KHN16429.1|  Aspartic proteinase nepenthesin-1                       101   1e-23   Glycine soja [wild soybean]
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   Cucumis sativus [cucumbers]
emb|CDY24395.1|  BnaCnng04620D                                          107   1e-23   Brassica napus [oilseed rape]
ref|XP_006437655.1|  hypothetical protein CICLE_v10031332mg             107   1e-23   
ref|XP_006484478.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   Citrus sinensis [apfelsine]
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   2e-23   
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   2e-23   Pyrus x bretschneideri [bai li]
gb|ABR17085.1|  unknown                                                 107   2e-23   Picea sitchensis
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   Cucumis melo [Oriental melon]
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   
ref|XP_008465249.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   Cucumis melo [Oriental melon]
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg             106   2e-23   Prunus persica
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   Setaria italica
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   3e-23   Solanum lycopersicum
emb|CDY24483.1|  BnaC05g34710D                                          106   3e-23   Brassica napus [oilseed rape]
ref|XP_002267930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   3e-23   Vitis vinifera
gb|KJB49971.1|  hypothetical protein B456_008G147500                    105   3e-23   Gossypium raimondii
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   3e-23   
ref|NP_001056485.1|  Os05g0590000                                       105   3e-23   
gb|AAT38006.1|  unknow protein                                          105   4e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99240.1|  hypothetical protein OsI_21202                          105   4e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   4e-23   Glycine max [soybeans]
gb|KJB37242.1|  hypothetical protein B456_006G195400                    105   4e-23   Gossypium raimondii
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   4e-23   Brassica rapa
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   4e-23   Malus domestica [apple tree]
ref|XP_007043208.1|  Aspartic proteinase nepenthesin-1, putative        105   5e-23   
emb|CDX92240.1|  BnaA05g21670D                                          105   6e-23   
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   6e-23   
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   6e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   6e-23   Elaeis guineensis
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   7e-23   Citrus sinensis [apfelsine]
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                   105   7e-23   Citrus sinensis [apfelsine]
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg             105   7e-23   Citrus clementina [clementine]
ref|XP_009385987.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   8e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   9e-23   Glycine max [soybeans]
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g             104   1e-22   Phaseolus vulgaris [French bean]
ref|XP_006406427.1|  hypothetical protein EUTSA_v10020671mg             104   1e-22   Eutrema salsugineum [saltwater cress]
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750          104   1e-22   Amborella trichopoda
ref|XP_010541885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-22   
ref|XP_004297710.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   Fragaria vesca subsp. vesca
ref|XP_010533981.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_010279486.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   Nelumbo nucifera [Indian lotus]
gb|KJB79793.1|  hypothetical protein B456_013G067200                    103   2e-22   Gossypium raimondii
ref|XP_008351877.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    103   2e-22   
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    103   3e-22   
emb|CBI35367.3|  unnamed protein product                                103   4e-22   Vitis vinifera
ref|XP_003637421.1|  Aspartic proteinase nepenthesin-1                  100   4e-22   
ref|XP_002885351.1|  pepsin A                                           102   4e-22   Arabidopsis lyrata subsp. lyrata
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   5e-22   Brassica rapa
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg             102   5e-22   Capsella rubella
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   5e-22   Nicotiana tomentosiformis
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   6e-22   Phoenix dactylifera
ref|XP_010103590.1|  Aspartic proteinase nepenthesin-2                  102   6e-22   Morus notabilis
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...    102   7e-22   Ricinus communis
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   7e-22   Pyrus x bretschneideri [bai li]
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504              102   8e-22   
gb|EYU40681.1|  hypothetical protein MIMGU_mgv1a005122mg                102   1e-21   Erythranthe guttata [common monkey flower]
ref|XP_009760593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   1e-21   Nicotiana sylvestris
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    102   1e-21   Phoenix dactylifera
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Phoenix dactylifera
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Cucumis melo [Oriental melon]
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Elaeis guineensis
ref|XP_010487964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004150193.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   1e-21   Cucumis sativus [cucumbers]
ref|NP_173922.1|  aspartyl protease family protein                      101   1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002275164.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   2e-21   Vitis vinifera
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-21   
ref|XP_010466176.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   2e-21   Cicer arietinum [garbanzo]
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   2e-21   Brassica rapa
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein            100   2e-21   Medicago truncatula
emb|CDY69364.1|  BnaCnng63170D                                          100   2e-21   Brassica napus [oilseed rape]
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   3e-21   
gb|KFK39328.1|  hypothetical protein AALP_AA3G230300                    100   3e-21   Arabis alpina [alpine rockcress]
ref|NP_188636.2|  protein ASPARTIC PROTEASE IN GUARD CELL 2             100   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   3e-21   Cucumis sativus [cucumbers]
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                    100   3e-21   Arabis alpina [alpine rockcress]
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   Populus euphratica
ref|XP_006360843.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   Solanum tuberosum [potatoes]
ref|XP_004960076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   Setaria italica
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   Brassica rapa
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   
gb|ABR16474.1|  unknown                                                 100   4e-21   Picea sitchensis
ref|XP_003520035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   Glycine max [soybeans]
ref|XP_003517994.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   4e-21   Glycine max [soybeans]
ref|XP_002315953.1|  aspartyl protease family protein                   100   4e-21   Populus trichocarpa [western balsam poplar]
emb|CDY51131.1|  BnaA07g37140D                                        99.4    5e-21   Brassica napus [oilseed rape]
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   5e-21   Solanum lycopersicum
dbj|BAK07248.1|  predicted protein                                      100   5e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009145693.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    5e-21   Brassica rapa
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    5e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  99.8    6e-21   
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    6e-21   Cucumis sativus [cucumbers]
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   6e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010508355.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004238952.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    6e-21   Solanum lycopersicum
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.4    6e-21   
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.8    7e-21   Camelina sativa [gold-of-pleasure]
emb|CAE05761.2|  OSJNBa0064G10.12                                     99.0    8e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054261.2|  Os04g0677100                                     99.0    8e-21   
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.4    9e-21   Solanum tuberosum [potatoes]
emb|CAJ86229.1|  H0402C08.5                                           99.0    1e-20   Oryza sativa [red rice]
ref|XP_006297584.1|  hypothetical protein CARUB_v10013606mg           99.0    1e-20   Capsella rubella
gb|EAZ32412.1|  hypothetical protein OsJ_16623                        99.0    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010551158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.6    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.6    2e-20   
ref|XP_007153018.1|  hypothetical protein PHAVU_003G000900g           98.2    2e-20   Phaseolus vulgaris [French bean]
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230            97.8    2e-20   
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369           97.8    2e-20   
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.2    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002885261.1|  aspartyl protease family protein                 98.2    2e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_010044282.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  98.2    3e-20   Eucalyptus grandis [rose gum]
ref|XP_010265215.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.8    3e-20   Nelumbo nucifera [Indian lotus]
gb|KCW86348.1|  hypothetical protein EUGRSUZ_B03036                   97.8    3e-20   Eucalyptus grandis [rose gum]
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.8    3e-20   Camelina sativa [gold-of-pleasure]
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                  97.8    3e-20   Arabis alpina [alpine rockcress]
gb|KDP20100.1|  hypothetical protein JCGZ_05869                       97.8    3e-20   Jatropha curcas
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg           97.4    4e-20   Capsella rubella
ref|XP_002890686.1|  aspartyl protease family protein                 97.4    5e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_010031370.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.1    5e-20   Eucalyptus grandis [rose gum]
gb|KDO70057.1|  hypothetical protein CISIN_1g0117491mg                94.7    5e-20   Citrus sinensis [apfelsine]
ref|XP_006653026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.1    6e-20   Oryza brachyantha
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1           97.1    6e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KDP29378.1|  hypothetical protein JCGZ_18299                       96.7    7e-20   Jatropha curcas
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg           97.1    7e-20   Eutrema salsugineum [saltwater cress]
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  97.1    8e-20   Elaeis guineensis
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...  96.7    8e-20   Ricinus communis
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.7    8e-20   Fragaria vesca subsp. vesca
gb|KJB52970.1|  hypothetical protein B456_008G285900                  96.7    9e-20   Gossypium raimondii
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.7    9e-20   Tarenaya hassleriana [spider flower]
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.3    9e-20   Cicer arietinum [garbanzo]
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein     96.3    1e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  96.3    1e-19   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY03848.1|  BnaC07g10730D                                        95.9    1e-19   
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g           95.9    2e-19   Phaseolus vulgaris [French bean]
ref|XP_003589787.1|  Aspartic proteinase nepenthesin-2                95.5    2e-19   
emb|CDM80984.1|  unnamed protein product                              95.9    2e-19   Triticum aestivum [Canadian hard winter wheat]
gb|AES60038.2|  aspartic protease in GUARD CELL-like protein          95.5    2e-19   Medicago truncatula
ref|XP_011459743.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.8    2e-19   Fragaria vesca subsp. vesca
emb|CDM83204.1|  unnamed protein product                              95.5    2e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g           95.5    2e-19   Populus trichocarpa [western balsam poplar]
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.1    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.1    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_006484425.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.1    3e-19   Citrus sinensis [apfelsine]
ref|XP_009608744.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    3e-19   Nicotiana tomentosiformis
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048            94.0    4e-19   
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900        94.7    4e-19   Sorghum bicolor [broomcorn]
gb|KJB50738.1|  hypothetical protein B456_008G185200                  94.7    4e-19   Gossypium raimondii
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    4e-19   Cicer arietinum [garbanzo]
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    4e-19   Populus euphratica
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    5e-19   
ref|XP_004253208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    5e-19   Solanum lycopersicum
emb|CDX75968.1|  BnaC03g40510D                                        94.4    6e-19   
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    6e-19   Prunus mume [ume]
ref|XP_011089579.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  94.0    6e-19   Sesamum indicum [beniseed]
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.0    7e-19   Brassica rapa
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.4    7e-19   Brachypodium distachyon [annual false brome]
ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.0    7e-19   
ref|XP_002529147.1|  Aspartic proteinase nepenthesin-1 precursor,...  93.6    8e-19   
emb|CDX82342.1|  BnaA03g34790D                                        94.0    8e-19   
emb|CDY25371.1|  BnaA05g19130D                                        92.8    8e-19   
ref|XP_006437718.1|  hypothetical protein CICLE_v10031364mg           93.6    8e-19   
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    1e-18   
ref|XP_006341626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.6    1e-18   
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.2    1e-18   
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.2    1e-18   
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  93.2    1e-18   
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630        93.2    1e-18   
ref|XP_010092769.1|  Aspartic proteinase nepenthesin-1                93.2    2e-18   
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein      92.8    2e-18   
dbj|BAJ97639.1|  predicted protein                                    92.8    2e-18   
emb|CDP04865.1|  unnamed protein product                              93.2    2e-18   
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  93.2    2e-18   
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.4    3e-18   
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.8    3e-18   
ref|XP_004235788.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.0    4e-18   
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.0    4e-18   
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.0    4e-18   
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.7    4e-18   
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    6e-18   
ref|XP_009770623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    1e-17   
gb|ABR17396.1|  unknown                                               89.0    1e-17   
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg           90.5    1e-17   
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    1e-17   
emb|CDY24567.1|  BnaC05g32510D                                        89.0    2e-17   
ref|XP_009800603.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    2e-17   
gb|ABK24255.1|  unknown                                               89.7    2e-17   
emb|CDP20336.1|  unnamed protein product                              89.7    2e-17   
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971            89.0    3e-17   
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039            89.4    3e-17   
ref|XP_007046283.1|  Eukaryotic aspartyl protease family protein      89.4    3e-17   
gb|EMS50115.1|  Aspartic proteinase nepenthesin-2                     86.7    3e-17   
ref|XP_010688619.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    6e-17   
ref|XP_006646269.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    6e-17   
ref|XP_006843768.1|  hypothetical protein AMTR_s00007p00241440        88.6    6e-17   
gb|EAY75637.1|  hypothetical protein OsI_03542                        87.8    7e-17   
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg           88.6    7e-17   
dbj|BAB84414.1|  chloroplast nucleoid DNA-binding protein cnd41-like  87.8    8e-17   
gb|EAZ13356.1|  hypothetical protein OsJ_03278                        87.8    9e-17   
ref|XP_010911344.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    1e-16   
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    1e-16   
gb|EAY72465.1|  hypothetical protein OsI_00321                        85.9    1e-16   
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.4    2e-16   
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966            85.9    2e-16   
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg              87.0    2e-16   
gb|EPS61272.1|  hypothetical protein M569_13524                       87.0    2e-16   
gb|EYU40867.1|  hypothetical protein MIMGU_mgv1a023461mg              87.0    2e-16   
ref|XP_004972145.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    2e-16   
ref|XP_008668689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  86.7    2e-16   
ref|XP_010105777.1|  Aspartic proteinase nepenthesin-1                87.0    2e-16   
gb|EAY72467.1|  hypothetical protein OsI_00323                        86.7    3e-16   
tpg|DAA35351.1|  TPA: hypothetical protein ZEAMMB73_696016            86.7    3e-16   
ref|NP_001041979.1|  Os01g0140100                                     86.3    4e-16   
emb|CBI27051.3|  unnamed protein product                              84.0    4e-16   
ref|XP_010695864.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  85.9    4e-16   
ref|XP_001759252.1|  predicted protein                                84.7    5e-16   
ref|XP_002442590.1|  hypothetical protein SORBIDRAFT_08g022570        85.5    6e-16   
ref|XP_002442591.1|  hypothetical protein SORBIDRAFT_08g022580        85.5    7e-16   
ref|XP_001757102.1|  predicted protein                                84.3    8e-16   
ref|XP_002468182.1|  hypothetical protein SORBIDRAFT_01g041210        85.1    9e-16   
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135            83.6    9e-16   
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134            83.6    9e-16   
emb|CDP20730.1|  unnamed protein product                              84.7    1e-15   
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470            82.8    3e-15   
ref|XP_002443631.1|  hypothetical protein SORBIDRAFT_08g022620        82.8    5e-15   
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  81.3    2e-14   
gb|KEH27070.1|  aspartic protease in GUARD CELL-like protein          81.3    2e-14   
ref|XP_008229704.1|  PREDICTED: uncharacterized protein LOC103329046  81.6    3e-14   
ref|XP_011072934.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.9    3e-14   
ref|XP_007215315.1|  hypothetical protein PRUPE_ppa003547mg           80.5    4e-14   
ref|XP_010524109.1|  PREDICTED: aspartic proteinase nepenthesin-1...  80.1    5e-14   
ref|XP_008784432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  80.1    5e-14   
ref|XP_008670374.1|  PREDICTED: aspartic proteinase nepenthesin-2...  79.7    6e-14   
gb|KHN11976.1|  Aspartic proteinase nepenthesin-1                     79.7    8e-14   
ref|XP_009377195.1|  PREDICTED: aspartic proteinase nepenthesin-2...  79.3    9e-14   
ref|XP_001784204.1|  predicted protein                                78.2    9e-14   
ref|XP_004500468.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  79.3    9e-14   
ref|XP_008380197.1|  PREDICTED: aspartic proteinase nepenthesin-2     78.6    2e-13   
ref|XP_008393394.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.1    2e-13   
emb|CDP15730.1|  unnamed protein product                              78.2    2e-13   
emb|CDO98452.1|  unnamed protein product                              77.8    2e-13   
ref|XP_011044763.1|  PREDICTED: aspartic proteinase nepenthesin-2...  78.2    2e-13   
gb|KDP26966.1|  hypothetical protein JCGZ_22200                       78.2    2e-13   
ref|XP_002307559.2|  hypothetical protein POPTR_0005s22630g           77.8    3e-13   
ref|XP_009625562.1|  PREDICTED: aspartic proteinase nepenthesin-2...  77.4    4e-13   
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  77.0    5e-13   
ref|NP_181826.1|  aspartyl protease-like protein                      77.0    5e-13   
ref|XP_006595492.1|  PREDICTED: uncharacterized protein LOC100305...  77.8    5e-13   
ref|XP_010517850.1|  PREDICTED: aspartic proteinase CDR1-like         77.0    5e-13   
emb|CDM84701.1|  unnamed protein product                              76.6    5e-13   
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161            75.5    7e-13   
ref|XP_002446596.1|  hypothetical protein SORBIDRAFT_06g018693        72.8    7e-13   
ref|XP_008778737.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  76.6    8e-13   
ref|XP_008356685.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  74.3    1e-12   
ref|XP_004503002.1|  PREDICTED: aspartic proteinase nepenthesin-1...  75.9    1e-12   
ref|XP_009625615.1|  PREDICTED: aspartic proteinase nepenthesin-1     75.9    1e-12   
ref|XP_008353635.1|  PREDICTED: aspartic proteinase nepenthesin-2...  76.3    1e-12   
gb|KJB08584.1|  hypothetical protein B456_001G092100                  75.9    1e-12   
ref|XP_007048982.1|  Eukaryotic aspartyl protease family protein ...  75.9    1e-12   
ref|XP_006857554.1|  hypothetical protein AMTR_s00061p00053330        75.5    1e-12   
ref|XP_003617399.1|  60S ribosomal protein L18a                       76.3    1e-12   
ref|XP_007048981.1|  Eukaryotic aspartyl protease family protein ...  75.9    1e-12   
ref|XP_006648575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.5    2e-12   
ref|XP_011467594.1|  PREDICTED: aspartic proteinase nepenthesin-2     75.9    2e-12   
dbj|BAK01404.1|  predicted protein                                    75.5    2e-12   
ref|NP_174430.1|  aspartyl protease-like protein                      75.1    2e-12   
ref|XP_007141420.1|  hypothetical protein PHAVU_008G193900g           75.5    2e-12   
tpg|DAA40201.1|  TPA: hypothetical protein ZEAMMB73_629620            74.7    2e-12   
ref|XP_011085418.1|  PREDICTED: aspartic proteinase nepenthesin-2...  75.1    2e-12   
ref|XP_002881883.1|  hypothetical protein ARALYDRAFT_903676           75.1    3e-12   
ref|NP_001170221.1|  uncharacterized protein LOC100384173 precursor   74.7    3e-12   
gb|AET00358.2|  eukaryotic aspartyl protease family protein           75.1    3e-12   
ref|XP_001779661.1|  predicted protein                                74.3    3e-12   
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075        74.7    3e-12   
ref|XP_010241281.1|  PREDICTED: aspartic proteinase nepenthesin-1...  75.1    3e-12   
ref|XP_001751688.1|  predicted protein                                74.3    3e-12   
ref|XP_009363121.1|  PREDICTED: aspartic proteinase nepenthesin-1     74.7    3e-12   
ref|XP_010241283.1|  PREDICTED: aspartic proteinase nepenthesin-1...  74.7    3e-12   
gb|KHN38336.1|  Aspartic proteinase nepenthesin-2                     74.7    3e-12   
ref|XP_008381436.1|  PREDICTED: aspartic proteinase nepenthesin-1     74.3    3e-12   
ref|XP_008227834.1|  PREDICTED: aspartic proteinase nepenthesin-1     74.3    4e-12   
ref|XP_006354419.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  74.7    4e-12   
ref|XP_010508488.1|  PREDICTED: aspartic proteinase CDR1-like         74.3    4e-12   
ref|XP_007146932.1|  hypothetical protein PHAVU_006G083000g           74.3    4e-12   
ref|XP_002442593.1|  hypothetical protein SORBIDRAFT_08g022613        74.3    4e-12   
ref|XP_007221482.1|  hypothetical protein PRUPE_ppa005446mg           73.9    5e-12   
ref|XP_009801916.1|  PREDICTED: aspartic proteinase nepenthesin-1     73.9    5e-12   
ref|NP_001046662.1|  Os02g0314600                                     73.9    5e-12   
gb|EAY85563.1|  hypothetical protein OsI_06935                        73.9    6e-12   
emb|CDX98347.1|  BnaC06g17080D                                        73.9    6e-12   
ref|XP_009356605.1|  PREDICTED: aspartic proteinase nepenthesin-2...  73.9    6e-12   
ref|XP_011100548.1|  PREDICTED: aspartic proteinase nepenthesin-2...  73.9    7e-12   
ref|XP_003552901.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.9    7e-12   
ref|XP_003537377.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.6    7e-12   
gb|KHN24691.1|  Aspartic proteinase nepenthesin-2                     73.6    7e-12   
ref|XP_004239252.1|  PREDICTED: aspartic proteinase nepenthesin-1...  73.6    7e-12   
ref|XP_003580821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.6    8e-12   
ref|XP_009390735.1|  PREDICTED: aspartic proteinase nepenthesin-2...  73.6    8e-12   
ref|XP_010506150.1|  PREDICTED: aspartic proteinase CDR1-like         73.6    8e-12   
emb|CDY53652.1|  BnaC04g52860D                                        73.6    9e-12   
ref|XP_010499694.1|  PREDICTED: probable aspartic protease At2g35615  73.2    9e-12   
ref|XP_006574359.1|  PREDICTED: uncharacterized protein LOC100527...  73.9    9e-12   
ref|XP_004486405.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.2    9e-12   
ref|XP_010480892.1|  PREDICTED: probable aspartic protease At2g35615  73.2    9e-12   
emb|CDX79836.1|  BnaA05g03200D                                        73.2    1e-11   
ref|XP_010525594.1|  PREDICTED: aspartic proteinase nepenthesin-2     73.2    1e-11   
ref|XP_004952344.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.2    1e-11   
ref|XP_004491319.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...  73.6    1e-11   
ref|XP_006345762.1|  PREDICTED: aspartic proteinase nepenthesin-1...  72.8    1e-11   
ref|XP_010058011.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.8    1e-11   
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748  73.2    1e-11   
ref|XP_009760965.1|  PREDICTED: aspartic proteinase nepenthesin-2...  72.8    2e-11   
ref|XP_006411570.1|  hypothetical protein EUTSA_v10016513mg           72.8    2e-11   
ref|XP_004239638.1|  PREDICTED: aspartic proteinase nepenthesin-1     72.0    2e-11   
ref|XP_010904875.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.4    2e-11   
ref|XP_009421481.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.4    2e-11   
ref|XP_006296519.1|  hypothetical protein CARUB_v10025708mg           72.0    2e-11   
ref|XP_002520371.1|  basic 7S globulin 2 precursor small subunit,...  72.4    2e-11   
gb|KDO51883.1|  hypothetical protein CISIN_1g041228mg                 72.0    2e-11   
ref|XP_006290872.1|  hypothetical protein CARUB_v10016982mg           72.0    3e-11   
ref|XP_009104182.1|  PREDICTED: aspartic proteinase nepenthesin-2     72.0    3e-11   
ref|XP_002460653.1|  hypothetical protein SORBIDRAFT_02g032590        71.6    3e-11   
ref|XP_006437136.1|  hypothetical protein CICLE_v10031104mg           72.0    3e-11   
ref|XP_010504886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.6    3e-11   
ref|XP_009142895.1|  PREDICTED: aspartic proteinase nepenthesin-2     71.6    3e-11   
gb|KEH33552.1|  eukaryotic aspartyl protease family protein           71.6    3e-11   
ref|XP_004168776.1|  PREDICTED: aspartic proteinase nepenthesin-1...  71.6    3e-11   
ref|XP_004243605.1|  PREDICTED: aspartic proteinase nepenthesin-2...  71.6    3e-11   
gb|KGN54860.1|  hypothetical protein Csa_4G554680                     71.6    3e-11   
ref|XP_010913225.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.6    3e-11   
ref|XP_010916060.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.6    3e-11   
ref|XP_006597643.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.6    3e-11   
ref|XP_010035929.1|  PREDICTED: aspartic proteinase nepenthesin-2...  71.6    3e-11   
ref|XP_006357686.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.6    4e-11   
ref|XP_011469449.1|  PREDICTED: aspartic proteinase CDR1-like iso...  71.2    4e-11   
ref|XP_004308645.2|  PREDICTED: aspartic proteinase CDR1-like iso...  71.2    4e-11   
ref|XP_004144695.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  71.6    4e-11   
emb|CDX79609.1|  BnaC03g19450D                                        71.2    4e-11   
ref|XP_007147550.1|  hypothetical protein PHAVU_006G134200g           71.2    4e-11   
gb|KFK44926.1|  hypothetical protein AALP_AA1G320800                  70.9    4e-11   
ref|XP_010688898.1|  PREDICTED: aspartic proteinase nepenthesin-1     71.2    5e-11   
emb|CDX67775.1|  BnaA07g18150D                                        71.2    5e-11   
ref|XP_009759829.1|  PREDICTED: aspartic proteinase nepenthesin-2...  70.9    6e-11   
ref|XP_010087862.1|  Aspartic proteinase nepenthesin-1                70.9    6e-11   
ref|XP_009622711.1|  PREDICTED: aspartic proteinase nepenthesin-2...  70.9    6e-11   
gb|KDP37099.1|  hypothetical protein JCGZ_06155                       70.5    7e-11   
ref|XP_010516575.1|  PREDICTED: aspartic proteinase nepenthesin-2...  70.9    7e-11   
dbj|BAJ53226.1|  JHL06P13.6                                           70.5    7e-11   
ref|XP_002876487.1|  hypothetical protein ARALYDRAFT_486375           70.9    7e-11   
ref|XP_007146226.1|  hypothetical protein PHAVU_006G022800g           70.9    7e-11   
ref|XP_003553140.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.9    7e-11   
ref|XP_006415326.1|  hypothetical protein EUTSA_v10009809mg           70.1    8e-11   
gb|EYU29201.1|  hypothetical protein MIMGU_mgv1a005225mg              70.5    8e-11   
ref|XP_003573011.1|  PREDICTED: aspartic proteinase nepenthesin-2...  70.5    8e-11   
ref|XP_002524401.1|  basic 7S globulin 2 precursor small subunit,...  70.1    9e-11   
gb|EYU42788.1|  hypothetical protein MIMGU_mgv1a008084mg              69.7    9e-11   
ref|XP_006373545.1|  hypothetical protein POPTR_0016s00260g           70.1    9e-11   
ref|XP_003578209.1|  PREDICTED: aspartic proteinase nepenthesin-1...  69.7    1e-10   
ref|XP_006402723.1|  hypothetical protein EUTSA_v10005882mg           70.1    1e-10   
ref|XP_010516577.1|  PREDICTED: aspartic proteinase nepenthesin-1...  70.1    1e-10   
gb|KHN18625.1|  Aspartic proteinase nepenthesin-2                     70.1    1e-10   
ref|XP_010512139.1|  PREDICTED: aspartic proteinase nepenthesin-2...  70.1    1e-10   
ref|XP_004170576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.1    1e-10   
ref|XP_010512140.1|  PREDICTED: aspartic proteinase nepenthesin-1...  70.1    1e-10   
ref|XP_004138237.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    1e-10   
ref|XP_010512138.1|  PREDICTED: aspartic proteinase nepenthesin-1...  69.7    1e-10   
gb|EYU25643.1|  hypothetical protein MIMGU_mgv1a027134mg              69.3    1e-10   
ref|XP_006660750.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    1e-10   
ref|XP_003627786.1|  Aspartic proteinase nepenthesin-1                69.3    1e-10   
gb|KGN63809.1|  hypothetical protein Csa_1G022480                     69.7    1e-10   
ref|XP_008442220.1|  PREDICTED: aspartic proteinase nepenthesin-1     69.3    1e-10   
ref|XP_009391801.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
ref|XP_010908060.1|  PREDICTED: aspartic proteinase nepenthesin-1...  69.7    2e-10   
ref|XP_002985015.1|  hypothetical protein SELMODRAFT_121417           69.7    2e-10   
gb|KGN54937.1|  hypothetical protein Csa_4G608130                     69.7    2e-10   
gb|EEE64882.1|  hypothetical protein OsJ_19741                        69.3    2e-10   
ref|XP_008465452.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    2e-10   
ref|XP_002986201.1|  hypothetical protein SELMODRAFT_234982           68.9    2e-10   



>ref|XP_004248083.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=458

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 138/179 (77%), Gaps = 17/179 (9%)
 Frame = +1

Query  76   IFA---SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAA  246
            IFA   SL YQTL+L PLP  Q  SLS +PQ S       D+ NTLS+ LHH+DL+S ++
Sbjct  14   IFAAAHSLQYQTLTLNPLPQLQ--SLSWEPQLSS------DNENTLSVQLHHVDLLSPSS  65

Query  247  VNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRL  426
             NATP ALF  RLQRDA RAK+LSLL+A     N+T G+DFSSSVISGL+QGSGEYFTR+
Sbjct  66   FNATPHALFKLRLQRDAIRAKSLSLLSA-----NST-GKDFSSSVISGLSQGSGEYFTRI  119

Query  427  GVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            G+GTP KY ++VLDTGSD+ W+QC PC KCY+Q+DPVFDPS SSSF  V CDSPLCRRL
Sbjct  120  GIGTPVKYVYLVLDTGSDIVWIQCLPCSKCYSQSDPVFDPSKSSSFSTVTCDSPLCRRL  178



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 129/181 (71%), Gaps = 10/181 (6%)
 Frame = +1

Query  85   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPK  264
            SL YQTL L  LP  Q  SL    Q         D  NTLSL LHH+DL+S ++ NATP 
Sbjct  24   SLQYQTLLLHSLPLTQLQSLDFDAQLLSGDGSDLDPDNTLSLQLHHVDLVSPSSFNATPH  83

Query  265  ALFVKRLQRDAARAKTLSLLAAA--------APPHNATRGRDFSSSVISGLAQGSGEYFT  420
            ALF  RLQRDA RAK +S LAAA          PH    GRDFSSSV+SGL+QGSGEYFT
Sbjct  84   ALFKLRLQRDAYRAKAISDLAAANATVGRRAGKPHAG--GRDFSSSVVSGLSQGSGEYFT  141

Query  421  RLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRR  600
            R+GVGTPPKY +MVLDTGSDV W+QCSPC+KCY Q+DPVFDPS SSSF+GV C SPLCRR
Sbjct  142  RIGVGTPPKYVYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPSKSSSFLGVACGSPLCRR  201

Query  601  L  603
            L
Sbjct  202  L  202



>ref|XP_009800816.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=474

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 132/172 (77%), Gaps = 6/172 (3%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLIS--SAAVNATPKA  267
            YQTL+LR LP  Q  SLS   Q S    QP +S NTL++ LHH+DLI+  ++  N TP A
Sbjct  28   YQTLTLRSLPEPQ--SLSWATQDSNDF-QPLNSENTLAVQLHHVDLITPYTSLSNTTPHA  84

Query  268  LFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  447
            LF  RLQRDA RAK LS LA A    NAT  +DFSSSVISGLAQGSGEYFTR+G+GTPPK
Sbjct  85   LFKLRLQRDAVRAKLLSNLAEAVANANATV-KDFSSSVISGLAQGSGEYFTRIGIGTPPK  143

Query  448  YAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            YA+MVLDTGSDV W+QC PCR+CY Q+DPVFDP+ SSSF G+ CDSPLCRRL
Sbjct  144  YAYMVLDTGSDVVWIQCLPCRQCYNQSDPVFDPTKSSSFTGLSCDSPLCRRL  195



>ref|XP_009613969.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=510

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 131/181 (72%), Gaps = 11/181 (6%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSGNTLSLDLHHIDLISSAAVNATP  261
            YQTL L  LP ++  SLS   +  +  +  D    D   TLS+ LHH+DL+S ++ NATP
Sbjct  52   YQTLVLNSLPNSEPQSLSWATEDFEAQLSGDGSNPDPDTTLSVQLHHVDLVSPSSFNATP  111

Query  262  KALFVKRLQRDAARAKTLSLLAAA-------APPHNATRGRDFSSSVISGLAQGSGEYFT  420
             ALF  RLQRDAARAK LS LAAA          H+    RDFSSSV SGLAQGSGEYFT
Sbjct  112  HALFKLRLQRDAARAKALSDLAAANITVGRRGGGHHVVGSRDFSSSVTSGLAQGSGEYFT  171

Query  421  RLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRR  600
            RLGVGTPPKYA+MVLDTGSDV W+QCSPC+KCY Q+DPVFDP+ S+SF+GV C SPLCRR
Sbjct  172  RLGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPTKSTSFLGVSCGSPLCRR  231

Query  601  L  603
            L
Sbjct  232  L  232



>ref|XP_009600181.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 133/172 (77%), Gaps = 6/172 (3%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLIS--SAAVNATPKA  267
            YQTL+LR LP  Q  S +++  Y     QP +S NTL++ LHH+DLI+  ++  N TP A
Sbjct  28   YQTLTLRSLPEPQSLSWATQDSYD---FQPLNSQNTLAVQLHHVDLITPYTSLFNTTPHA  84

Query  268  LFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  447
            LF  RLQRDA RA+ LS LA AA   NAT  +DFSSSVISGLAQGSGEYFTR+G+GTPPK
Sbjct  85   LFKLRLQRDAVRAELLSKLAEAAANANATV-KDFSSSVISGLAQGSGEYFTRIGIGTPPK  143

Query  448  YAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            YA++VLDTGSDV W+QC PCR+CY Q+DPVFDPS SSSF G+ CDSPLCRRL
Sbjct  144  YAYLVLDTGSDVVWIQCLPCRQCYNQSDPVFDPSKSSSFTGLSCDSPLCRRL  195



>ref|XP_009775618.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=491

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 131/181 (72%), Gaps = 11/181 (6%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSGNTLSLDLHHIDLISSAAVNATP  261
            YQTL L  LP +Q  SLS   +  +  +  D    D   TLS+ LHH+DL+S ++ NATP
Sbjct  33   YQTLVLNSLPNSQPQSLSWATEDFEAQLSGDGSNPDPDYTLSVQLHHVDLVSPSSFNATP  92

Query  262  KALFVKRLQRDAARAKTLSLLAAA-------APPHNATRGRDFSSSVISGLAQGSGEYFT  420
              LF  RLQRDAARAK LS LAAA          H+   GRDFSSSV SGLAQGSGEYFT
Sbjct  93   HTLFKLRLQRDAARAKALSDLAAANITVGRRGGGHHVVGGRDFSSSVTSGLAQGSGEYFT  152

Query  421  RLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRR  600
            RLGVGTPPKYA+MVLDTGSDV W+QCSPC+KCY Q+DPVFDP+ SSSF+GV C SPLCRR
Sbjct  153  RLGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPTKSSSFLGVSCGSPLCRR  212

Query  601  L  603
            L
Sbjct  213  L  213



>ref|XP_011093028.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=476

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 132/177 (75%), Gaps = 6/177 (3%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            A L YQT  L  LP  Q  S  ++ Q S+T VQP  S  TLSLDLHH+D +S    N+TP
Sbjct  24   APLQYQTFLLTSLPNPQSLSWPTQ-QDSETQVQPH-SHTTLSLDLHHVDNLS-PDFNSTP  80

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGV  432
            ++LF  RL+RDA R K LS ++A +  + + + R   DFSSSVISGLAQGSGEYFTR+G+
Sbjct  81   QSLFKLRLRRDAIRVKALSTISAVSQTNVSGQPRAAGDFSSSVISGLAQGSGEYFTRIGI  140

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GTPPKY +MVLDTGSDV W+QCSPCRKCY+QTDPVFDP  S+SF+GV C SPLCRRL
Sbjct  141  GTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQTDPVFDPKASTSFLGVSCGSPLCRRL  197



>gb|EYU40714.1| hypothetical protein MIMGU_mgv1a019320mg [Erythranthe guttata]
Length=469

 Score =   181 bits (460),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 133/176 (76%), Gaps = 11/176 (6%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLS-SKPQYSQTLVQPDDSGNTLSLDLHHID-LISSAAVNATP  261
            L YQTL L  LP  Q  SLS    Q S + ++P+ S  TLSLDLHH+D L  SAA ++TP
Sbjct  22   LHYQTLVLTSLPNPQSQSLSWPTQQQSDSQIRPE-SDTTLSLDLHHLDNLPPSAAFSSTP  80

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNATRGR--DFSSSVISGLAQGSGEYFTRLGVG  435
            ++LF  RL+RDA R + LS LA      N + GR  DFSSS++SGLAQGSGEYFTR+G+G
Sbjct  81   QSLFKLRLRRDAVRVRALSTLA------NVSGGRPGDFSSSIVSGLAQGSGEYFTRIGIG  134

Query  436  TPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            TPPKY +MVLDTGSDV W+QCSPCRKCY+Q+DPVFDP  S+SF+G+ CDSP+CRRL
Sbjct  135  TPPKYVYMVLDTGSDVVWVQCSPCRKCYSQSDPVFDPKSSTSFLGLTCDSPVCRRL  190



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 128/185 (69%), Gaps = 17/185 (9%)
 Frame = +1

Query  85   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSGNTLSLDLHHIDLISSAAVN  252
            SL Y TL L  LP  Q   L     +   L+  D    D  N LSL LHH+DL+S ++ N
Sbjct  43   SLQYHTLLLHSLPLTQ---LQKSLHFDAQLLSGDGSDLDPDNALSLQLHHVDLVSPSSFN  99

Query  253  ATPKALFVKRLQRDAARAKTLSLLAAA--------APPHNATRGRDFSSSVISGLAQGSG  408
            ATP ALF  RLQRDA RAK +S LA+A          PH    GRDFSSSV+SGL+QGSG
Sbjct  100  ATPHALFKLRLQRDAYRAKAISDLASANATVGRRAGKPHPG--GRDFSSSVVSGLSQGSG  157

Query  409  EYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSP  588
            EYFTR+GVGTP KY +MVLDTGSDV W+QCSPC+KCY Q+DPVFDPS SSSF+GV C SP
Sbjct  158  EYFTRIGVGTPSKYVYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPSKSSSFLGVACGSP  217

Query  589  LCRRL  603
            LCRRL
Sbjct  218  LCRRL  222



>ref|XP_006362137.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=461

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 136/173 (79%), Gaps = 11/173 (6%)
 Frame = +1

Query  85   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPK  264
            SL YQTL+L  LP  Q  SLS +PQ S       D+ NTLS+ LHH+DL+S ++ NATP 
Sbjct  20   SLQYQTLTLNSLPQLQ--SLSWEPQLSS------DNENTLSVQLHHVDLLSPSSFNATPH  71

Query  265  ALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  444
            ALF  RLQRDA RAK+LSLL+A+A   N+T G+DFSSSVISGL+QGSGEYFTR+G+GTP 
Sbjct  72   ALFKLRLQRDAIRAKSLSLLSASA--ANST-GKDFSSSVISGLSQGSGEYFTRIGIGTPT  128

Query  445  KYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            KY ++VLDTGSD+ W+QC PC KCY+Q+DPVFDPS SSSF  V CDSPLCRRL
Sbjct  129  KYVYLVLDTGSDIVWIQCLPCAKCYSQSDPVFDPSKSSSFSPVTCDSPLCRRL  181



>ref|XP_011093892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Sesamum 
indicum]
Length=478

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 126/177 (71%), Gaps = 8/177 (5%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            A L YQTL L PLPT Q  S    P   ++ + P  S NT SL+LHH+D +S  A N+TP
Sbjct  28   APLQYQTLVLTPLPTPQTLSW---PSQQESELGPL-SENTFSLNLHHVDSLS-PAFNSTP  82

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRD---FSSSVISGLAQGSGEYFTRLGV  432
            ++LF  RL RD  R K LS LAAA   + + R R    FSSSV SGLAQGSGEYFTRLGV
Sbjct  83   ESLFKLRLHRDGVRVKALSTLAAATQTNVSARARGAPGFSSSVTSGLAQGSGEYFTRLGV  142

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GTP KY +MVLDTGSDV W+QCSPCR+CY Q+DPVFDP  S+SF+GV C SPLCRRL
Sbjct  143  GTPAKYVYMVLDTGSDVVWVQCSPCRRCYTQSDPVFDPRKSTSFLGVSCGSPLCRRL  199



>gb|EYU38885.1| hypothetical protein MIMGU_mgv1a026932mg [Erythranthe guttata]
Length=471

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 133/178 (75%), Gaps = 13/178 (7%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLS-SKPQYSQTLVQPDDSGNTLSLDLHHIDLI---SSAAVNA  255
            L YQTL L  LP  Q  SLS    Q S + ++P+ S  TLSLDLHH+D +   +SAA ++
Sbjct  22   LHYQTLVLTSLPNPQSQSLSWPTQQQSDSQIRPE-SDTTLSLDLHHVDNLPPSASAAFSS  80

Query  256  TPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGR--DFSSSVISGLAQGSGEYFTRLG  429
            TP++LF  RL+RDA R + LS +A      N + GR  DFSSS++SGLAQGSGEYFTR+G
Sbjct  81   TPQSLFKLRLRRDAVRVRALSTIA------NVSVGRPGDFSSSIVSGLAQGSGEYFTRIG  134

Query  430  VGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +GTPPKY +MVLDTGSDV W+QCSPCRKCY+Q+DPVFDP  S+SF+G+ C SP+CRRL
Sbjct  135  IGTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQSDPVFDPKSSTSFLGLTCHSPVCRRL  192



>gb|KDP28482.1| hypothetical protein JCGZ_14253 [Jatropha curcas]
Length=478

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 122/175 (70%), Gaps = 7/175 (4%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSL---SSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNAT  258
            LDYQTL L PLP     S     S+ +  QTL    DS  T SL LHHID +S+   N T
Sbjct  28   LDYQTLVLNPLPRQTALSWPAADSEAETLQTLTDTADS-TTFSLQLHHIDALSN---NKT  83

Query  259  PKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  438
            P+ LF +RLQRDA R + LS +AA+A       G  FSSSVISGLAQGSGEYFTR+GVGT
Sbjct  84   PQDLFGERLQRDAFRVEALSSVAASAVGAGGRVGTGFSSSVISGLAQGSGEYFTRIGVGT  143

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            PP+Y +MVLDTGSD+ W+QC+PC KCY+Q+DPVFDP  S SF G+ C SPLC RL
Sbjct  144  PPRYVYMVLDTGSDIVWIQCAPCNKCYSQSDPVFDPRKSRSFAGIPCGSPLCNRL  198



>ref|XP_007217966.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
 gb|EMJ19165.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
Length=468

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 126/179 (70%), Gaps = 19/179 (11%)
 Frame = +1

Query  85   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPK  264
            +L++QTL L PLP     S      + +++  P    NTLS+ LHH+D +S   +N TP 
Sbjct  24   ALEHQTLVLNPLPNPPTLS------WPESVTDP----NTLSVQLHHLDALS---LNKTPS  70

Query  265  ALFVKRLQRDAARAKTLS-LLAAAAPPHNATRG-----RDFSSSVISGLAQGSGEYFTRL  426
             LF  RLQRDA R KTLS + AAAA P+   RG     R FSSSV+SGLAQGSGEYFTRL
Sbjct  71   QLFNLRLQRDAVRVKTLSSIAAAAASPNRTARGGRVPIRGFSSSVVSGLAQGSGEYFTRL  130

Query  427  GVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GVGTPPKY +MVLDTGSDV WLQC+PC++CY+QTDPVFDP  S +F  + C SPLCR+L
Sbjct  131  GVGTPPKYVYMVLDTGSDVVWLQCAPCKRCYSQTDPVFDPRKSGTFSTIPCGSPLCRKL  189



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 126/184 (68%), Gaps = 13/184 (7%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTL----VQPDDSGNTLSLDLHHIDLISSAAV  249
            ASL YQT  L  LPT    S       S++     +   D+ ++LSL LHH+D +S    
Sbjct  21   ASLQYQTFVLNSLPTQSTLSWPESVSVSESESSLPLPAPDAESSLSLRLHHVDSLS---F  77

Query  250  NATPKALFVKRLQRDAARAKTLSLLAAAA---PPHNATRGR---DFSSSVISGLAQGSGE  411
            N TP+ LF  R+QRD  R K+L+  A +A   PP N +RGR    FSSSVISGLAQGSGE
Sbjct  78   NRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSRGRANGGFSSSVISGLAQGSGE  137

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YFTRLGVGTPP+Y +MVLDTGSDV W+QC+PC+KCY+QTDPVFDP+ S SF  V C SPL
Sbjct  138  YFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQTDPVFDPAKSRSFATVPCRSPL  197

Query  592  CRRL  603
            CR+L
Sbjct  198  CRKL  201



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 126/184 (68%), Gaps = 13/184 (7%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTL----VQPDDSGNTLSLDLHHIDLISSAAV  249
            ASL YQT  L  LPT    S       S++     +   D+ ++LSL LHH+D +S    
Sbjct  21   ASLQYQTFVLNSLPTPSTLSWPESVSVSESESSLPLPAPDAESSLSLRLHHVDSLS---F  77

Query  250  NATPKALFVKRLQRDAARAKTLSLLAAAA---PPHNATRGR---DFSSSVISGLAQGSGE  411
            N TP+ LF  R+QRD  R K+L+  A +A   PP N +RGR    FSSSVISGLAQGSGE
Sbjct  78   NRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSRGRANGGFSSSVISGLAQGSGE  137

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YFTRLGVGTPP+Y +MVLDTGSDV W+QC+PC+KCY+QTDPVFDP+ S SF  V C SPL
Sbjct  138  YFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQTDPVFDPAKSRSFATVPCRSPL  197

Query  592  CRRL  603
            CR+L
Sbjct  198  CRKL  201



>gb|EYU32252.1| hypothetical protein MIMGU_mgv1a005685mg [Erythranthe guttata]
Length=474

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 125/176 (71%), Gaps = 4/176 (2%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            A L YQT  L  LP  Q  S  S+ Q SQ +  P +S    SL+LHH+D +S +++ +TP
Sbjct  22   APLQYQTFVLTSLPQPQTISWVSQ-QESQVIETPSESETDFSLNLHHVDSLSPSSI-STP  79

Query  262  KALFVKRLQRDAARAKTLSLLAAAA--PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVG  435
            ++LF  RL+RD  R + LS LAA+A  P + + +   FSSSVISGLA GSGEYFTRLGVG
Sbjct  80   ESLFQLRLRRDGVRVEALSTLAASAAAPTNVSGKPHGFSSSVISGLAHGSGEYFTRLGVG  139

Query  436  TPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            TP KY +MVLDTGSDV W+QCSPCRKCY Q+DPVFDP  S +F GV C SPLCRRL
Sbjct  140  TPAKYVYMVLDTGSDVVWIQCSPCRKCYTQSDPVFDPKKSKTFSGVACGSPLCRRL  195



>ref|XP_011038277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=505

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 120/178 (67%), Gaps = 11/178 (6%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLV-----QPDDSGNT-LSLDLHHIDLISSAAVNA  255
            +QTL+L PLP     S +     +QT       +P  S  T LS+ LHHID +SS     
Sbjct  51   FQTLTLNPLPNKPTISWADTEPGTQTFTDPTISEPSSSATTSLSVQLHHIDALSSGK---  107

Query  256  TPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRD--FSSSVISGLAQGSGEYFTRLG  429
            + + LF  RL RDAAR K+L  LAA     N TR R   FSSSVISGLAQGSGEYFTRLG
Sbjct  108  SSQDLFNSRLARDAARVKSLISLAATVGGTNLTRARGPGFSSSVISGLAQGSGEYFTRLG  167

Query  430  VGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            VGTP +Y +MVLDTGSD+ W+QC+PC+KCY+QTDPVFDP+ S SF  + C SPLCRRL
Sbjct  168  VGTPARYVYMVLDTGSDIVWIQCAPCKKCYSQTDPVFDPTKSRSFASIPCGSPLCRRL  225



>ref|XP_008351846.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 109/142 (77%), Gaps = 10/142 (7%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRG-----  360
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R KTL+ LAAA+P +  TRG     
Sbjct  70   NTLSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAASP-NRTTRGGGXVP  125

Query  361  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpv  537
             R FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDV WLQC+PCR+CY Q+DP+
Sbjct  126  VRGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQSDPI  185

Query  538  fdpsxsssfvGVKCDSPLCRRL  603
            FDP  S SF  + C SPLCR+L
Sbjct  186  FDPRKSRSFATIPCGSPLCRKL  207



>ref|XP_008343434.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 109/142 (77%), Gaps = 10/142 (7%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRG-----  360
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R KTL+ LAAA+P +  TRG     
Sbjct  70   NTLSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAASP-NRTTRGGGRVP  125

Query  361  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpv  537
             R FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDV WLQC+PCR+CY Q+DP+
Sbjct  126  VRGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQSDPI  185

Query  538  fdpsxsssfvGVKCDSPLCRRL  603
            FDP  S SF  + C SPLCR+L
Sbjct  186  FDPRKSRSFATIPCGSPLCRKL  207



>ref|XP_011023172.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=492

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 124/182 (68%), Gaps = 15/182 (8%)
 Frame = +1

Query  94   YQTLSLRPLPT------AQHYSLSSKPQYSQTLVQPD----DSGNTLSLDLHHIDLISSA  243
            +QTL++ PLP       A   + +     +QTL         +  +LS+ LHH+D +SS 
Sbjct  34   FQTLTVNPLPNKPTLSWADTETETESEPEAQTLTDSTFSEASTTTSLSVQLHHLDALSS-  92

Query  244  AVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRD--FSSSVISGLAQGSGEYF  417
              + TP+ LF  RL RDA+R K+L+ LAAA    N TR R   FSSSVISGLAQGSGEYF
Sbjct  93   --DKTPQDLFNSRLARDASRVKSLTSLAAATGRTNRTRARGPGFSSSVISGLAQGSGEYF  150

Query  418  TRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCR  597
            TRLGVGTP +Y FMVLDTGSD+ W+QC+PC+KCY+QTDPVF+P+ S SF  + C SPLCR
Sbjct  151  TRLGVGTPARYVFMVLDTGSDIVWIQCAPCKKCYSQTDPVFNPTKSRSFANIPCGSPLCR  210

Query  598  RL  603
            RL
Sbjct  211  RL  212



>ref|XP_002523337.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF39053.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=469

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 118/173 (68%), Gaps = 8/173 (5%)
 Frame = +1

Query  85   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPK  264
            SL+YQTL   PL +    S +     S++     +S  T S+ LHH+D +S    N+TP+
Sbjct  25   SLNYQTLVANPLRSQPTLSWTD----SESPTDTAESSATFSVQLHHVDALS---FNSTPE  77

Query  265  ALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  444
             LF  RLQRDAAR + +S LA  A       G  FSSSVISGLAQGSGEYFTR+GVGTPP
Sbjct  78   TLFTTRLQRDAARVEAISYLAETAGTGKRV-GTGFSSSVISGLAQGSGEYFTRIGVGTPP  136

Query  445  KYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +Y +MVLDTGSD+ W+QC+PC++CYAQ+DPVFDP  S SF  + C SPLC RL
Sbjct  137  RYVYMVLDTGSDIVWIQCAPCKRCYAQSDPVFDPRKSRSFASIACRSPLCHRL  189



>emb|CDP08669.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 125/179 (70%), Gaps = 8/179 (4%)
 Frame = +1

Query  88   LDYQTLSLRPLPT-AQHYSLSSKPQYSQTLVQPDDSG-----NTLSLDLHHIDLISSAAV  249
            LD QT     LP   Q  S +S  +    L Q   +G     N  SL+LHH+D +S  + 
Sbjct  31   LDCQTFIPNSLPKPTQSPSWTSDGEPQTILSQETAAGTEFQSNNFSLELHHVDALS-LSP  89

Query  250  NATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGR-DFSSSVISGLAQGSGEYFTRL  426
            +A+P++LF  RLQRDA RAK++S +A+         GR +FSSSVISGL+QGSGEYFTRL
Sbjct  90   HASPESLFNLRLQRDAFRAKSISDMASGRGRQGVGLGRMNFSSSVISGLSQGSGEYFTRL  149

Query  427  GVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            G+GTPPKY++MVLDTGSDV W+QCSPC+KCY Q DP+FDPS SSSF GV C SPLCRRL
Sbjct  150  GIGTPPKYSYMVLDTGSDVVWIQCSPCKKCYTQADPLFDPSHSSSFAGVACASPLCRRL  208



>ref|XP_004494825.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=473

 Score =   162 bits (411),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 119/167 (71%), Gaps = 8/167 (5%)
 Frame = +1

Query  103  LSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKR  282
            LS+  LP A   +L S P+  + L  P+     LSL LHH+D +S+   N TP+ LF  R
Sbjct  35   LSINSLPNAP--TLPS-PESEELLSIPESDPQPLSLQLHHVDALSN---NKTPQQLFHLR  88

Query  283  LQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  462
            LQRDAAR ++ +L AA    H +  G  FSSS++SGL+QGSGEYFTR+GVGTP KY FMV
Sbjct  89   LQRDAARVESFTLAAALNQSHRS--GSGFSSSIVSGLSQGSGEYFTRIGVGTPAKYVFMV  146

Query  463  LDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            LDTGSDV WLQC+PCRKCY+Q DP+FDP+ S +F G+ C +PLCRRL
Sbjct  147  LDTGSDVVWLQCAPCRKCYSQQDPIFDPTKSRTFAGIPCGAPLCRRL  193



>ref|XP_002320868.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE99183.1| aspartyl protease family protein [Populus trichocarpa]
Length=488

 Score =   163 bits (412),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 120/178 (67%), Gaps = 11/178 (6%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLV-----QPDDSGNT-LSLDLHHIDLISSAAVNA  255
            +QTL+L PLP     S +     +QT       +P  S  T LS+ LHHID +SS   + 
Sbjct  34   FQTLTLNPLPNKPTISWADTEPGTQTFTDQTTSEPSSSATTFLSVQLHHIDALSS---DK  90

Query  256  TPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRD--FSSSVISGLAQGSGEYFTRLG  429
            + + LF  RL RDAAR K+L  LAA     N TR R   FSSSVISGLAQGSGEYFTRLG
Sbjct  91   SSQDLFNSRLVRDAARVKSLISLAATVGGTNLTRARGPGFSSSVISGLAQGSGEYFTRLG  150

Query  430  VGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            VGTP +Y +MVLDTGSD+ W+QC+PC KCY+QTDPVFDP+ S SF  + C SPLCRRL
Sbjct  151  VGTPARYVYMVLDTGSDIVWIQCAPCIKCYSQTDPVFDPTKSRSFANIPCGSPLCRRL  208



>ref|XP_010266550.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=484

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 106/139 (76%), Gaps = 8/139 (6%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPP---HNATR--GRD  366
            L+  L H D +   A N TP+ALF  RL+RDAAR ++LS +AA APP    NATR  G  
Sbjct  68   LTARLEHRDAL---AFNVTPEALFHLRLERDAARVESLSTMAAGAPPVTSRNATRSRGNG  124

Query  367  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdp  546
            FSSSVISGL+QGSGEYFTR+GVGTPP+Y +MVLDTGSD+ W+QC+PCRKCY Q DP+FDP
Sbjct  125  FSSSVISGLSQGSGEYFTRIGVGTPPRYVYMVLDTGSDIVWIQCAPCRKCYTQADPMFDP  184

Query  547  sxsssfvGVKCDSPLCRRL  603
              S SF GV C SPLCRRL
Sbjct  185  KKSRSFAGVSCGSPLCRRL  203



>ref|XP_008461984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=517

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 118/174 (68%), Gaps = 18/174 (10%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            A+ ++QTL+LR LPT    SL    +  Q+          L+LDLHH+D   S ++N TP
Sbjct  82   AASEFQTLTLRSLPTPSPLSLFPDSESLQS-----SPAAALTLDLHHLD---SLSLNKTP  133

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTP  441
              LF  RL RDA R   L+  + AAP         FSSSVISGLAQGSGEYFTRLGVGTP
Sbjct  134  TDLFNLRLHRDALRVHALT--SRAAP--------GFSSSVISGLAQGSGEYFTRLGVGTP  183

Query  442  PKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P+Y +MVLDTGSDV WLQCSPCRKCY+Q+DP+F+P  S SF G+ C SPLCRRL
Sbjct  184  PRYLYMVLDTGSDVVWLQCSPCRKCYSQSDPIFNPYKSKSFAGIPCSSPLCRRL  237



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 122/177 (69%), Gaps = 10/177 (6%)
 Frame = +1

Query  94   YQTL--SLRPLPTAQHYSL--SSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            YQTL  +   LP+A   S    S+P     +    DS ++++L+L HID +S+   N TP
Sbjct  28   YQTLVPTSHSLPSASPISFQPESEPVSESLIGSGSDSESSITLNLDHIDALST---NRTP  84

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGV  432
            + LF  RLQRD+ R K+++ LAA  P  N T   R   FSSSV+SGL+QGSGEYFTRLGV
Sbjct  85   EELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSSSVVSGLSQGSGEYFTRLGV  144

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+FDP  S ++  + C SPLCRRL
Sbjct  145  GTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYSTIPCSSPLCRRL  201



>ref|XP_002302634.2| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE81907.2| aspartyl protease family protein [Populus trichocarpa]
Length=490

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 125/181 (69%), Gaps = 15/181 (8%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLS-----SKPQYSQTLVQPDDSGNTLS----LDLHHIDLISSAA  246
            +QTL++ PLP     S +     S+P+ +QTL     +  + +    + LHH+D +SS  
Sbjct  34   FQTLTVNPLPNKPTLSWADTGPESEPE-TQTLTDSTSTEASTTTSLSVQLHHLDALSS--  90

Query  247  VNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRD--FSSSVISGLAQGSGEYFT  420
             + TP+ LF  RL RDA+R K+L+ LAAA    N TR R   FSSSV SGLAQGSGEYFT
Sbjct  91   -DETPQDLFNSRLARDASRVKSLTSLAAAVGSTNRTRARGPGFSSSVTSGLAQGSGEYFT  149

Query  421  RLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRR  600
            RLGVGTP +Y FMVLDTGSDV W+QC+PC+KCY+QTDPVF+P+ S SF  + C SPLCRR
Sbjct  150  RLGVGTPARYVFMVLDTGSDVVWIQCAPCKKCYSQTDPVFNPTKSRSFANIPCGSPLCRR  209

Query  601  L  603
            L
Sbjct  210  L  210



>ref|XP_010053832.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW78191.1| hypothetical protein EUGRSUZ_D02381 [Eucalyptus grandis]
Length=485

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 128/179 (72%), Gaps = 13/179 (7%)
 Frame = +1

Query  97   QTLSLRPLPT-----AQHYSLSSKPQYSQTLVQPDDSGNT-LSLDLHHIDLISSAAVNAT  258
            Q L LRPLP+     +   S ++    S+T  + D +  T LS++L H+D +S    N T
Sbjct  31   QPLVLRPLPSRPAPASWPESEAAASLSSETEAESDSAATTSLSVELQHVDALS---FNLT  87

Query  259  PKALFVKRLQRDAARAKTLSLLAAAAPPH---NATRGR-DFSSSVISGLAQGSGEYFTRL  426
            P+ALF  RLQRDA+R +++S LA AA      N +R R  FSSSV+SGLAQGSGEYFTRL
Sbjct  88   PQALFHLRLQRDASRVQSISDLAVAAAAAPAGNVSRPRLGFSSSVVSGLAQGSGEYFTRL  147

Query  427  GVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GVGTPP+Y +MVLDTGSDV W+QC+PCRKCY+QTDPVFDPS S+SF  + C SPLCRRL
Sbjct  148  GVGTPPRYVYMVLDTGSDVVWIQCAPCRKCYSQTDPVFDPSKSTSFAAIPCSSPLCRRL  206



>ref|XP_006418409.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
 gb|ESQ36762.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
Length=486

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 129/190 (68%), Gaps = 16/190 (8%)
 Frame = +1

Query  73   PIFASL-DYQTL--SLRPLPTAQHYSL--SSKPQYSQTLVQPD-----DSGNTLSLDLHH  222
            P F+SL  +QTL  S   LP+A   S    S+P     L   +     DS ++++L+L H
Sbjct  20   PTFSSLPTFQTLIPSSHSLPSASPTSFQPESEPDSESLLGGSESEYGSDSESSITLNLDH  79

Query  223  IDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNAT---RGRDFSSSVISGL  393
            ID +S+   N TP+ LF  RLQRD+ R ++++ LAA  P  NAT   R   FSSSV+SGL
Sbjct  80   IDALST---NRTPQELFSFRLQRDSRRVESIATLAARIPRRNATHAPRTVGFSSSVVSGL  136

Query  394  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGV  573
            +QGSGEYFTRLGVGTP +Y +MVLDTGSD+ WLQC+PCRKCY+Q+DP+FDP  S ++  +
Sbjct  137  SQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRKCYSQSDPIFDPRKSRTYSTI  196

Query  574  KCDSPLCRRL  603
             C SPLCRRL
Sbjct  197  PCSSPLCRRL  206



>ref|XP_009336767.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=485

 Score =   158 bits (400),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 106/140 (76%), Gaps = 11/140 (8%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRG------R  363
            LS+ LHHID +   A+N TP  LF  RLQRDA R KTL+ LAA+  P+  TRG      R
Sbjct  72   LSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAS--PNRTTRGGGRVPVR  126

Query  364  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfd  543
             FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDV WLQC+PCR+CY Q+DP+FD
Sbjct  127  GFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQSDPIFD  186

Query  544  psxsssfvGVKCDSPLCRRL  603
            P  S SF  + C SPLCR+L
Sbjct  187  PRKSRSFATIPCGSPLCRKL  206



>gb|EPS66029.1| hypothetical protein M569_08742 [Genlisea aurea]
Length=464

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 120/175 (69%), Gaps = 9/175 (5%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            A+L +QT S   LP    +     P+ S+  +Q D S    SL L H+D +  +  +A+P
Sbjct  17   AALPFQTFSPTSLPRPLAF-----PE-SEEALQEDYS--PASLGLFHVDDVYYSGADASP  68

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNAT-RGRDFSSSVISGLAQGSGEYFTRLGVGT  438
            + LF  RL+RDA R + LS     A   N + R RDFSSSV SGL+QGSGEYFTR+G+GT
Sbjct  69   ELLFQFRLRRDAIRVRDLSAAVVEAAARNVSGRARDFSSSVTSGLSQGSGEYFTRIGIGT  128

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            PP+Y +MVLDTGSDV W+QCSPC KCY+QTDPVFDP  S+SF+GV C SPLCRRL
Sbjct  129  PPRYVYMVLDTGSDVVWIQCSPCTKCYSQTDPVFDPRASTSFLGVSCASPLCRRL  183



>ref|XP_002892074.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68333.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 131/190 (69%), Gaps = 17/190 (9%)
 Frame = +1

Query  73   PIFASL-DYQTL--SLRPLPTAQHYSL--SSKPQYSQTLVQPD-----DSGNTLSLDLHH  222
            P F+SL  +QTL  +   LP+A   S    S+P  S++L+  +     DS ++++L+L H
Sbjct  20   PCFSSLPSFQTLIPNSHSLPSASPISFQPESEPD-SESLLGSEFESGSDSESSITLNLDH  78

Query  223  IDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNAT---RGRDFSSSVISGL  393
            ID +SS   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R   FSSSV+SGL
Sbjct  79   IDALSS---NKTPQELFSSRLQRDSRRVKSIATLAAQIPGRNVTHAPRTGGFSSSVVSGL  135

Query  394  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGV  573
            +QGSGEYFTRLGVGTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+FDP  S ++  +
Sbjct  136  SQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSKTYATI  195

Query  574  KCDSPLCRRL  603
             C SP CRRL
Sbjct  196  PCSSPHCRRL  205



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 116/174 (67%), Gaps = 19/174 (11%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            A+ ++QTL+LR LPT     L    Q  Q+   PD     L+LDLHH+D   S ++N TP
Sbjct  19   AASEFQTLTLRSLPTPSPLPLFPDSQSLQS--SPD---APLTLDLHHLD---SLSLNKTP  70

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTP  441
              LF  RL RD  R   L+           +R   FSSSV+SGL+QGSGEYFTRLGVGTP
Sbjct  71   TDLFNLRLHRDTLRVHALN-----------SRAAGFSSSVVSGLSQGSGEYFTRLGVGTP  119

Query  442  PKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P+Y +MVLDTGSDV WLQCSPCRKCY+Q+DP+F+P  S SF G+ C SPLCRRL
Sbjct  120  PRYLYMVLDTGSDVVWLQCSPCRKCYSQSDPIFNPYKSKSFAGIPCSSPLCRRL  173



>ref|XP_010095748.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62168.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=491

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 118/196 (60%), Gaps = 38/196 (19%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGN--------------------TLS  207
            L+Y+TL L  LP  Q           QTL  PD                        ++S
Sbjct  31   LEYETLLLTSLPIPQ-----------QTLSWPDSESELTGSDLESETAAAEETETSLSIS  79

Query  208  LDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRD----FSS  375
              LHHID +S+   + +P+ LF  RLQRDA R K L  + AAA   N +R R     FSS
Sbjct  80   AQLHHIDALSA---DKSPEQLFDLRLQRDALRVKNLVEVTAAAASRNVSRTRGAAPGFSS  136

Query  376  SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxs  555
            SVISGLAQGSGEYFTRLGVGTPP+Y +MVLDTGSDV WLQC+PCRKCY Q DPVFDPS S
Sbjct  137  SVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRKCYTQADPVFDPSKS  196

Query  556  ssfvGVKCDSPLCRRL  603
             SF  + C SPLCR+L
Sbjct  197  RSFARISCGSPLCRKL  212



>emb|CBI40559.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 127/183 (69%), Gaps = 16/183 (9%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQ-----PDDSGNTLSLDLHHIDLISSAAVN  252
            L+YQ+L +RPL   ++ +  S+  +++T  Q       ++  T+++ L H D++   A N
Sbjct  60   LEYQSLVVRPL--GENPTTKSQLSWTETETQISTLPVSETDPTMTMHLEHRDVL---AFN  114

Query  253  ATPKALFVKRLQRDAARAKTLSLLAAAAPPH----NAT--RGRDFSSSVISGLAQGSGEY  414
            ATP+ALF  RLQRDA R + LS +AAAA       N T  +G  FSSSV SGLAQGSGEY
Sbjct  115  ATPEALFNLRLQRDAFRVEALSKMAAAAGGRRAGRNGTHAQGGGFSSSVTSGLAQGSGEY  174

Query  415  FTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLC  594
            FTRLGVGTPPKY +MVLDTGSDV W+QC+PCRKCY+QTDPVFDP  S SF  + C SPLC
Sbjct  175  FTRLGVGTPPKYVYMVLDTGSDVVWIQCAPCRKCYSQTDPVFDPKKSGSFSSISCRSPLC  234

Query  595  RRL  603
             RL
Sbjct  235  LRL  237



>gb|KEH24641.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=485

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 114/167 (68%), Gaps = 7/167 (4%)
 Frame = +1

Query  109  LRPLPTAQHYSLSSKPQYSQTLVQPDD--SGNTLSLDLHHIDLISSAAVNATPKALFVKR  282
            +R LP     +     Q S ++ +  D     +LSL LHHID +SS   + TP+ LF  R
Sbjct  44   IRSLPNPSTLTWPESEQESLSIPESVDPIEQESLSLQLHHIDTLSS---DKTPQQLFHLR  100

Query  283  LQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  462
            LQRDAAR ++ +       PH +  G  FSSS++SGL+QGSGEYFTR+GVGTP +Y FMV
Sbjct  101  LQRDAARVESFATALNKTRPHRSATG--FSSSIVSGLSQGSGEYFTRIGVGTPARYVFMV  158

Query  463  LDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            LDTGSDV WLQC+PCRKCY+Q DPVFDP+ S S+ G+ C +PLCRRL
Sbjct  159  LDTGSDVVWLQCAPCRKCYSQADPVFDPTKSRSYAGIPCGAPLCRRL  205



>gb|KJB49569.1| hypothetical protein B456_008G125700 [Gossypium raimondii]
Length=488

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 122/180 (68%), Gaps = 14/180 (8%)
 Frame = +1

Query  97   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPDD----SGNT---LSLDLHHIDLISSAAVNA  255
             +L LRPLP+A   S         +LV+  D    + NT   L L+LHH+D +SS     
Sbjct  33   HSLLLRPLPSAPVLSWQDSDLPFNSLVETSDLDTVNSNTSLGLQLELHHLDALSS---EE  89

Query  256  TPKALFVKRLQRDAARAKTLSLLA--AAAPPHNATRGR--DFSSSVISGLAQGSGEYFTR  423
            TP+ LF  RLQRDA RA+T++ L   A A  H    GR   FSSSVISGLAQGSGEYFTR
Sbjct  90   TPERLFDLRLQRDALRAETINSLVSKAVARKHPRAPGRRPGFSSSVISGLAQGSGEYFTR  149

Query  424  LGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            LGVGTPP+Y +MVLDTGSDV W+QCSPC+KCY+Q+DP+FDP+ S SF G+ C S LCR L
Sbjct  150  LGVGTPPRYLYMVLDTGSDVIWVQCSPCKKCYSQSDPIFDPTKSRSFSGIPCGSQLCRSL  209



>ref|XP_002263964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
 emb|CAN64659.1| hypothetical protein VITISV_009613 [Vitis vinifera]
Length=489

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 127/183 (69%), Gaps = 16/183 (9%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQ-----PDDSGNTLSLDLHHIDLISSAAVN  252
            L+YQ+L +RPL   ++ +  S+  +++T  Q       ++  T+++ L H D++   A N
Sbjct  33   LEYQSLVVRPL--GENPTTKSQLSWTETETQISTLPVSETDPTMTMHLEHRDVL---AFN  87

Query  253  ATPKALFVKRLQRDAARAKTLSLLAAAAPPH----NAT--RGRDFSSSVISGLAQGSGEY  414
            ATP+ALF  RLQRDA R + LS +AAAA       N T  +G  FSSSV SGLAQGSGEY
Sbjct  88   ATPEALFNLRLQRDAFRVEALSKMAAAAGGRRAGRNGTHAQGGGFSSSVTSGLAQGSGEY  147

Query  415  FTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLC  594
            FTRLGVGTPPKY +MVLDTGSDV W+QC+PCRKCY+QTDPVFDP  S SF  + C SPLC
Sbjct  148  FTRLGVGTPPKYVYMVLDTGSDVVWIQCAPCRKCYSQTDPVFDPKKSGSFSSISCRSPLC  207

Query  595  RRL  603
             RL
Sbjct  208  LRL  210



>ref|XP_010474721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=484

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSV  381
            ++L+L HID +SS   N TP+ LF  RLQRD+ R ++++ LAA  P  N T    FSSSV
Sbjct  74   ITLNLDHIDALSS---NKTPQELFSSRLQRDSKRVQSIATLAARVPRRNVTHAPGFSSSV  130

Query  382  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsss  561
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+FDP  S +
Sbjct  131  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRT  190

Query  562  fvGVKCDSPLCRRL  603
            +  + C SP CRRL
Sbjct  191  YSTIPCSSPHCRRL  204



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 122/177 (69%), Gaps = 10/177 (6%)
 Frame = +1

Query  94   YQTL--SLRPLPTAQHYSL--SSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            YQTL  +   LP+A   S    S+P     +    DS ++++L+L HID +S+   N TP
Sbjct  28   YQTLVPTSHSLPSASPTSFQPESEPVSESLIGSGSDSDSSITLNLDHIDALST---NRTP  84

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGV  432
            + LF  RLQRD+ R K+++ LAA  P  N T   R   FSSSV+SGL+QGSGEYFTRLGV
Sbjct  85   EELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSSSVVSGLSQGSGEYFTRLGV  144

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+FDP  S ++  + C SPLCRRL
Sbjct  145  GTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYSTIPCSSPLCRRL  201



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 122/177 (69%), Gaps = 10/177 (6%)
 Frame = +1

Query  94   YQTL--SLRPLPTAQHYSL--SSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            YQTL  +   LP+A   S    S+P     +    DS ++++L+L HID +S+   N TP
Sbjct  28   YQTLVPTSHSLPSASPTSFQPESEPVSESLIGSGSDSDSSITLNLDHIDALST---NRTP  84

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGV  432
            + LF  RLQRD+ R K+++ LAA  P  N T   R   FSSSV+SGL+QGSGEYFTRLGV
Sbjct  85   EELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSSSVVSGLSQGSGEYFTRLGV  144

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+FDP  S ++  + C SPLCRRL
Sbjct  145  GTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYSTIPCSSPLCRRL  201



>gb|AGV54495.1| aspartic proteinase nepenthesin-1-like protein [Phaseolus vulgaris]
Length=476

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 118/172 (69%), Gaps = 6/172 (3%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKA  267
            L  QTL LR LP     S    P+ +      +   +T+S+++HHID +S   +N TP  
Sbjct  32   LKSQTLILRNLPNPPTLSW---PESTTLGSDSEPDPDTISVNVHHIDALS---LNKTPSQ  85

Query  268  LFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  447
            LF  RLQRDAAR K+LS LAA       T G  FSSSVISGLAQGSGEYFTRLGVGTPPK
Sbjct  86   LFHFRLQRDAARVKSLSSLAALNQTRPTTSGSGFSSSVISGLAQGSGEYFTRLGVGTPPK  145

Query  448  YAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            Y +MVLDTGSDV WLQC PC KCY+QTD +FDPS SSSF G+ C SPLCR L
Sbjct  146  YVYMVLDTGSDVVWLQCKPCAKCYSQTDEIFDPSKSSSFAGISCSSPLCRSL  197



>ref|XP_007135265.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
 gb|ESW07259.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
Length=477

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 118/172 (69%), Gaps = 6/172 (3%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKA  267
            L  QTL LR LP     S    P+ +      +   +T+S+++HHID +S   +N TP  
Sbjct  32   LKSQTLILRNLPNPPTLSW---PESTTLGSDSEPDPDTISVNVHHIDALS---LNKTPSQ  85

Query  268  LFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  447
            LF  RLQRDAAR K+LS LAA       T G  FSSSVISGLAQGSGEYFTRLGVGTPPK
Sbjct  86   LFHFRLQRDAARVKSLSSLAALNQTRPTTSGSGFSSSVISGLAQGSGEYFTRLGVGTPPK  145

Query  448  YAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            Y +MVLDTGSDV WLQC PC KCY+QTD +FDPS SSSF G+ C SPLCR L
Sbjct  146  YVYMVLDTGSDVVWLQCKPCAKCYSQTDEIFDPSKSSSFAGISCSSPLCRSL  197



>gb|AGV54447.1| aspartic proteinase nepenthesin-1 precursor [Phaseolus vulgaris]
Length=477

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 117/172 (68%), Gaps = 6/172 (3%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKA  267
            L  QTL LR LP     S    P+ +      +   +T+S+++HHID +S   +N TP  
Sbjct  32   LKSQTLILRNLPNPPTLSW---PESTTLGSDSEPDPDTISVNVHHIDALS---LNKTPSQ  85

Query  268  LFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  447
            LF  RLQRDAAR K+LS LAA       T G  FSSSVISGLAQGSGEYFTRLGVGTPPK
Sbjct  86   LFHFRLQRDAARVKSLSSLAALNQTRPTTSGSGFSSSVISGLAQGSGEYFTRLGVGTPPK  145

Query  448  YAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            Y +MVLDTGSDV WLQC PC KCY+QTD +FDPS S SF G+ C SPLCRR 
Sbjct  146  YVYMVLDTGSDVVWLQCKPCAKCYSQTDEIFDPSKSKSFAGIPCYSPLCRRF  197



>ref|NP_171637.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAF97328.1|AC023628_9 Unknown protein [Arabidopsis thaliana]
 gb|AAM91547.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP31963.1| At1g01300 [Arabidopsis thaliana]
 gb|AEE27268.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=485

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 102/137 (74%), Gaps = 6/137 (4%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNAT---RGRDFS  372
            ++L+L HID +SS   N TP  LF  RLQRD+ R K+++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPDELFSSRLQRDSRRVKSIATLAAQIPGRNVTHAPRPGGFS  128

Query  373  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsx  552
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+FDP  
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRK  188

Query  553  sssfvGVKCDSPLCRRL  603
            S ++  + C SP CRRL
Sbjct  189  SKTYATIPCSSPHCRRL  205



>ref|XP_007147317.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
 gb|ESW19311.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
Length=534

 Score =   150 bits (378),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 118/168 (70%), Gaps = 8/168 (5%)
 Frame = +1

Query  100  TLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVK  279
            TLSL  LP   H    S PQ ++ L +PD     LSL+LHHID +SS   N TP+ LF  
Sbjct  96   TLSLHSLP---HSPTLSWPQ-AEALAEPDPE-EALSLNLHHIDALSS---NKTPEQLFHL  147

Query  280  RLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  459
            RLQRD  R ++L  LAA    H    G  FSSS+ISGLAQGSGEYFTR+GVGTP KY +M
Sbjct  148  RLQRDGKRVQSLLTLAALNSSHARRSGSGFSSSIISGLAQGSGEYFTRIGVGTPAKYVYM  207

Query  460  VLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            VLDTGSDV WLQC+PCRKCY QTDPVFDP+ S ++ G+ C +PLCRRL
Sbjct  208  VLDTGSDVVWLQCAPCRKCYTQTDPVFDPTKSRTYAGIPCGAPLCRRL  255



>gb|AAM66061.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
Length=485

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 103/137 (75%), Gaps = 6/137 (4%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNAT---RGRDFS  372
            ++L+L HID +SS   N TP+ LF  RLQRD+ R ++++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVRSIATLAAQIPGRNVTHAPRPGGFS  128

Query  373  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsx  552
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+FDP  
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRK  188

Query  553  sssfvGVKCDSPLCRRL  603
            S ++  + C SP CRRL
Sbjct  189  SKTYATIPCSSPHCRRL  205



>ref|XP_008376086.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=487

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 107/143 (75%), Gaps = 10/143 (7%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAA-PPHNATRG----  360
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAAAA  P+  TRG    
Sbjct  69   NTLSVQLHHIDAM---ALNKTPTQLFHLRLQRDAFRVKALTTLAAAAASPNRTTRGGGHV  125

Query  361  --RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdp  534
                FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDV WLQC+PC++CY QTDP
Sbjct  126  PVTGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCKRCYTQTDP  185

Query  535  vfdpsxsssfvGVKCDSPLCRRL  603
            +FDP  S SF  + C SPLCR+L
Sbjct  186  IFDPRKSGSFATIPCGSPLCRKL  208



>ref|XP_010457141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=485

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 102/137 (74%), Gaps = 6/137 (4%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNAT---RGRDFS  372
            ++L+L HID +SS   N TP+ LF  RLQRD+ R  +++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVNSIATLAARVPRRNVTHAPRPGGFS  128

Query  373  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsx  552
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+FDP  
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRK  188

Query  553  sssfvGVKCDSPLCRRL  603
            S ++  + C SP CRRL
Sbjct  189  SRTYSTIPCSSPHCRRL  205



>gb|KFK42512.1| hypothetical protein AALP_AA1G003500 [Arabis alpina]
Length=477

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 104/134 (78%), Gaps = 3/134 (2%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSV  381
            ++L+L HID +++   N TP+ LF  RLQRD+ R K+++ LA+     +A R   FSSSV
Sbjct  67   ITLNLDHIDALTT---NRTPQELFTSRLQRDSKRVKSIATLASQRNTTHAPRTGTFSSSV  123

Query  382  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsss  561
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+ WLQC+PC++CY+Q+DP++DP  S++
Sbjct  124  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCKRCYSQSDPIYDPRKSTT  183

Query  562  fvGVKCDSPLCRRL  603
            +  + C SPLC+RL
Sbjct  184  YSTISCSSPLCKRL  197



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 114/172 (66%), Gaps = 6/172 (3%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+QTL LR LP++  +     P  S + +   ++  T      H+  + + + N TP+ L
Sbjct  29   DFQTLILRSLPSSPSF----LPSDSNSFLS-SEATETELGLELHLHHLDALSFNRTPEEL  83

Query  271  FVKRLQRDAARAKTLSLLAAAAPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPK  447
            F  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+GVGTPPK
Sbjct  84   FHLRLQRDAIRVKKLSSLGATSRNLSRPSGTTGFSSSVISGLAQGSGEYFTRIGVGTPPK  143

Query  448  YAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            Y +MVLDTGSD+ WLQC+PC+ CY+QTDPVF+P  S SF  V C +PLCRRL
Sbjct  144  YVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFAKVLCRTPLCRRL  195



>emb|CDX89133.1| BnaA04g00530D [Brassica napus]
Length=483

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 116/175 (66%), Gaps = 10/175 (6%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            Y TL +  LP++    + S P+ S++L     S  +LSL L H+D ISS + +A+P  LF
Sbjct  29   YNTLVVNTLPSSP---ILSSPE-SESLTTVSQSTTSLSLHLSHVDAISSFS-DASPAELF  83

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  438
              RL+RD+ R ++L+ LAA +   N TR        FS +VISGL+QGSGEYF RLGVGT
Sbjct  84   NLRLKRDSLRVESLTTLAAVSSRRNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  143

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P K  +MVLDTGSDV WLQC+PC+ CY Q+D +FDPS S +F  V C S LCRRL
Sbjct  144  PAKNMYMVLDTGSDVVWLQCAPCKVCYNQSDAIFDPSKSKTFAAVPCGSRLCRRL  198



>ref|XP_002878415.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54674.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 113/175 (65%), Gaps = 8/175 (5%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            YQTL +  LP++   S      +S   V   +S  +LS+ L H+D +SS + +A+P  LF
Sbjct  30   YQTLVVNTLPSSATLSWPESKSFSDESVS--ESTTSLSVHLSHVDALSSFS-DASPVDLF  86

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  438
              RLQRD+ R K+++ LAA +   NAT+        FS +VISGL+QGSGEYF RLGVGT
Sbjct  87   KLRLQRDSLRVKSITSLAAVSTGRNATKRTPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  146

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P    +MVLDTGSDV WLQCSPC+ CY Q+D +FDP  S +F  V C S LCRRL
Sbjct  147  PATNVYMVLDTGSDVVWLQCSPCKACYNQSDVIFDPKKSKTFATVPCGSRLCRRL  201



>ref|XP_010469025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=486

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 114/175 (65%), Gaps = 7/175 (4%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            YQTL +  LP+A   S       +    QP+ + ++LS+ L H+D + S + +A+P ALF
Sbjct  29   YQTLVVNTLPSASTLSWPDSESLTGE-SQPESTTSSLSVHLSHVDALYSFS-DASPTALF  86

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  438
              RLQRD+ R +++S LAA +   N TR        FS +VISGL+QGSGEYF RLGVGT
Sbjct  87   NLRLQRDSLRVESISSLAAVSTGRNVTRRTPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  146

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P    +MVLDTGSDV WLQCSPC+ CY Q+DP+FDP  S ++  V C S LCRRL
Sbjct  147  PATNVYMVLDTGSDVVWLQCSPCKACYNQSDPIFDPKRSKTYATVPCGSRLCRRL  201



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 97/130 (75%), Gaps = 3/130 (2%)
 Frame = +1

Query  214  LHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGL  393
            LHHID +S+   N TP+ LF  RL RD+ R ++++ L       +A     FSSSVISGL
Sbjct  61   LHHIDALSA---NKTPEQLFHLRLHRDSRRVESIAALTRRGNASHAPSAAGFSSSVISGL  117

Query  394  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGV  573
            +QGSGEYFTR+GVGTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+F P+ S ++ G+
Sbjct  118  SQGSGEYFTRIGVGTPARYLYMVLDTGSDIVWLQCAPCRRCYSQSDPIFVPAKSKTYAGI  177

Query  574  KCDSPLCRRL  603
             C SPLCRRL
Sbjct  178  SCSSPLCRRL  187



>ref|XP_004306664.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=467

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 120/174 (69%), Gaps = 13/174 (7%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+QTL L PLP+A   SLS    +S+T  +PD   ++LSL LHH+D +SS   + TP  L
Sbjct  24   DHQTLLLSPLPSAP--SLSQPESFSETTSEPDSDPSSLSLPLHHLDALSS---DQTPSQL  78

Query  271  FVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVIS---GLAQGSGEYFTRLGVGTP  441
            F  RL+RD+ R  +L+ LA     +N TR    S    S   GL+QGSGEYFTR+GVG+P
Sbjct  79   FHLRLRRDSLRFNSLTSLA-----YNRTRPGPSSGFSSSIVSGLSQGSGEYFTRIGVGSP  133

Query  442  PKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            PKY +MVLDTGSDV WLQC+PC++CY+QTD VFDP  SSS+  + C SPLCRRL
Sbjct  134  PKYLYMVLDTGSDVVWLQCAPCKRCYSQTDLVFDPRKSSSYSSLPCSSPLCRRL  187



>ref|XP_003529886.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 108/147 (73%), Gaps = 11/147 (7%)
 Frame = +1

Query  175  VQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNAT  354
            V+PD    T SL LHHID +S    N TP  LF  RL+RDAAR KTL+ LAAA    N T
Sbjct  54   VEPDPEPTT-SLSLHHIDALS---FNKTPSQLFHLRLERDAARVKTLTHLAAAT---NKT  106

Query  355  RGRD----FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYA  522
            R  +    FSSSV+SGL+QGSGEYFTRLGVGTPPKY +MVLDTGSDV WLQC PC KCY+
Sbjct  107  RPANPGSGFSSSVVSGLSQGSGEYFTRLGVGTPPKYLYMVLDTGSDVVWLQCKPCTKCYS  166

Query  523  QTdpvfdpsxsssfvGVKCDSPLCRRL  603
            QTD +FDPS S SF G+ C SPLCRRL
Sbjct  167  QTDQIFDPSKSKSFAGIPCYSPLCRRL  193



>emb|CDY43952.1| BnaC04g21580D [Brassica napus]
Length=483

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 115/175 (66%), Gaps = 10/175 (6%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            Y TL +   P++    + S P+ S++L  P  S  +LSL L HID ISS + +A+P  LF
Sbjct  29   YNTLVVNTFPSSP---ILSSPE-SESLTTPSQSTTSLSLHLSHIDAISSFS-DASPAELF  83

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  438
              RL+RD+ R ++L+ LAA +   N TR        FS +VISGL+QGSGEYF RLGVGT
Sbjct  84   DLRLKRDSIRVESLTSLAAVSSRRNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  143

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P    +MVLDTGSDV WLQC+PC+ CY Q+D +FDPS S +F  V C S LCRRL
Sbjct  144  PATNMYMVLDTGSDVVWLQCAPCKVCYNQSDAIFDPSKSKTFATVPCGSRLCRRL  198



>ref|XP_009138753.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=483

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 115/175 (66%), Gaps = 10/175 (6%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            Y TL +  LP++    + S P+ S++L     S  +LSL L H+D ISS A +A+P  LF
Sbjct  29   YNTLVVNTLPSSP---ILSSPE-SESLTTVSQSTTSLSLHLSHVDAISSFA-DASPAELF  83

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  438
              RL+RD+ R ++L+ LAA +   N TR        FS +VISGL+QGSGEYF RLGVGT
Sbjct  84   NLRLKRDSLRVESLTTLAAVSSRRNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  143

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P    +MVLDTGSDV WLQC+PC+ CY Q+D +FDPS S +F  V C S LCRRL
Sbjct  144  PATNMYMVLDTGSDVVWLQCAPCKVCYNQSDAIFDPSKSKTFAAVPCGSRLCRRL  198



>gb|KFK35370.1| hypothetical protein AALP_AA5G276300 [Arabis alpina]
Length=485

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 116/177 (66%), Gaps = 11/177 (6%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            YQTL +  LP++   S    P  S++  + + +  +LS+ L HID +SS + ++TP  LF
Sbjct  28   YQTLIVNTLPSSPTLSW---PDQSESEFKSESTTTSLSVHLSHIDALSSFS-DSTPSELF  83

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATRGR-------DFSSSVISGLAQGSGEYFTRLGV  432
              RL+RD+ R  +++ LAA +   N TR +        FS +VISGL+QGSGEYF RLGV
Sbjct  84   NLRLRRDSLRVNSITKLAAVSTGRNITRKKRTPKSSGGFSGAVISGLSQGSGEYFMRLGV  143

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GTP   A+MVLDTGSDV WLQCSPC+ CY Q+DP+FDP  S S+  V C S LCRRL
Sbjct  144  GTPATNAYMVLDTGSDVVWLQCSPCKVCYNQSDPIFDPKKSKSYATVACGSRLCRRL  200



>ref|XP_006307379.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
 gb|EOA40277.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
Length=481

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 97/134 (72%), Gaps = 6/134 (4%)
 Frame = +1

Query  211  DLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNAT---RGRDFSSSV  381
            +L HID +SS   N TP  LF  RL RD+ R K++  LAA  P  N T   R   FSSSV
Sbjct  71   NLDHIDALSS---NKTPDELFSSRLLRDSRRVKSIVTLAARVPRRNVTHAPRPGGFSSSV  127

Query  382  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsss  561
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+FDP  S +
Sbjct  128  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRT  187

Query  562  fvGVKCDSPLCRRL  603
            +  + C SP CRRL
Sbjct  188  YSTIPCSSPQCRRL  201



>ref|XP_010665756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 119/178 (67%), Gaps = 14/178 (8%)
 Frame = +1

Query  100  TLSLRPLPTAQHYSLSSKPQYSQTLVQPDDS---GNTLSLDLHHIDLISSAAVNATPKAL  270
            TL+  P P++ H       Q +QTL + + S    +T +L L H+D +SS   + TP+ L
Sbjct  31   TLNSLPKPSSLHPD-QQWVQTTQTLEELELSTSIDSTFTLHLEHLDALSS---HLTPEEL  86

Query  271  FVKRLQRDAARAKTL------SLLAAAAPPHNATRG-RDFSSSVISGLAQGSGEYFTRLG  429
            F  RL+RD ARAKT+      S  +A     NA+   RDFSSS++SGL+QGSGEYFTRLG
Sbjct  87   FSFRLKRDDARAKTIFARAHSSSRSAHKHGRNASHSTRDFSSSIVSGLSQGSGEYFTRLG  146

Query  430  VGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            VGTPPKY +MVLDTGSD+ W+QC+PC+KCY QTD +F+P  S S+  + C S +C+RL
Sbjct  147  VGTPPKYMYMVLDTGSDIVWIQCTPCKKCYDQTDRMFNPVKSGSYRSIPCRSKICQRL  204



>ref|XP_007051537.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95694.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=488

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 119/180 (66%), Gaps = 14/180 (8%)
 Frame = +1

Query  97   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPDD-----SGNTLS--LDLHHIDLISSAAVNA  255
            QTL  R LP+    S       S +LV+  D     S  TL   L+LHH+D  SS  +  
Sbjct  33   QTLVPRTLPSPSTLSGQDSELESDSLVETSDLDTVNSNTTLEVQLELHHVDAFSSEEI--  90

Query  256  TPKALFVKRLQRDAARAKTLSLLAAAA----PPHNATRGRDFSSSVISGLAQGSGEYFTR  423
             P+ LF  RLQRD  RA+T++ L A A    PP    R   FSSS+ISGLAQGSGEYFTR
Sbjct  91   -PERLFDLRLQRDELRAETINSLVAKAVARNPPRAPGRRSGFSSSIISGLAQGSGEYFTR  149

Query  424  LGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            LGVGTPP+Y +MVLDTGSDV W+QCSPC+KCY+Q+DP+FDP+ S SF G+ C SPLCR L
Sbjct  150  LGVGTPPRYLYMVLDTGSDVVWVQCSPCKKCYSQSDPIFDPTKSRSFSGIPCGSPLCRSL  209



>ref|XP_010413342.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=488

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 114/175 (65%), Gaps = 7/175 (4%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            YQTL +  LP+A   S       +    QP+ + ++LS+ L H+D + S + +A+P  LF
Sbjct  31   YQTLVVNTLPSAATLSWPDSESLAGE-SQPESTTSSLSVHLSHVDALFSFS-DASPTDLF  88

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  438
              RLQRD+ R +++S LAA +   NATR        FS +VISGL+QGSGEYF RLGVGT
Sbjct  89   NLRLQRDSLRVESISSLAAVSTGRNATRRTPRSAGGFSGAVISGLSQGSGEYFMRLGVGT  148

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P    +MVLDTGSDV WLQCSPC+ CY Q+DP+FDP  S ++  V C S LCRRL
Sbjct  149  PATNVYMVLDTGSDVVWLQCSPCKACYNQSDPIFDPKRSKTYATVPCGSRLCRRL  203



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 115/172 (67%), Gaps = 6/172 (3%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+QTL L  LP++  +  S    +  +  +   S   L L LHH+D +S    N TP+ L
Sbjct  26   DFQTLPLTSLPSSPSFLPSDSNSFLSS--EATQSELGLELHLHHLDALS---FNRTPEEL  80

Query  271  FVKRLQRDAARAKTLSLLAAAAPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPK  447
            F  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+GVGTPPK
Sbjct  81   FHLRLQRDAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFTRIGVGTPPK  140

Query  448  YAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            Y +MVLDTGSD+ WLQC+PC+ CY+QTDPVF+P  S SF  V C +PLCRRL
Sbjct  141  YVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFAKVLCRTPLCRRL  192



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 115/172 (67%), Gaps = 6/172 (3%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+QTL L  LP++  +  S    +  +  +   S   L L LHH+D +S    N TP+ L
Sbjct  67   DFQTLPLTSLPSSPSFLPSDSNSFLSS--EATQSELGLELHLHHLDALS---FNRTPEEL  121

Query  271  FVKRLQRDAARAKTLSLLAAAAPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPK  447
            F  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+GVGTPPK
Sbjct  122  FHLRLQRDAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFTRIGVGTPPK  181

Query  448  YAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            Y +MVLDTGSD+ WLQC+PC+ CY+QTDPVF+P  S SF  V C +PLCRRL
Sbjct  182  YVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFAKVLCRTPLCRRL  233



>ref|XP_007051536.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX95693.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=557

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 119/180 (66%), Gaps = 14/180 (8%)
 Frame = +1

Query  97   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPDD-----SGNTLS--LDLHHIDLISSAAVNA  255
            QTL  R LP+    S       S +LV+  D     S  TL   L+LHH+D  SS  +  
Sbjct  33   QTLVPRTLPSPSTLSGQDSELESDSLVETSDLDTVNSNTTLEVQLELHHVDAFSSEEI--  90

Query  256  TPKALFVKRLQRDAARAKTLSLLAAAA----PPHNATRGRDFSSSVISGLAQGSGEYFTR  423
             P+ LF  RLQRD  RA+T++ L A A    PP    R   FSSS+ISGLAQGSGEYFTR
Sbjct  91   -PERLFDLRLQRDELRAETINSLVAKAVARNPPRAPGRRSGFSSSIISGLAQGSGEYFTR  149

Query  424  LGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            LGVGTPP+Y +MVLDTGSDV W+QCSPC+KCY+Q+DP+FDP+ S SF G+ C SPLCR L
Sbjct  150  LGVGTPPRYLYMVLDTGSDVVWVQCSPCKKCYSQSDPIFDPTKSRSFSGIPCGSPLCRSL  209



>emb|CDY25081.1| BnaC06g18230D [Brassica napus]
Length=485

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 116/175 (66%), Gaps = 9/175 (5%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            Y TL +  LP++Q +S       + T+    DS  +L++ L H+D +SS + +A+P  LF
Sbjct  29   YNTLIVNTLPSSQIFSSPEPGSLTSTVF---DSITSLTVHLSHVDALSSFS-DASPLELF  84

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATRGR-----DFSSSVISGLAQGSGEYFTRLGVGT  438
              RL+RD+ R K+L+ LAA +   N T+        FS +VISGL+QGSGEYF RLGVGT
Sbjct  85   NLRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGT  144

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P    +MVLDTGSDV WLQCSPC+ CY Q+DP+F+P+ S++F  V C S LCRRL
Sbjct  145  PATNVYMVLDTGSDVVWLQCSPCKVCYNQSDPMFNPAKSTTFATVPCGSSLCRRL  199



>ref|XP_010512555.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   141 bits (355),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 115/179 (64%), Gaps = 7/179 (4%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            +S  YQTL +  LP+    S       +    QP+ + ++LS+ L H+D +SS + +A+P
Sbjct  22   SSSQYQTLVVNTLPSPATLSWPDSESLTGE-SQPESTTSSLSVHLSHVDALSSLS-DASP  79

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNATR-----GRDFSSSVISGLAQGSGEYFTRL  426
              LF  RLQRD+ R ++++ LAA +   N TR        FS +VISGL+QGSGEYF RL
Sbjct  80   TDLFNLRLQRDSLRVESIASLAAVSTGRNVTRKTPRSAGGFSGAVISGLSQGSGEYFMRL  139

Query  427  GVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GVGTP    +MVLDTGSDV WLQCSPC+ CY Q+DP+FDP  S ++  V C S LCRRL
Sbjct  140  GVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQSDPIFDPKRSKTYATVPCGSRLCRRL  198



>gb|AAK64003.1| AT3g61820/F15G16_210 [Arabidopsis thaliana]
Length=362

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 116/179 (65%), Gaps = 8/179 (4%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            AS  YQTL +  LP++   +LS     S T     +S  +LS+ L H+D +SS + +A+P
Sbjct  23   ASSQYQTLVVNTLPSSA--TLSWPESESLTDESLSESTTSLSVHLSHVDALSSFS-DASP  79

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNATR-----GRDFSSSVISGLAQGSGEYFTRL  426
              LF  RLQRD+ R K+++ LAA +   NAT+        FS +VISGL+QGSGEYF RL
Sbjct  80   ADLFNLRLQRDSLRVKSITSLAAVSTGRNATKRTPRTAGGFSGAVISGLSQGSGEYFMRL  139

Query  427  GVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GVGTP    +MVLDTGSDV WLQCSPC+ CY QTD +FDP  S +F  V C S LCRRL
Sbjct  140  GVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQTDAIFDPKKSKTFATVPCGSRLCRRL  198



>ref|XP_009394177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 115/193 (60%), Gaps = 33/193 (17%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLS------------------LD  213
            L YQTL + PL        SSKP  S+     DD    L+                  + 
Sbjct  30   LAYQTLVVTPLA-------SSKPLLSE---DADDGDENLASAVESETTLSSSPSSSLHVH  79

Query  214  LHHIDLISSAAVNATPKALFVKRLQRDAARAKTLS--LLAAAAPPH-NATRGRDFSSSVI  384
            L H D  S  A     + +F+ RL RDAAR +TLS  L  A APP  N T  R FSS V+
Sbjct  80   LSHRD--SLLADTTAAEQIFLLRLDRDAARVETLSQILAVATAPPAANVTSRRGFSSKVV  137

Query  385  SGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssf  564
            SGLAQGSGEYF R+G+GTP +YA+MVLDTGSDV WLQC+PCR+CY+Q+DP+FDP  S S+
Sbjct  138  SGLAQGSGEYFARIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYSQSDPIFDPRSSRSY  197

Query  565  vGVKCDSPLCRRL  603
              + C +PLCRRL
Sbjct  198  AAIPCGAPLCRRL  210



>ref|NP_191741.1| aspartyl protease [Arabidopsis thaliana]
 emb|CAB71112.1| putative protein [Arabidopsis thaliana]
 gb|AEE80260.1| aspartyl protease [Arabidopsis thaliana]
Length=483

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 116/179 (65%), Gaps = 8/179 (4%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            AS  YQTL +  LP++   +LS     S T     +S  +LS+ L H+D +SS + +A+P
Sbjct  23   ASSQYQTLVVNTLPSSA--TLSWPESESLTDESLSESTTSLSVHLSHVDALSSFS-DASP  79

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNATR-----GRDFSSSVISGLAQGSGEYFTRL  426
              LF  RLQRD+ R K+++ LAA +   NAT+        FS +VISGL+QGSGEYF RL
Sbjct  80   ADLFNLRLQRDSLRVKSITSLAAVSTGRNATKRTPRTAGGFSGAVISGLSQGSGEYFMRL  139

Query  427  GVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GVGTP    +MVLDTGSDV WLQCSPC+ CY QTD +FDP  S +F  V C S LCRRL
Sbjct  140  GVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQTDAIFDPKKSKTFATVPCGSRLCRRL  198



>ref|XP_003554768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=472

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 100/134 (75%), Gaps = 3/134 (2%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSV  381
            LSL LHHID +SS   N TP+ LF  RLQRDA R + +  LAA    H    G  FSSS+
Sbjct  62   LSLHLHHIDALSS---NKTPEQLFQLRLQRDAKRVEGVVALAALNQSHARRSGSSFSSSI  118

Query  382  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsss  561
            ISGLAQGSGEYFTR+GVGTP +Y +MVLDTGSDV WLQC+PCRKCY Q DPVFDP+ S +
Sbjct  119  ISGLAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCYTQADPVFDPTKSRT  178

Query  562  fvGVKCDSPLCRRL  603
            + G+ C +PLCRRL
Sbjct  179  YAGIPCGAPLCRRL  192



>ref|XP_008799615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=504

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 120/188 (64%), Gaps = 20/188 (11%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHY----SLSSKPQYSQTLVQPDDSG---------NTLSLDLHHID  228
            ++YQTL + PL +         L +    +QTL   D++G         ++L + + H D
Sbjct  29   IEYQTLVVTPLRSPPALLPDDDLLTWTTDTQTLA--DETGISAGAAAASSSLRVRIAHRD  86

Query  229  LISSAAVNATPKALFVKRLQRDAARAKTL-SLLAAAAPPHNATRG--RDFSSSVISGLAQ  399
              S  A N+TP+ L   RL RDA R   L  +L A     +A R   R FSSSV+SGLAQ
Sbjct  87   --SLFAANSTPEHLLGLRLGRDATRVSHLHEILGAEGNATHAVRAGRRGFSSSVVSGLAQ  144

Query  400  GSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKC  579
            GSGEYFTR+G+GTP +YA+MVLDTGSDV WLQC+PCR+CY+QTDP+FDP  S S+  + C
Sbjct  145  GSGEYFTRIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYSQTDPIFDPRRSRSYATIPC  204

Query  580  DSPLCRRL  603
            D+PLCRRL
Sbjct  205  DAPLCRRL  212



>emb|CDX67868.1| BnaA07g19080D [Brassica napus]
Length=485

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 9/175 (5%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            Y TL +  LP++Q +S    P+         DS  +L++ L H+D +SS + +A+P  LF
Sbjct  29   YNTLVVNTLPSSQIFS---SPEPESLTSTVSDSTTSLTVHLSHVDALSSFS-DASPLELF  84

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATRGR-----DFSSSVISGLAQGSGEYFTRLGVGT  438
              RL+RD+ R K+L+ LAA +   N T+        FS +VISGL+QGSGEYF RLGVGT
Sbjct  85   NLRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGT  144

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P    +MVLDTGSDV WLQCSPC+ CY Q+DP+FDP+ S +F  V C SPLCRRL
Sbjct  145  PATNVYMVLDTGSDVVWLQCSPCKVCYNQSDPMFDPAKSKTFATVPCGSPLCRRL  199



>ref|XP_009104352.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=485

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 116/175 (66%), Gaps = 9/175 (5%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            Y TL +  LP++Q +S    P+         DS  +L++ L H+D +SS + +A+P  LF
Sbjct  29   YNTLVVNTLPSSQIFS---SPEPESLTSTVSDSTTSLTVHLSHVDALSSFS-DASPSELF  84

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATRGR-----DFSSSVISGLAQGSGEYFTRLGVGT  438
              RL+RD+ R K+L+ LAA +   N T+        FS +VISGL+QGSGEYF RLGVGT
Sbjct  85   NLRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGT  144

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P    +MVLDTGSDV WLQCSPC+ CY Q+DP+F+P+ S++F  V C SPLCR+L
Sbjct  145  PATNVYMVLDTGSDVVWLQCSPCKVCYNQSDPMFNPAKSTTFATVPCGSPLCRKL  199



>ref|XP_010544842.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=510

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (65%), Gaps = 5/177 (3%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            ++L +QTL + PLPT+   S       +       ++  +LS  L H+D +S +  + +P
Sbjct  58   STLRHQTLVVNPLPTSPTLSWPDSEFVTDGSDSLSETATSLSAQLLHVDALSPS--DTSP  115

Query  262  KALFVKRLQRDAARAKTLSLLAAAAP---PHNATRGRDFSSSVISGLAQGSGEYFTRLGV  432
            + LF  RL+RD+ R +TL+  AAA+     H       FS +V+SGL+QGSGEYFTRLGV
Sbjct  116  EHLFDLRLRRDSLRVETLTSFAAASVRNVTHAPRAAGGFSGAVVSGLSQGSGEYFTRLGV  175

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GTP  YA+MVLDTGSD+ WLQCSPC+ CY Q+DP+FDP+ S S+  V C S LCRRL
Sbjct  176  GTPATYAYMVLDTGSDIVWLQCSPCKVCYNQSDPIFDPAKSRSYATVPCASRLCRRL  232



>gb|KJB09628.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=446

 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 119/180 (66%), Gaps = 14/180 (8%)
 Frame = +1

Query  97   QTLSLRPLPTAQHYSLSSKPQYSQTL-----VQPDDSGNTLS--LDLHHIDLISSAAVNA  255
            QTL  RPLP+A   S       S +L     + P  S  TL   L+LHH+D +SS     
Sbjct  33   QTLLPRPLPSAPTLSWHDSEPESNSLEETSQLDPLSSNTTLEVQLELHHVDALSS---ED  89

Query  256  TPKALFVKRLQRDAARAKTLSLLAAAA----PPHNATRGRDFSSSVISGLAQGSGEYFTR  423
            TP+ LF  RLQRDA R+ T+  L + A    PP  A R   FSSS+ISGLAQGSGEYFTR
Sbjct  90   TPELLFDLRLQRDALRSGTIYSLVSKAVARNPPRAAGRRSGFSSSIISGLAQGSGEYFTR  149

Query  424  LGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            LGVGTP +  +MVLDTGSDV W+QCSPC+ CY+Q+DP+FDP+ S+SF G+ C SPLCR L
Sbjct  150  LGVGTPARNLYMVLDTGSDVVWVQCSPCKSCYSQSDPIFDPTKSASFSGIPCRSPLCRSL  209



>gb|KJB09626.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=488

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 119/180 (66%), Gaps = 14/180 (8%)
 Frame = +1

Query  97   QTLSLRPLPTAQHYSLSSKPQYSQTL-----VQPDDSGNTLS--LDLHHIDLISSAAVNA  255
            QTL  RPLP+A   S       S +L     + P  S  TL   L+LHH+D +SS     
Sbjct  33   QTLLPRPLPSAPTLSWHDSEPESNSLEETSQLDPLSSNTTLEVQLELHHVDALSS---ED  89

Query  256  TPKALFVKRLQRDAARAKTLSLLAAAA----PPHNATRGRDFSSSVISGLAQGSGEYFTR  423
            TP+ LF  RLQRDA R+ T+  L + A    PP  A R   FSSS+ISGLAQGSGEYFTR
Sbjct  90   TPELLFDLRLQRDALRSGTIYSLVSKAVARNPPRAAGRRSGFSSSIISGLAQGSGEYFTR  149

Query  424  LGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            LGVGTP +  +MVLDTGSDV W+QCSPC+ CY+Q+DP+FDP+ S+SF G+ C SPLCR L
Sbjct  150  LGVGTPARNLYMVLDTGSDVVWVQCSPCKSCYSQSDPIFDPTKSASFSGIPCRSPLCRSL  209



>ref|XP_010918360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=507

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 101/140 (72%), Gaps = 8/140 (6%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTL-SLLAAAAPPHNATRG-----R  363
            L + L H+D  S  A N+TP+ L   RL RD AR   L  +LAAA    NATR      R
Sbjct  78   LRVRLAHLD--SLLAANSTPEHLLSLRLGRDVARVSNLHEILAAAMAAGNATRAIRGRRR  135

Query  364  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfd  543
             FSSSV+SGLAQGSGEYFTR+G+GTP +YA+MVLDTGSDV WLQC+PCR+CY+QTDPVFD
Sbjct  136  GFSSSVVSGLAQGSGEYFTRIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYSQTDPVFD  195

Query  544  psxsssfvGVKCDSPLCRRL  603
            P  S S+  V CD+PLCR L
Sbjct  196  PRRSRSYAAVPCDAPLCRTL  215



>ref|XP_010480432.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=488

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 102/137 (74%), Gaps = 6/137 (4%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNAT---RGRDFS  372
            ++L+L HID +SS   N TP+ LF  RLQRD+ R  +++ LAA  P  N T   R   FS
Sbjct  75   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVNSIATLAARVPRRNVTHAPRSGGFS  131

Query  373  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsx  552
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+ WLQC+PCR+CY+Q+DP+FDP  
Sbjct  132  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRK  191

Query  553  sssfvGVKCDSPLCRRL  603
            S ++  + C SP CRRL
Sbjct  192  SRTYSTIPCSSPHCRRL  208



>gb|KJB41527.1| hypothetical protein B456_007G108800, partial [Gossypium raimondii]
Length=460

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 114/182 (63%), Gaps = 14/182 (8%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDD----SGNT---LSLDLHHIDLISSAA  246
            L  QTL LRP P+A   S +     S +LV+  +    S NT   + L+LHH+D  SS  
Sbjct  23   LQLQTLVLRPFPSAPTLSWTDAEPESDSLVEIFELNAVSFNTTLEMHLELHHLDAFSS--  80

Query  247  VNATPKALFVKRLQRDAARAKTLSLLAAAAPPHN---ATRGRDFSSSVISGLAQGSGEYF  417
               T + LF   LQRD  RA+T+  L + A   N   AT    FSSS+I GLAQGSGEYF
Sbjct  81   -EETLERLFDLCLQRDMLRAETIYSLVSKAIACNRPRATGYLGFSSSIIFGLAQGSGEYF  139

Query  418  TRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCR  597
            TRLGV T P+Y +MVLDTG DV W+QCSPC+ CY+Q+DP+F P+ S SF G+ C SPL R
Sbjct  140  TRLGVSTLPRYLYMVLDTG-DVVWVQCSPCKNCYSQSDPIFYPTKSHSFSGIPCGSPLYR  198

Query  598  RL  603
             L
Sbjct  199  SL  200



>ref|XP_010924503.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=508

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 115/190 (61%), Gaps = 20/190 (11%)
 Frame = +1

Query  88   LDYQTLSLRPL-------PTAQHYSLSSKPQY--SQTLVQPDDSG---NTLSLDLHHIDL  231
            L+YQTL + PL       P     + +S  Q    +T + P   G   ++  + L H D 
Sbjct  29   LEYQTLVVTPLRPTPALLPDDDFLTWTSDSQTPADETDLSPAGGGAFSSSFHVSLAHRD-  87

Query  232  ISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHN------ATRGRDFSSSVISGL  393
             S  A N TP+ L   RL RDAAR   L  + AAA            R R FS+SV+SGL
Sbjct  88   -SLLAANTTPEHLLRLRLGRDAARVANLHKILAAATAAGNATHAVGARPRGFSASVVSGL  146

Query  394  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGV  573
            +QGSGEYFTR+G+GTP +Y  MVLDTGSDV WLQC+PCR+CY+QTDP+FDP  S S+  V
Sbjct  147  SQGSGEYFTRIGIGTPARYLNMVLDTGSDVVWLQCAPCRRCYSQTDPIFDPRQSRSYAAV  206

Query  574  KCDSPLCRRL  603
             C++PLCRRL
Sbjct  207  PCEAPLCRRL  216



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 113/167 (68%), Gaps = 17/167 (10%)
 Frame = +1

Query  148  SKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLS---  318
            S  ++S+T VQ ++  N++ L + H D +SS++  +  K +  +RL+RDAAR  +++   
Sbjct  52   SAQEWSET-VQGEEK-NSIVLQVVHRDSLSSSSNTSLVKEILQERLKRDAARVDSINARV  109

Query  319  ------LLAAAAPPHNATR------GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  462
                  +  A   P N +        +DFSSS+ISGLAQGSGEYFTRLGVGTPP+Y +MV
Sbjct  110  QLAAMGVSKAEMKPLNGSSIDARFDAKDFSSSIISGLAQGSGEYFTRLGVGTPPRYTYMV  169

Query  463  LDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            LDTGSD+ W+QC PC KCY QTDP+F+P+ SS++  V C +PLC++L
Sbjct  170  LDTGSDIMWIQCLPCAKCYGQTDPLFNPAASSTYRKVPCATPLCKKL  216



>ref|XP_006852628.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
 gb|ERN14095.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
Length=489

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 114/200 (57%), Gaps = 39/200 (20%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGN-----TLSLDLHHIDLISSAAVN  252
            L+ QTL LRPL        S  P   + L Q +  G+     +L L LHH D   S ++N
Sbjct  23   LESQTLLLRPL--------SKPPLLDEDLKQEETEGDLSDQTSLFLTLHHRD---SLSLN  71

Query  253  ATPKALFVKRLQRDAARAKTLS----LLAAAAPPHNA-----------------TRGRD-  366
             T + LF  RL+RD AR K+L+    L AA    H                   TRGR  
Sbjct  72   LTAEELFKLRLERDDARVKSLTNWVNLAAALGSSHRGHHHGAANPAAHANGSVQTRGRGQ  131

Query  367  -FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfd  543
             F++ V+SGL QGSGEYF R+ VGTPP+  +MVLDTGSD+ WLQC+PCR CY Q  P+F+
Sbjct  132  AFTAPVVSGLPQGSGEYFARVKVGTPPQPMYMVLDTGSDLAWLQCTPCRHCYRQVGPIFN  191

Query  544  psxsssfvGVKCDSPLCRRL  603
            PS SSS+  + C +PLCRRL
Sbjct  192  PSSSSSYSTLPCAAPLCRRL  211



>ref|XP_006402438.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
 dbj|BAJ34045.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43891.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
Length=484

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 115/175 (66%), Gaps = 10/175 (6%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            Y TL +  LP++   S    P+ S++L+   DS  +LS+ L H+D   S++ +A+P  LF
Sbjct  30   YNTLVVNTLPSSPILSF---PE-SESLISDSDSTTSLSVHLSHVD-ALSSSSDASPAELF  84

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGT  438
              RLQRD+ R ++L+ LAA +   N T+        FS  VISGL+QGSGEYF RLGVGT
Sbjct  85   NLRLQRDSLRVESLTSLAAVSAGRNVTKRPPRSAGGFSGVVISGLSQGSGEYFMRLGVGT  144

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P    +MVLDTGSDV WLQCSPC+ CY Q+DPVF+P+ S +F  V C S LCRRL
Sbjct  145  PATNMYMVLDTGSDVVWLQCSPCKVCYNQSDPVFNPAKSKTFATVPCGSRLCRRL  199



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = +1

Query  292  DAARAKTLSLLAAAAPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLD  468
            DA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+GVGTPPKY +MVLD
Sbjct  1    DAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFTRIGVGTPPKYVYMVLD  60

Query  469  TGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            TGSD+ WLQC+PC+ CY+QTDPVF+P  S SF  V C +PLCRRL
Sbjct  61   TGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFAKVLCRTPLCRRL  105



>ref|NP_001043485.1| Os01g0598600 [Oryza sativa Japonica Group]
 dbj|BAB63755.1| nucleoid DNA-binding protein cnd41-like [Oryza sativa Japonica 
Group]
 dbj|BAF05399.1| Os01g0598600 [Oryza sativa Japonica Group]
 gb|EAY74816.1| hypothetical protein OsI_02707 [Oryza sativa Indica Group]
Length=500

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 105/183 (57%), Gaps = 13/183 (7%)
 Frame = +1

Query  85   SLDYQTLSLRPL-PTAQHYSLSSKPQYSQTLVQPDDSG---NTLSLDLHHIDLISSAAVN  252
            ++ YQTL   PL P     +        Q  +  D+ G   +T+ L + H D     AVN
Sbjct  31   AVRYQTLVATPLSPHPYTATAVEDDGLFQGSLAADEGGAAASTVGLRVVHRDDF---AVN  87

Query  253  ATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATR------GRDFSSSVISGLAQGSGEY  414
            AT   L   RL+RD  RA  +S  A  A   N TR      G  F + V+SGLAQGSGEY
Sbjct  88   ATAAELLAHRLRRDKRRASRISAAAGGAAAANGTRVGGGGGGSGFVAPVVSGLAQGSGEY  147

Query  415  FTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLC  594
            FT++GVGTP   A MVLDTGSDV WLQC+PCR+CY Q+  +FDP  S S+  V C +PLC
Sbjct  148  FTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCYDQSGQMFDPRASHSYGAVDCAAPLC  207

Query  595  RRL  603
            RRL
Sbjct  208  RRL  210



>gb|EAZ12575.1| hypothetical protein OsJ_02481 [Oryza sativa Japonica Group]
Length=501

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 106/186 (57%), Gaps = 13/186 (7%)
 Frame = +1

Query  76   IFASLDYQTLSLRPL-PTAQHYSLSSKPQYSQTLVQPDDSG---NTLSLDLHHIDLISSA  243
            +  ++ YQTL   PL P     +        Q  +  D+ G   +T+ L + H D     
Sbjct  28   VAEAVRYQTLVATPLSPHPYTATAVEDDGLFQGSLAADEGGAAASTVGLRVVHRDDF---  84

Query  244  AVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATR------GRDFSSSVISGLAQGS  405
            AVNAT   L   RL+RD  RA  +S  A  A   N TR      G  F + V+SGLAQGS
Sbjct  85   AVNATAAELLAHRLRRDKRRASRISAAAGGAAAANGTRVGGGGGGSGFVAPVVSGLAQGS  144

Query  406  GEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDS  585
            GEYFT++GVGTP   A MVLDTGSDV WLQC+PCR+CY Q+  +FDP  S S+  V C +
Sbjct  145  GEYFTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCYDQSGQMFDPRASHSYGAVDCAA  204

Query  586  PLCRRL  603
            PLCRRL
Sbjct  205  PLCRRL  210



>ref|XP_011461997.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=261

 Score =   119 bits (298),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 88/137 (64%), Gaps = 12/137 (9%)
 Frame = +1

Query  130  QHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAK  309
            Q  SL       +   +PD   ++LSL LHH+D +SS   N TP  LF  RL+RD+ R  
Sbjct  18   QRVSLGDHESTLEKTSEPDSDPSSLSLPLHHLDALSS---NQTPSQLFHLRLRRDSLRFN  74

Query  310  TLSLLAAAAPPHNATRGRDFSSSVIS----GLAQGSGEYFTRLGVGTPPKYAFMVLDTGS  477
            +L+ LA     +N TR    SS   S    GL+QGSGEYFTR+GVG+ PKY +MVLDTGS
Sbjct  75   SLTSLA-----YNRTRPGPPSSGFSSSIVSGLSQGSGEYFTRIGVGSSPKYLYMVLDTGS  129

Query  478  DVFWLQCSPCRKCYAQT  528
            +V WLQC+PC++CY+QT
Sbjct  130  EVVWLQCAPCKRCYSQT  146



>ref|XP_004969076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=493

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 85/121 (70%), Gaps = 1/121 (1%)
 Frame = +1

Query  244  AVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNAT-RGRDFSSSVISGLAQGSGEYFT  420
            AVNAT   L   RL+RD  RA  +S  AA     N T RG   ++ V+SGLA+GSGEYFT
Sbjct  77   AVNATAAELLKHRLRRDKRRAARISKEAAGGAAANGTSRGGGVAAPVVSGLAEGSGEYFT  136

Query  421  RLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRR  600
            ++GVGTP   A MVLDTGSDV WLQC+PCR+CY Q+ PVFDP  SSS+  V C +PLCRR
Sbjct  137  KIGVGTPATPALMVLDTGSDVVWLQCAPCRRCYDQSGPVFDPRRSSSYGAVDCAAPLCRR  196

Query  601  L  603
            L
Sbjct  197  L  197



>ref|XP_003520873.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=461

 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 101/148 (68%), Gaps = 8/148 (5%)
 Frame = +1

Query  163  SQTLVQPDDSGNTLSLDLHH-IDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAP  339
            S+TL +P ++ +       H ID +SS   N TP+ LF  RLQRDA R + L     A  
Sbjct  41   SETLSEPQETLSLSLHLHLHHIDALSS---NKTPEQLFHLRLQRDAKRVEALLNQIHARR  97

Query  340  PHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCY  519
               ++     SSS+ISGLAQGSGEYFTR+GVGTP +Y +MVLDTGSDV WLQC+PCRKCY
Sbjct  98   SAGSSF----SSSIISGLAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCY  153

Query  520  AQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             QTD VFDP+ S ++ G+ C +PLCRRL
Sbjct  154  TQTDHVFDPTKSRTYAGIPCGAPLCRRL  181



>ref|XP_003569303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brachypodium 
distachyon]
Length=494

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 86/132 (65%), Gaps = 9/132 (7%)
 Frame = +1

Query  214  LHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATR--GRDFSSSVIS  387
            +H  D +    VNAT   L   RLQRD  RA  +S  A AA   N TR  G    + V+S
Sbjct  81   VHRDDFV----VNATAAELLGHRLQRDGKRAARISAAAGAA---NGTRRTGSGVVAPVVS  133

Query  388  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfv  567
            GLAQGSGEYFT++GVGTP   A MVLDTGSDV WLQC+PCR+CY Q+  VFDP  S S+ 
Sbjct  134  GLAQGSGEYFTKIGVGTPATPALMVLDTGSDVVWLQCAPCRRCYDQSGQVFDPRRSRSYG  193

Query  568  GVKCDSPLCRRL  603
             V C +PLCRRL
Sbjct  194  AVGCSAPLCRRL  205



>ref|XP_002440367.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
 gb|EES18797.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
Length=462

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 91/140 (65%), Gaps = 10/140 (7%)
 Frame = +1

Query  184  DDSGN--TLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATR  357
            DD+GN  T+   L H +  ++    A    L   RL RDAARA+ +S+ A      N TR
Sbjct  70   DDNGNASTVRFLLAHREAFAAPNATA--AQLLAHRLARDAARAEAISVSA-----RNVTR  122

Query  358  -GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdp  534
             G  FS+ V+SGLAQGSGEYF  +GVGTPP  A +VLDTGSDV WLQC+PCR+CYAQ+  
Sbjct  123  AGGGFSAPVVSGLAQGSGEYFASVGVGTPPTPALLVLDTGSDVVWLQCAPCRQCYAQSGR  182

Query  535  vfdpsxsssfvGVKCDSPLC  594
            VFDP  S S+  V+C +P C
Sbjct  183  VFDPRRSRSYAAVRCGAPPC  202



>dbj|BAJ86414.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 91/151 (60%), Gaps = 9/151 (6%)
 Frame = +1

Query  160  YSQTLVQPDDS-GNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAA  336
            ++  L   +D+  +T+   L H D  S   VNAT   L   RL+RDA RA  LS   AAA
Sbjct  59   FAGNLASAEDAPASTVRFRLVHRDDFS---VNATAAELLAYRLERDAKRAARLS---AAA  112

Query  337  PPHNATRGRDFSSSVISG--LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCR  510
             P N TR             LAQGSGEYFT++GVGTP   A MVLDTGSDV WLQC+PCR
Sbjct  113  GPANGTRRGGGGVVAPVVSGLAQGSGEYFTKIGVGTPATPALMVLDTGSDVVWLQCAPCR  172

Query  511  KCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +CY Q+  VFDP  S S+  V C +PLCRRL
Sbjct  173  RCYEQSGQVFDPRRSRSYNAVGCAAPLCRRL  203



>ref|XP_011007544.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 103/168 (61%), Gaps = 13/168 (8%)
 Frame = +1

Query  109  LRPLPTAQHYSLSSKPQYSQTLVQPDDSGNT--LSLDLHHIDLISSAAVNATPKALFVKR  282
            +RPL ++Q+  LS        +  P+DSG+     L L H D +S           F  R
Sbjct  68   IRPLKSSQYQELS--------MNIPNDSGSEGKQKLKLVHRDKVSFNKKFHNHSHDFHAR  119

Query  283  LQRDAARAKTLSLLAAAAPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  459
            +QRD  R   +SL+   +    A+ G  DF S V+SG+ QGSGEYF R+GVG+PP+  +M
Sbjct  120  MQRDVKR--VVSLIRRVSSGSAASYGVEDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYM  177

Query  460  VLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            V+D+GSD+ W+QC PC +CY QTDP+FDP+ S+SF+GV C S +C ++
Sbjct  178  VIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFMGVSCSSAVCDQV  225



>ref|XP_011031192.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 103/168 (61%), Gaps = 13/168 (8%)
 Frame = +1

Query  109  LRPLPTAQHYSLSSKPQYSQTLVQPDDSGNT--LSLDLHHIDLISSAAVNATPKALFVKR  282
            +RPL ++Q+  LS        +  P+DSG+     L L H D +S           F  R
Sbjct  68   IRPLKSSQYQELS--------MNIPNDSGSEGKQKLKLVHRDKVSFNKKFHNHSHDFHAR  119

Query  283  LQRDAARAKTLSLLAAAAPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  459
            +QRD  R   +SL+   +    A+ G  DF S V+SG+ QGSGEYF R+GVG+PP+  +M
Sbjct  120  MQRDVKR--VVSLIRRVSSGSAASYGVEDFGSEVVSGMDQGSGEYFVRIGVGSPPRSQYM  177

Query  460  VLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            V+D+GSD+ W+QC PC +CY QTDP+FDP+ S+SF+GV C S +C ++
Sbjct  178  VIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFMGVSCSSAVCDQV  225



>gb|KEH44446.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=486

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 95/167 (57%), Gaps = 3/167 (2%)
 Frame = +1

Query  103  LSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKR  282
            L+L+P  T +    + K        + D       L L H D IS+  ++    + F  R
Sbjct  47   LNLKPFHTTKQPQENKKSNAESMSEKSDAVSGKHKLKLLHRDKISAFNISGDHLSRFNAR  106

Query  283  LQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  462
            ++RD+ R   +    A    +      +F S V+SG+ QGSGEYF R+GVG+PPK  ++V
Sbjct  107  MERDSKRVTAVVRQIAGGVGYET---EEFGSGVVSGMEQGSGEYFVRIGVGSPPKNQYVV  163

Query  463  LDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +D+GSD+ W+QC PC +CY Q+DPVF+P  SSS+ GV C S +C R+
Sbjct  164  VDSGSDIIWVQCQPCTQCYHQSDPVFNPEDSSSYAGVSCGSTVCSRV  210



>tpg|DAA58835.1| TPA: hypothetical protein ZEAMMB73_701358 [Zea mays]
Length=485

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 82/120 (68%), Gaps = 3/120 (3%)
 Frame = +1

Query  244  AVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTR  423
            AVNAT   L   RLQRD  RA  +S  A A   +     +  ++ V+SGLAQGSGEYFT+
Sbjct  76   AVNATAGELLKHRLQRDKRRAARISEAAGAGGGNGR---KGVAAPVVSGLAQGSGEYFTK  132

Query  424  LGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +GVGTP   A MVLDTGSDV W+QC+PCR+CY Q+ PVFDP  SSS+  V C + LCRRL
Sbjct  133  IGVGTPATQALMVLDTGSDVVWVQCAPCRRCYEQSGPVFDPRRSSSYGAVGCGAALCRRL  192



>gb|ABK24480.1| unknown [Picea sitchensis]
Length=496

 Score =   111 bits (278),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 102/190 (54%), Gaps = 22/190 (12%)
 Frame = +1

Query  70   HPIFASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAV  249
            HP + +LD         P    Y    KP+ +   VQ           +H   L+   A 
Sbjct  38   HPAYLALDVAASIRDTAPGGVEYKRVQKPKRTAWSVQL----------VHRDSLLFKGAA  87

Query  250  NATP--KALFVKRLQRDAARAKTLS--------LLAAAAPPHNATRG--RDFSSSVISGL  393
            NAT   +    ++L+R+AAR + L         L    A  +    G   +F S V+SG+
Sbjct  88   NATASYERRLEEKLRREAARVRALEQRIERKLKLKKDPAGSYENVAGVTAEFGSEVVSGM  147

Query  394  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGV  573
             QGSGEYFTR+G+GTP +  +MVLDTGSDV W+QC PCR+CY+Q DP+F+PS S SF  V
Sbjct  148  EQGSGEYFTRIGIGTPTREQYMVLDTGSDVVWIQCEPCRECYSQADPIFNPSSSVSFSTV  207

Query  574  KCDSPLCRRL  603
             CDS +C +L
Sbjct  208  GCDSAVCSQL  217



>ref|XP_002306246.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
 gb|EEE93242.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
Length=502

 Score =   111 bits (277),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 105/176 (60%), Gaps = 8/176 (5%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQ--PDDSGNT--LSLDLHHIDLISSAAVNAT  258
            D+Q L+++   T        KP   Q L    P+DSG+     L L H D +S       
Sbjct  54   DFQLLNVKQAITETKIR-PLKPSLYQELSMNIPNDSGSEGKQKLKLVHRDKVSFNNKFHN  112

Query  259  PKALFVKRLQRDAARAKTLSLLAAAAPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVG  435
               +F  R+QRD  R   +SL+   +    A+ G  DF S V+SG+ QGSGEYF R+GVG
Sbjct  113  HSHVFHARMQRDVKRV--VSLIRRVSSGSTASYGVEDFGSEVVSGMDQGSGEYFVRIGVG  170

Query  436  TPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +PP+  +MV+D+GSD+ W+QC PC +CY QTDP+FDP+ S+SF+GV C S +C ++
Sbjct  171  SPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFMGVSCSSAVCDQV  226



>ref|XP_010248951.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=475

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 98/177 (55%), Gaps = 10/177 (6%)
 Frame = +1

Query  88   LDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNT---LSLDLHHIDLISSAAVNAT  258
            +DYQ L++R          S    Y Q  ++ +D G       L L H D I      +T
Sbjct  28   VDYQHLNVRETIATTKVQRSEMKSY-QEFLESNDRGEAEGRWKLKLVHRDTIFMGNY-ST  85

Query  259  PKALFVKRLQRDAARAKTLS--LLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGV  432
             +    +R+ RD  R  +L+  L       +      DF S VISG+ QGSGEYF R+GV
Sbjct  86   HRQRLDERITRDVKRVASLTRRLSGGDGAGYEV---EDFGSEVISGMEQGSGEYFVRIGV  142

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            G+PP+  +MVLD+GSD+ W+QC PC +CY Q DPVFDP+ S++F GV C S +C RL
Sbjct  143  GSPPRNQYMVLDSGSDIVWVQCQPCSQCYRQLDPVFDPAASATFAGVACSSTVCGRL  199



>ref|XP_002309912.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
 gb|EEE90362.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
Length=501

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 102/176 (58%), Gaps = 8/176 (5%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTL-VQPDDS--GNTLSLDLHHIDLISSAAVNATP  261
            D+Q L+++   T          QY +     P+DS  G    L L H D +S +      
Sbjct  53   DFQLLNVKQALTETKTRPIKPSQYQELFKTNPNDSESGGKQKLKLVHRDKVSFSNKLHNH  112

Query  262  KALFVKRLQRDAARAKTL--SLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVG  435
              +F  R+ RD  R  +L   L + +A  +      DF S V+SG+ QGSGEYF R+G+G
Sbjct  113  SHVFHARMHRDVKRVASLIHRLSSGSAAKYEV---EDFGSDVVSGMNQGSGEYFVRIGLG  169

Query  436  TPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +PP+  +MV+D+GSD+ W+QC PC +CY QTDP+FDP+ S+SF+GV C S +C R+
Sbjct  170  SPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFMGVSCSSAVCDRV  225



>ref|XP_009337150.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 107/184 (58%), Gaps = 24/184 (13%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            A L +   SL+PL         S+ Q SQ L     + +  SL LH  D + ++  +   
Sbjct  45   AVLSFDPESLQPL--------ESQSQESQPL-----NSSAFSLQLHPRDALFNSQ-HKDY  90

Query  262  KALFVKRLQRDAARAKTLSLLAAAA----------PPHNATRGRDFSSSVISGLAQGSGE  411
            K+L + RL RD+AR  +L      A          P H   + +D S+ V+SG++QGSGE
Sbjct  91   KSLTLTRLGRDSARVNSLHTKLQLALQGIKRVDLEPMHTEIQSQDLSTPVVSGVSQGSGE  150

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YF+R+GVGTP K  +MVLDTGSDV WLQC PC  CY Q+DPVF+P+ SS++  + CD+P 
Sbjct  151  YFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPVFNPAGSSTYSQLTCDAPQ  210

Query  592  CRRL  603
            C+ L
Sbjct  211  CQAL  214



>ref|XP_009351765.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Pyrus x 
bretschneideri]
Length=548

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 91/147 (62%), Gaps = 13/147 (9%)
 Frame = +1

Query  193  GNTLSLDLHHIDLISSAAVNATPKA--------LFVKRLQRDAARAKTLS--LLAAAAPP  342
            G    L + H D +SS   N             LF  R++RDA R  +L+  LL  +   
Sbjct  116  GEKWKLKVVHRDKMSSQYSNRNGNGGSHTSHSHLFRARMKRDAKRVASLTRRLLNDS---  172

Query  343  HNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYA  522
            ++     DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY 
Sbjct  173  NSELESLDFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCTECYH  232

Query  523  QTdpvfdpsxsssfvGVKCDSPLCRRL  603
            Q+DP+FDP+ S+S+ GV CDS LC RL
Sbjct  233  QSDPIFDPARSASYSGVSCDSSLCGRL  259



>gb|KJB77420.1| hypothetical protein B456_012G135900 [Gossypium raimondii]
Length=484

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 88/137 (64%), Gaps = 5/137 (4%)
 Frame = +1

Query  208  LDLHHIDLISS--AAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHN--ATRG-RDFS  372
            L L H D +S+  A V+      F  R+QRD  R  +L L       H+  A  G  DF 
Sbjct  72   LKLIHRDWLSTENATVSRNHSRRFHARIQRDVKRVASLLLRIPGGVIHDGEAAHGVNDFG  131

Query  373  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsx  552
            S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY Q+DPVFDP+ 
Sbjct  132  SDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCNQCYKQSDPVFDPAD  191

Query  553  sssfvGVKCDSPLCRRL  603
            S+S+ GV C S +C R+
Sbjct  192  SASYGGVPCSSSVCDRI  208



>ref|XP_002455897.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
 gb|EES01017.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
Length=493

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 79/116 (68%), Gaps = 4/116 (3%)
 Frame = +1

Query  268  LFVKRLQRDAARAKTLS--LLAAAAPPHNATRGRD--FSSSVISGLAQGSGEYFTRLGVG  435
            L   RLQRD  RA  +S       A   N TR R    ++ V+SGLAQGSGEYFT++GVG
Sbjct  88   LLRHRLQRDKRRAARISKAAAGGGAGAANGTRSRGGAVAAPVVSGLAQGSGEYFTKIGVG  147

Query  436  TPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            TP   A MVLDTGSDV WLQC+PCR+CY Q+ PVFDP  SSS+  V C +PLCRRL
Sbjct  148  TPSTPALMVLDTGSDVVWLQCAPCRRCYDQSGPVFDPRRSSSYGAVDCAAPLCRRL  203



>gb|KDP40474.1| hypothetical protein JCGZ_24473 [Jatropha curcas]
Length=469

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 95/152 (63%), Gaps = 5/152 (3%)
 Frame = +1

Query  157  QYSQTLVQPDDSGN--TLSLDLHHID-LISSAAVNATPKALFVKRLQRDAARAKTLSLLA  327
            QY Q  +  +DS +     L L H D +I+S+        LF  R+ RD  R    SL+ 
Sbjct  44   QYQQLFINQNDSQSQGIWKLKLVHRDRIITSSNSLHNHTHLFHARINRDIKRVA--SLIR  101

Query  328  AAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPC  507
              + P    +  DF + V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+ W+QC PC
Sbjct  102  RLSSPAATYQVNDFGAEVVSGMNQGSGEYFVRIGVGSPPRDQYVVIDSGSDIVWVQCQPC  161

Query  508  RKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             +CY QTDPVFDP+ S+SF+GV C S +C R+
Sbjct  162  TQCYHQTDPVFDPANSASFIGVSCSSAVCDRV  193



>ref|XP_006345303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=477

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 102/189 (54%), Gaps = 16/189 (8%)
 Frame = +1

Query  76   IFASLDYQTLSLR----PLPTAQHYSLSSKPQYSQTLVQP---------DDSGNTLSLDL  216
            I AS  Y++ S      P PT +H  ++   + S TL+QP         DD  +   L L
Sbjct  15   ISASASYESKSTSGHAIPFPTHEHLDVNQAIKES-TLIQPPETHDINIVDDDNSRWKLKL  73

Query  217  HHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLA  396
             H D +  +     P   F  R++RD  R  TL+             G  F S VISG+ 
Sbjct  74   LHRDKLPFSHFTDHPHR-FQARMKRDIKRVHTLTATTNYDEVKEEEFG-GFGSEVISGME  131

Query  397  QGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVK  576
            QGSGEYF R+GVG+P +  +MV+D GSD+ W+QC PC  CY Q+DPVFDPS S+SF GV 
Sbjct  132  QGSGEYFVRIGVGSPVRQQYMVIDAGSDIVWVQCQPCTHCYHQSDPVFDPSLSASFSGVP  191

Query  577  CDSPLCRRL  603
            C S LC R+
Sbjct  192  CSSSLCDRI  200



>ref|XP_008244017.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=494

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 79/124 (64%), Gaps = 10/124 (8%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLSLLAAAA----------PPHNATRGRDFSSSVISGLAQGSGE  411
            ++L + RL RD+AR  +L      A          P H   R  D S+ V+SG++QGSGE
Sbjct  98   ESLVLSRLGRDSARVNSLHTKLQLAVQNIKKSDLEPMHTEIRPEDLSTPVVSGVSQGSGE  157

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YFTR+GVGTP K  +MVLDTGSD+ WLQC PC  CY QTDPVF+P+ SS++  V CDS  
Sbjct  158  YFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDCYQQTDPVFNPTGSSTYHPVTCDSAQ  217

Query  592  CRRL  603
            C  L
Sbjct  218  CHSL  221



>ref|XP_004497254.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=486

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 101/184 (55%), Gaps = 9/184 (5%)
 Frame = +1

Query  70   HPIFASLDY-QTLS-----LRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDL  231
            +P F  L+  QT++     L+P  T +    + K        + +       L L H D 
Sbjct  30   YPHFQHLNVKQTIAETKRKLKPFHTTKQPQENQKSNTDAESEKTESGSGKRKLKLLHRDE  89

Query  232  ISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGE  411
            I    ++   ++ F  R++RDA R   +    A    +      +F S V+SG+ QGSGE
Sbjct  90   IHIFNISRDHRSRFNARMKRDAKRVAAVVRRIAGGVGYKT---EEFGSDVVSGMEQGSGE  146

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YF R+GVG+PPK  ++V+D+GSD+ W+QC PC +CY Q+DPVF+P  SSS+ GV C S +
Sbjct  147  YFVRIGVGSPPKNQYVVIDSGSDIIWVQCQPCTQCYRQSDPVFNPGDSSSYSGVSCGSTV  206

Query  592  CRRL  603
            C R+
Sbjct  207  CSRV  210



>ref|XP_009629151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=491

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 100/181 (55%), Gaps = 17/181 (9%)
 Frame = +1

Query  106  SLRPLPTAQHYSLSSKPQYSQTLVQP------------DDSGN---TLSLDLHHIDLISS  240
            +L P PT +++++        T +Q             D++G     L L L H D +  
Sbjct  37   ALFPYPTHENFNVQETISQLATKIQTPHEKQEEDFHFDDENGEEKRNLKLKLIHRDKLYF  96

Query  241  AAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFT  420
            +   +    +F  R++RD  R    SL+       N  R  +F S V+SG+ QGSGEYF 
Sbjct  97   SNYFSNHSKMFEARMKRDVKRVS--SLIHRITGGGNGYRVEEFGSDVVSGMDQGSGEYFV  154

Query  421  RLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRR  600
            R+GVG+P +  +MV+D+GSD+ W+QC PC +CY Q+DPVFDPS S SF GV C S +C R
Sbjct  155  RIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCYHQSDPVFDPSLSGSFAGVSCGSSVCDR  214

Query  601  L  603
            +
Sbjct  215  V  215



>ref|XP_011022942.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=502

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 102/177 (58%), Gaps = 9/177 (5%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTL-VQPDDS---GNTLSLDLHHIDLISSAAVNAT  258
            D+Q L+++   T          QY +     P+DS   G    L L H D +S +     
Sbjct  53   DFQLLNVKQALTETKTRPIKPSQYQELFKTNPNDSESTGGKQKLKLVHRDKVSFSNQLHN  112

Query  259  PKALFVKRLQRDAARAKTL--SLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGV  432
               +F  R+ RD  R  +L   L + +A  +      +F S V+SG+ QGSGEYF R+G+
Sbjct  113  HSHVFNARMHRDVKRVASLIHRLSSGSAAKYEV---ENFGSDVVSGMNQGSGEYFVRIGL  169

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            G+PP+  +MV+D+GSD+ W+QC PC +CY QTDP+FDP+ S+SF+GV C S +C R+
Sbjct  170  GSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFMGVSCSSAVCDRV  226



>ref|XP_006415880.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
 gb|ESQ34233.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
Length=487

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 106/179 (59%), Gaps = 13/179 (7%)
 Frame = +1

Query  100  TLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVK  279
            T S+R    A  + L+   Q  Q+L     S +  +L LH    +  A  ++  K+L + 
Sbjct  39   TDSIRKTKDASSFQLN--KQEDQSLTHSPSSSSAFTLQLHSRASVRGAEHHSDYKSLTLA  96

Query  280  RLQRDAARAKTL---------SLLAAAAPPHNAT--RGRDFSSSVISGLAQGSGEYFTRL  426
            RL+RD+AR K+L         ++  +   P + T    +D  + +ISG  QGSGEYFTR+
Sbjct  97   RLERDSARVKSLMARLDLAINNISKSDLKPISTTYTTQQDIEAPLISGTTQGSGEYFTRV  156

Query  427  GVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            G+G P +  +MVLDTGSDV WLQC+PC +CY QT+P+F+PS SSS+  + CD+P C+ L
Sbjct  157  GIGNPAREVYMVLDTGSDVNWLQCAPCAECYHQTEPIFEPSSSSSYSPLSCDTPQCKSL  215



>ref|XP_007142740.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
 gb|ESW14734.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
Length=475

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 106/183 (58%), Gaps = 10/183 (5%)
 Frame = +1

Query  70   HPIFASLDY-QTLS---LRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLIS  237
            +P F  L+  QTL+   L P PT+     S + Q    +   D S     L L H D +S
Sbjct  22   YPHFQQLNVKQTLAQTKLIPKPTSTPKQPSHQHQTPNAVT--DSSSTKWKLKLLHRDKVS  79

Query  238  SAAVNATPKALFVKRLQRDAAR-AKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEY  414
            +       +  F  R++RDA R A  L  LAA  P  ++     F S V+SG+ QGSGEY
Sbjct  80   TFNTTLDHQTRFNARIERDARRVAVLLRRLAAGKPTLDS---EAFGSDVVSGMEQGSGEY  136

Query  415  FTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLC  594
            F R+GVG+PP+  ++V+D+GSD+ W+QC PC +CY Q+DPVF+P+ SSS+ GV C S +C
Sbjct  137  FVRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCYRQSDPVFNPADSSSYAGVSCASTVC  196

Query  595  RRL  603
              +
Sbjct  197  SHV  199



>gb|ABK25248.1| unknown [Picea sitchensis]
Length=366

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 105/192 (55%), Gaps = 26/192 (14%)
 Frame = +1

Query  73   PIFASLDYQTLSLRPLPTAQ---HYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSA  243
            P + +LD  + SLR   TA     Y   +KP+ S   V+           +H   L+   
Sbjct  40   PAYHALDVAS-SLRETDTAAGGAEYKRETKPRRSPWSVEV----------VHRDALLLKN  88

Query  244  AVNATP------------KALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVIS  387
            A NAT             +A+ V+ L+R   R  TL+        + A    DF   V+S
Sbjct  89   AANATASYERRLKEKLRREAVRVRGLERQIERTLTLNKDPVNRYENVAEVDADFGGEVVS  148

Query  388  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfv  567
            G+ QGSGEYFTR+GVGTP +  +MVLDTGSDV W+QC PCR+CY+Q DP+F+PS S+SF 
Sbjct  149  GMEQGSGEYFTRIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYSQADPIFNPSYSASFS  208

Query  568  GVKCDSPLCRRL  603
             V CDS +C +L
Sbjct  209  TVGCDSAVCSQL  220



>gb|KDO69941.1| hypothetical protein CISIN_1g011042mg [Citrus sinensis]
Length=495

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 91/144 (63%), Gaps = 15/144 (10%)
 Frame = +1

Query  205  SLDLHHIDLISSAAVNATPKA-------LFVKRLQRDAARAKTL----SLLAAAAPPHNA  351
            +L+L H D +SS++ N T           F  R+QRD  R  TL    S   A A  H  
Sbjct  80   NLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAAKHEV  138

Query  352  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTd  531
               +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY Q+D
Sbjct  139  ---QDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSD  195

Query  532  pvfdpsxsssfvGVKCDSPLCRRL  603
            PVFDP+ S+SF GV C S +C RL
Sbjct  196  PVFDPADSASFSGVSCSSAVCDRL  219



>gb|KHN16429.1| Aspartic proteinase nepenthesin-1, partial [Glycine soja]
Length=104

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +1

Query  391  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvG  570
            LAQGSGEYFTR+GVGTP +Y +MVLDTGSDV WLQC+PCRKCY Q DPVFDP+ S ++ G
Sbjct  1    LAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCYTQADPVFDPTKSRTYAG  60

Query  571  VKCDSPLCRRL  603
            + C +PLCRRL
Sbjct  61   IPCGAPLCRRL  71



>ref|XP_004147103.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004166359.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 gb|KGN51568.1| hypothetical protein Csa_5G579060 [Cucumis sativus]
Length=482

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 91/140 (65%), Gaps = 7/140 (5%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTL----SLLAAAAPPHNATRGR  363
            NT  L+L H D +S    +   +  F  R++RDA R  TL    S  A AA   +  +  
Sbjct  70   NTFKLNLLHRDKLSHVHGH---RRGFNDRMKRDAIRVATLVRRLSHGAPAAVKDSRYKVA  126

Query  364  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfd  543
            +F++ VISG+  GSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY Q+DPVFD
Sbjct  127  NFATDVISGMEAGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCKPCSRCYQQSDPVFD  186

Query  544  psxsssfvGVKCDSPLCRRL  603
            P+ SSSF GV C S +C RL
Sbjct  187  PADSSSFAGVSCGSDVCDRL  206



>emb|CDY24395.1| BnaCnng04620D [Brassica napus]
Length=482

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 106/181 (59%), Gaps = 26/181 (14%)
 Frame = +1

Query  106  SLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP----KALF  273
            S+R    A  + L+ + ++SQ    P  S  + SL LH     S A+V  T      +L 
Sbjct  41   SIRKTKDASSFRLNQQEEHSQ---YPTSS--SFSLQLH-----SRASVRGTEHPDYNSLT  90

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATRG-----------RDFSSSVISGLAQGSGEYFT  420
            + RL RD+AR K+L+     A  +N TR             +  + +ISG  QGSGEYFT
Sbjct  91   LARLHRDSARVKSLTARLNLAI-NNITRADLKHTMYTTEQEEIEAPLISGTTQGSGEYFT  149

Query  421  RLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRR  600
            R+G+G+P +  +MVLDTGSDV WLQC+PC +CY QT+P+F+P+ SSS+  + CD+P C+ 
Sbjct  150  RVGIGSPAREVYMVLDTGSDVNWLQCAPCAQCYHQTEPIFEPTSSSSYATLSCDAPQCKA  209

Query  601  L  603
            L
Sbjct  210  L  210



>ref|XP_006437655.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
 gb|ESR50895.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
Length=495

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 90/143 (63%), Gaps = 15/143 (10%)
 Frame = +1

Query  208  LDLHHIDLISSAAVNATPKA-------LFVKRLQRDAARAKTL----SLLAAAAPPHNAT  354
            L+L H D +SS++ N T           F  R+QRD  R  TL    S   A A  H   
Sbjct  81   LELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAAKHEV-  138

Query  355  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdp  534
              +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY Q+DP
Sbjct  139  --QDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDP  196

Query  535  vfdpsxsssfvGVKCDSPLCRRL  603
            VFDP+ S+SF GV C S +C RL
Sbjct  197  VFDPADSASFSGVSCSSAVCDRL  219



>ref|XP_006484478.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=495

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 90/143 (63%), Gaps = 15/143 (10%)
 Frame = +1

Query  208  LDLHHIDLISSAAVNATPKA-------LFVKRLQRDAARAKTL----SLLAAAAPPHNAT  354
            L+L H D +SS++ N T           F  R+QRD  R  TL    S   A A  H   
Sbjct  81   LELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAAKHEV-  138

Query  355  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdp  534
              +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY Q+DP
Sbjct  139  --QDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQSDP  196

Query  535  vfdpsxsssfvGVKCDSPLCRRL  603
            VFDP+ S+SF GV C S +C RL
Sbjct  197  VFDPADSASFSGVSCSSAVCDRL  219



>ref|XP_008351878.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 102/173 (59%), Gaps = 18/173 (10%)
 Frame = +1

Query  133  HYSLSSKPQYSQTLV------QPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRD  294
            H  LS  P+  Q L       QP +S +  SL LH  D + ++  +   K+L + RL RD
Sbjct  44   HAVLSFDPESLQPLEXQSQESQPLNS-SAFSLQLHPRDXLFNSQ-HKDYKSLTLTRLGRD  101

Query  295  AARAKTLSLLAAAA----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  444
            +AR  +L      A          P H   + +D S+ V+SG++QGSGEYF+R+GVGTP 
Sbjct  102  SARVNSLHTKLQLALQGIKRGDLEPMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVGTPA  161

Query  445  KYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            K  +MVLDTGSDV WLQC PC  CY Q+DP F+P+ SS++  + CD+P C+ L
Sbjct  162  KSFYMVLDTGSDVNWLQCGPCSDCYQQSDPXFNPAGSSTYSQLTCDAPQCQAL  214



>ref|XP_009337317.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 106/184 (58%), Gaps = 24/184 (13%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            A L +   SL+PL         S+ Q SQ L     + +  SL LH  D + ++  +   
Sbjct  45   AVLSFDPESLQPL--------ESQSQESQPL-----NSSAFSLQLHPRDALFNSQ-HKDY  90

Query  262  KALFVKRLQRDAARAKTLSLLAAAA----------PPHNATRGRDFSSSVISGLAQGSGE  411
            K+L + RL RD+AR  +L      A          P H   + +D S+ V+SG++QGSGE
Sbjct  91   KSLTLTRLGRDSARVNSLHTKLQLALQGIKRVDLEPMHTEVQSQDLSTPVVSGVSQGSGE  150

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YF+R+GVGTP K  +MVLDTGSDV WLQC PC  CY Q+DPVF+P+ SS++  + CD+  
Sbjct  151  YFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPVFNPAGSSTYSQLTCDASQ  210

Query  592  CRRL  603
            C+ L
Sbjct  211  CQAL  214



>gb|ABR17085.1| unknown [Picea sitchensis]
Length=498

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/192 (41%), Positives = 105/192 (55%), Gaps = 26/192 (14%)
 Frame = +1

Query  73   PIFASLDYQTLSLRPLPTAQ---HYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSA  243
            P + +LD  + SLR   TA     Y   +KP+ S   V+           +H   L+   
Sbjct  40   PAYHALDVAS-SLRETDTAAGGAEYKRETKPRRSPWSVEV----------VHRDALLLKN  88

Query  244  AVNATP------------KALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVIS  387
            A NAT             +A+ V+ L+R   R  TL+        + A    DF   V+S
Sbjct  89   AANATASYERRLKEKLRREAVRVRGLERQIERTLTLNKDPVNRYENVAEVDADFGGEVVS  148

Query  388  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfv  567
            G+ QGSGEYFTR+GVGTP +  +MVLDTGSDV W+QC PCR+CY+Q DP+F+PS S+SF 
Sbjct  149  GMEQGSGEYFTRIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYSQADPIFNPSYSASFS  208

Query  568  GVKCDSPLCRRL  603
             V CDS +C +L
Sbjct  209  TVGCDSAVCSQL  220



>ref|XP_008445900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=481

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 91/139 (65%), Gaps = 6/139 (4%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLL---AAAAPPHNATRGRD  366
            +T  L+L H D +S    +   +  F  R++RDA R  TL       AAA   +  +  +
Sbjct  70   DTFKLNLLHRDKLSHVHGH---RRGFNDRMKRDAIRVATLVRRLSHGAAAVEDSRFKVAN  126

Query  367  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdp  546
            F++ VISG+ +GSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY Q+DPVFDP
Sbjct  127  FATDVISGMEEGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCSRCYQQSDPVFDP  186

Query  547  sxsssfvGVKCDSPLCRRL  603
            + SSSF GV C S +C RL
Sbjct  187  ADSSSFAGVSCGSDVCDRL  205



>ref|XP_008374731.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
Length=487

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 97/161 (60%), Gaps = 11/161 (7%)
 Frame = +1

Query  151  KPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAA  330
            KP  SQ+      + +  SL LH  D + ++  +   K+L + RL RD+AR  +L     
Sbjct  55   KPLESQSQESRPLNSSAFSLQLHPRDALFNSQ-HKDYKSLTLTRLDRDSARVNSLHTKLQ  113

Query  331  AA----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSD  480
             A          P H     +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDTGSD
Sbjct  114  LALQGIKKSDLEPMHAEILPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSD  173

Query  481  VFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            V WLQC+PC  CY Q+DPVF P+ SS++  + CD+P C+ L
Sbjct  174  VNWLQCNPCSDCYQQSDPVFSPAGSSTYSQLTCDAPQCQAL  214



>ref|XP_008465249.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=477

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = +1

Query  271  FVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  450
            F +R+ RD+ R  +L  L + A     T   DF S V+SG  QGSGEYF R+GVG+PP+ 
Sbjct  94   FKERISRDSKRVSSLLRLLSNASDEQVT---DFGSDVVSGTEQGSGEYFVRIGVGSPPRS  150

Query  451  AFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             ++V+D+GSD+ W+QC PC +CY Q+DPVFDP+ S+++ G+ CDS +C RL
Sbjct  151  QYVVIDSGSDIVWVQCQPCSECYQQSDPVFDPAGSATYAGISCDSSVCDRL  201



>ref|XP_007209939.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
 gb|EMJ11138.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
Length=494

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 78/124 (63%), Gaps = 10/124 (8%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLSLL----------AAAAPPHNATRGRDFSSSVISGLAQGSGE  411
            ++L   RL RD+AR  +L             +   P H   R  D S+ V+SG++QGSGE
Sbjct  98   ESLVQSRLGRDSARVNSLHTKLQLVVQNIKKSDLEPMHTEIRPEDLSTPVVSGVSQGSGE  157

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YFTR+GVGTP K  +MVLDTGSD+ WLQC PC  CY QTDPVF+P+ SS++  V CDS  
Sbjct  158  YFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDCYQQTDPVFNPTGSSTYRPVTCDSAQ  217

Query  592  CRRL  603
            C  L
Sbjct  218  CHSL  221



>ref|XP_004961034.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 107/183 (58%), Gaps = 10/183 (5%)
 Frame = +1

Query  82   ASLDYQTLSLRPL---PTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVN  252
            A   Y TL   PL   PTA+  + +     +      D  GN  +++L      + AA N
Sbjct  38   ARYQYHTLRATPLSPEPTARVDAAAILGTSTDLTAVFDGIGNASAVELVLAHREAFAAPN  97

Query  253  ATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATR------GRDFSSSVISGLAQGSGEY  414
            AT   L   RL RDAARA  +S  AAA    N TR      G  F++ V+SGL+QGSGEY
Sbjct  98   ATAPQLLAHRLARDAARADAISSAAAAGA-TNGTRAPRRRGGSGFAAPVLSGLSQGSGEY  156

Query  415  FTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLC  594
            F ++GVGTPP  A +VLDTGSDV WLQC+PCR CYAQ+  VFDP  S S+  V C +PLC
Sbjct  157  FAQVGVGTPPTPALLVLDTGSDVVWLQCAPCRHCYAQSGRVFDPRRSRSYATVPCAAPLC  216

Query  595  RRL  603
            RRL
Sbjct  217  RRL  219



>ref|XP_004236867.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=479

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 98/179 (55%), Gaps = 7/179 (4%)
 Frame = +1

Query  70   HPIFASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGN-TLSLDLHHIDLISSAA  246
            H IF   +    S+  L T       ++ +Y        +SGN  L L+L H D +    
Sbjct  31   HEIFNVKE----SIAQLDTKPQTPFENQEEYHVDNEIEQESGNLKLKLNLIHRDKLQIPH  86

Query  247  VNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRL  426
                   +F  R+ RD  R    S++          R ++F S +ISG+ QGSGEYF R+
Sbjct  87   FPYNNDKVFEGRISRDLKRVS--SIIHRIENGGVNYRVKEFGSDLISGMDQGSGEYFVRV  144

Query  427  GVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GVG+PPK  +MVLD+GSD+ W+QC PC +CY Q+DPVFDPS S SF GV C S +C R+
Sbjct  145  GVGSPPKNQYMVLDSGSDIVWVQCQPCTQCYHQSDPVFDPSLSVSFTGVSCGSSVCDRV  203



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 92/143 (64%), Gaps = 5/143 (3%)
 Frame = +1

Query  187  DSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTL----SLLAAAAPPHNAT  354
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  ++     L    A      
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKNYKSLVLSRLERDSSRVASIIAKVKLAVEGADSETHY  133

Query  355  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdp  534
            +  + ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY Q+DP
Sbjct  134  QPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDP  193

Query  535  vfdpsxsssfvGVKCDSPLCRRL  603
            +FDPS SS++  + C +P C  L
Sbjct  194  IFDPSSSSTYKSLTCSAPQCASL  216



>ref|XP_002267930.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=479

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 70/168 (42%), Positives = 100/168 (60%), Gaps = 11/168 (7%)
 Frame = +1

Query  121  PTAQHYSLSSKPQYSQTLVQP-------DDSGNTLSLDLHHIDLISSAAVNATPKALFVK  279
            PT QH  L+ K   + T + P       ++ G    + + H D +S    +     L   
Sbjct  40   PTFQH--LNVKETIAGTRIIPLEVSEDHEEGGEKWMMKVVHRDQLSFGNSDDHRHRL-DG  96

Query  280  RLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  459
            RL+RDA R  +L +   ++    + R  DF + VISG+ QGSGEYF R+GVG+PP+  +M
Sbjct  97   RLKRDAKRVASL-IRRLSSGGGGSYRVDDFGTDVISGMEQGSGEYFVRIGVGSPPRSQYM  155

Query  460  VLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            V+D+GSD+ W+QC PC +CY Q+DPVFDP+ S+SF GV C S +C RL
Sbjct  156  VIDSGSDIVWVQCQPCTQCYHQSDPVFDPADSASFTGVSCSSSVCDRL  203



>gb|KJB49971.1| hypothetical protein B456_008G147500 [Gossypium raimondii]
Length=480

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/169 (40%), Positives = 95/169 (56%), Gaps = 15/169 (9%)
 Frame = +1

Query  112  RPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISS--AAVNATPKALFVKRL  285
            RPL T++H+ +S             ++     L L H D +SS  +A        F  R+
Sbjct  46   RPLQTSEHHQVS----------DVSETQGKWKLKLVHRDKLSSNTSATFRDHSRRFHARM  95

Query  286  QRDAARAKTLSL---LAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  456
            QRD  R  +L              A    DF S V+SG+ QGSGEYF R+GVG+PPK  +
Sbjct  96   QRDVKRVASLLRRLSGGGGHDGGAAYEVNDFGSDVVSGMDQGSGEYFVRIGVGSPPKSQY  155

Query  457  MVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            MV+D+GSD+ W+QC PC +CY Q+DPVFDP+ S+S+ G+ C S +C R+
Sbjct  156  MVIDSGSDIVWVQCQPCNQCYRQSDPVFDPADSASYAGISCSSAVCDRI  204



>ref|XP_008367576.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 106/184 (58%), Gaps = 24/184 (13%)
 Frame = +1

Query  82   ASLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP  261
            A L +   SL+PL         S+ Q SQ L     + +  SL LH  D++ ++  +   
Sbjct  45   AVLSFDPESLQPL--------ESQSQESQPL-----NSSAFSLQLHPRDVLFNSQ-HKDY  90

Query  262  KALFVKRLQRDAARAKTLSLLAAAA----------PPHNATRGRDFSSSVISGLAQGSGE  411
            K+L +  L RD+AR  +L      A          P H   + +D S+ V+SG++QGSGE
Sbjct  91   KSLTLTILGRDSARVNSLHTKLQLALQGIKRGDLEPMHAEIQPQDLSTPVVSGVSQGSGE  150

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YF+R+GVGTP K  +MVLDTGSDV WLQC PC  CY Q+DP F+P+ SS++  + CD+P 
Sbjct  151  YFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDCYQQSDPXFNPAGSSTYSQLTCDAPQ  210

Query  592  CRRL  603
            C+ L
Sbjct  211  CQAL  214



>ref|NP_001056485.1| Os05g0590000 [Oryza sativa Japonica Group]
 gb|AAT58814.1| putative nucleoid DNA-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF18399.1| Os05g0590000 [Oryza sativa Japonica Group]
Length=481

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 91/168 (54%), Gaps = 19/168 (11%)
 Frame = +1

Query  109  LRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQ  288
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  40   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  85

Query  289  RDAARAKTLSLLAAAAPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  459
                        A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  86   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  143

Query  460  VLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            VLDTGSDV WLQC+PCR CYAQ+  VFDP  S S+  V C +P+CRRL
Sbjct  144  VLDTGSDVVWLQCAPCRHCYAQSGRVFDPRRSRSYAAVDCVAPICRRL  191



>gb|AAT38006.1| unknow protein [Oryza sativa Japonica Group]
Length=475

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 91/168 (54%), Gaps = 19/168 (11%)
 Frame = +1

Query  109  LRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQ  288
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  34   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  79

Query  289  RDAARAKTLSLLAAAAPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  459
                        A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  80   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  137

Query  460  VLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            VLDTGSDV WLQC+PCR CYAQ+  VFDP  S S+  V C +P+CRRL
Sbjct  138  VLDTGSDVVWLQCAPCRHCYAQSGRVFDPRRSRSYAAVDCVAPICRRL  185



>gb|EAY99240.1| hypothetical protein OsI_21202 [Oryza sativa Indica Group]
Length=475

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 91/168 (54%), Gaps = 19/168 (11%)
 Frame = +1

Query  109  LRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQ  288
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  34   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  79

Query  289  RDAARAKTLSLLAAAAPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  459
                        A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  80   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  137

Query  460  VLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            VLDTGSDV WLQC+PCR CYAQ+  VFDP  S S+  V C +P+CRRL
Sbjct  138  VLDTGSDVVWLQCAPCRHCYAQSGRVFDPRRSRSYAAVDCVAPICRRL  185



>ref|XP_003536757.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=475

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 83/132 (63%), Gaps = 2/132 (2%)
 Frame = +1

Query  208  LDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVIS  387
            L L H D + +       +  F  R+QRD  RA +L    AA  P  A     F S V+S
Sbjct  70   LKLVHRDKVPTFNTYHDHRTRFNARMQRDTKRAASLLRRLAAGKPTYAAEA--FGSDVVS  127

Query  388  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfv  567
            G+ QGSGEYF R+GVG+PP+  ++V+D+GSD+ W+QC PC +CY Q+DPVF+P+ SSSF 
Sbjct  128  GMEQGSGEYFVRIGVGSPPRNQYVVMDSGSDIIWVQCEPCTQCYHQSDPVFNPADSSSFS  187

Query  568  GVKCDSPLCRRL  603
            GV C S +C  +
Sbjct  188  GVSCASTVCSHV  199



>gb|KJB37242.1| hypothetical protein B456_006G195400 [Gossypium raimondii]
Length=482

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 105/180 (58%), Gaps = 19/180 (11%)
 Frame = +1

Query  118  LPTAQHYSLSSKPQ----YSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP----KALF  273
            L  AQH  LS  PQ    ++QT  QP    ++ S  +  + L S  +V+ T     KAL 
Sbjct  43   LSQAQHI-LSFDPQSLKAFAQTQTQPLFFNSSTSAAVFSVPLHSRGSVHKTHHTDYKALV  101

Query  274  VKRLQRDAARAKTLS---LLAAAAPPHNATR-------GRDFSSSVISGLAQGSGEYFTR  423
            + RL+RD+AR  +LS   LLA      +  R           S+ +ISG +QGSGEYF+R
Sbjct  102  LSRLERDSARVDSLSTKLLLALNGVKKSQLRPLPTQIQAEALSTPIISGTSQGSGEYFSR  161

Query  424  LGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +GVG P K  +MVLDTGSD+ W+QC PC +CY Q+DP+F+PS SS++  V C+S  C  L
Sbjct  162  VGVGKPAKQFYMVLDTGSDINWIQCEPCNECYQQSDPIFNPSGSSTYSPVTCESKQCSSL  221



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 92/143 (64%), Gaps = 5/143 (3%)
 Frame = +1

Query  187  DSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTL----SLLAAAAPPHNAT  354
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  ++    +L    A      
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVASIIAKVNLAVEGADSETRY  133

Query  355  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdp  534
               + ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY Q+DP
Sbjct  134  NPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDP  193

Query  535  vfdpsxsssfvGVKCDSPLCRRL  603
            +FDPS SS++  + C +P C  L
Sbjct  194  IFDPSSSSTYKSLTCSAPQCASL  216



>ref|XP_008340423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Malus domestica]
Length=547

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 92/147 (63%), Gaps = 13/147 (9%)
 Frame = +1

Query  193  GNTLSLDLHHIDLISSAAVN--------ATPKALFVKRLQRDAARAKTLS--LLAAAAPP  342
            G    + + H D +SS   N         + + LF  R++RDA R  +L+  LL  +   
Sbjct  115  GGKWKVKVVHRDKMSSQYSNRNGNGGSHTSHRHLFRARMKRDAKRVASLTRHLLNCS---  171

Query  343  HNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYA  522
            ++     DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY 
Sbjct  172  NSELESLDFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCTECYH  231

Query  523  QTdpvfdpsxsssfvGVKCDSPLCRRL  603
            Q+DP+FDP+ S+S+ GV C S LC RL
Sbjct  232  QSDPIFDPARSASYSGVSCASSLCGRL  258



>ref|XP_007043208.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
 gb|EOX99039.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
Length=481

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 102/178 (57%), Gaps = 8/178 (4%)
 Frame = +1

Query  91   DYQTLSLRP--LPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNA--T  258
            D+Q L+++   + T +   L +   + Q+     D G    L L H D + S    A   
Sbjct  29   DFQLLNVKQTLIGTKKPTPLKTFEYHEQSNASESDQGK-WKLKLVHRDKLFSNTTTAFHD  87

Query  259  PKALFVKRLQRDAARAKTLSLLAAAAPPHNATRG---RDFSSSVISGLAQGSGEYFTRLG  429
                F+ R+QRD  R  +L  L +    H+        DF S V+SG+ QGSGEYF R+G
Sbjct  88   HSHRFLARMQRDVKRVASLVRLLSGGGGHDGDAAYEVNDFGSDVVSGMDQGSGEYFVRIG  147

Query  430  VGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            VG+PP+  +MV+D+GSD+ W+QC PC +CY Q+DPVFDP+ S+S+ GV C S +C R+
Sbjct  148  VGSPPRSQYMVIDSGSDIVWVQCQPCNQCYRQSDPVFDPANSASYSGVSCTSSVCDRI  205



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 92/143 (64%), Gaps = 5/143 (3%)
 Frame = +1

Query  187  DSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTL----SLLAAAAPPHNAT  354
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   +    +L    A      
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAAIIAKVNLAVEGADSETRY  133

Query  355  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdp  534
            +  + ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY Q+DP
Sbjct  134  QPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDP  193

Query  535  vfdpsxsssfvGVKCDSPLCRRL  603
            +FDPS SS++  + C +P C  L
Sbjct  194  IFDPSSSSTYKSLTCSAPQCASL  216



>ref|XP_010908909.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=448

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 103/173 (60%), Gaps = 9/173 (5%)
 Frame = +1

Query  85   SLDYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPK  264
            ++D+Q L++  L        S+  Q S+T V      N  +L+L H D ISS    ++  
Sbjct  7    TIDFQYLNVHELLI----QTSNLHQLSKTHVH---KANKWALNLVHRDTISSRNY-SSHH  58

Query  265  ALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  444
              F + + RDA R   L+   AA+    A    DF S V+SGL +GSGEYF R+GVG+PP
Sbjct  59   HRFQELMNRDARRVAGLTRRLAASTGL-AYSSEDFGSEVVSGLEEGSGEYFVRVGVGSPP  117

Query  445  KYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +  +MV+D+GSD+ W+QC PC +CY Q DPVFDP+ S+SF  + CDS +C  L
Sbjct  118  REQYMVIDSGSDITWVQCQPCSQCYHQADPVFDPAQSASFYSIGCDSAVCGLL  170



>ref|XP_009398943.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 114/204 (56%), Gaps = 26/204 (13%)
 Frame = +1

Query  70   HPIFASLDYQTLSLRPLPTA---QHYSLSSKPQYSQTL---VQPDDSGNTLSLDLHHIDL  231
            HP   S  Y T +   + T+    H +LS +P  S  L   + P D  + +S+ LH  D 
Sbjct  30   HPEVQSTGYPTTATLDVSTSLAQAHLALSYRPPSSTELPSHLLPYDPSSAISVALHSRDF  89

Query  232  I-----SSAAVNATPKALFVKRLQRDAARAKTLSLLAAAA---------PPHNATRGRDF  369
            +     SSA  +   KAL + RL RD AR +++++ A  A          P+   +    
Sbjct  90   LPSFVGSSAHGHPDYKALTLARLFRDVARVRSIAVRATLAFGAVADSVLNPNTDVKALQI  149

Query  370  SS------SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTd  531
            ++      SVISG + GSGEYF+R+GVG+PPK  +M+LDTGSDV W+QC PC  CY Q+D
Sbjct  150  AAVNSIMGSVISGASMGSGEYFSRVGVGSPPKPLYMILDTGSDVSWVQCLPCADCYEQSD  209

Query  532  pvfdpsxsssfvGVKCDSPLCRRL  603
            PVFDPS SSS+  + CDS LC  L
Sbjct  210  PVFDPSDSSSYTLLSCDSSLCHSL  233



>ref|XP_010916474.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=512

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 101/153 (66%), Gaps = 22/153 (14%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATP---KALFVKRLQRDAARAKTLSL-LAAAAPPHNATR----  357
            L+L+LH  D + ++A +  P   K L + RL+RD+AR K+++  LA AA  H+  R    
Sbjct  82   LTLELHSRDFLPTSA-HPRPNDYKTLTLDRLRRDSARVKSIAAQLALAA--HSVKRTDLK  138

Query  358  ----GRDFSSS-------VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSP  504
                 ++F++S       ++SG +QGSGEYF+R+G+G PPK  +MVLDTGSDV W+QC P
Sbjct  139  PVAEEKEFAASAESIRGPIVSGTSQGSGEYFSRVGIGNPPKPLYMVLDTGSDVTWVQCQP  198

Query  505  CRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            C  CY Q+DP+FDPS SSS+  + CDSP CR L
Sbjct  199  CADCYEQSDPIFDPSASSSYSPLPCDSPRCRAL  231



>ref|XP_006485768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=495

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 92/151 (61%), Gaps = 11/151 (7%)
 Frame = +1

Query  181  PDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAA--------  336
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR  TL      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  337  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCR  510
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  511  KCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +CY Q+DP+FDP  SSS+  + C +P C+ L
Sbjct  192  ECYQQSDPIFDPKTSSSYSPLPCAAPQCKSL  222



>gb|KDO64536.1| hypothetical protein CISIN_1g011045mg [Citrus sinensis]
Length=495

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 92/151 (61%), Gaps = 11/151 (7%)
 Frame = +1

Query  181  PDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAA--------  336
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR  TL      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  337  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCR  510
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  511  KCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +CY Q+DP+FDP  SSS+  + C +P C+ L
Sbjct  192  ECYQQSDPIFDPKTSSSYSPLPCAAPQCKSL  222



>ref|XP_006440937.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
 gb|ESR54177.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
Length=495

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 92/151 (61%), Gaps = 11/151 (7%)
 Frame = +1

Query  181  PDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAA--------  336
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR  TL      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  337  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCR  510
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  511  KCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +CY Q+DP+FDP  SSS+  + C +P C+ L
Sbjct  192  ECYQQSDPIFDPKTSSSYSPLPCAAPQCKSL  222



>ref|XP_009385987.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 87/136 (64%), Gaps = 5/136 (4%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSS  375
            N LSL L H D +     +     L  + L+RD+ R  TL+   + A  H      DF S
Sbjct  51   NRLSLSLFHRDALPGRNFSGHRHRL-DRLLERDSRRVVTLTRRLSTARYHV----DDFGS  105

Query  376  SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxs  555
             V+SGL +GSGEYF R+GVG PP+  ++V+D+GSD+ W+QC PC +CYAQ++PVFDP+ S
Sbjct  106  EVVSGLEEGSGEYFVRVGVGVPPRDQYLVVDSGSDIVWIQCRPCSQCYAQSEPVFDPAES  165

Query  556  ssfvGVKCDSPLCRRL  603
            +SF GV C SP+C  L
Sbjct  166  ASFAGVACGSPICGLL  181



>ref|XP_003555824.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 101/182 (55%), Gaps = 6/182 (3%)
 Frame = +1

Query  70   HPIFASLDYQTLSLRPLPTAQHYSLSSKPQYSQ----TLVQPDDSGNTLSLDLHHIDLIS  237
            H I +   +Q L+++ + T    + ++  ++ Q     +     S     L L H D + 
Sbjct  18   HNIISYPHFQQLNVKQILTETKLNPTNTYKHLQHQKLNIATEASSPAKYKLKLVHRDKVP  77

Query  238  SAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYF  417
            +   +   +  F  R+QRD  R   L    AA  P  A     F S V+SG+ QGSGEYF
Sbjct  78   TFNTSHDHRTRFNARMQRDTKRVAALRRHLAAGKPTYAEEA--FGSDVVSGMEQGSGEYF  135

Query  418  TRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCR  597
             R+GVG+PP+  ++V+D+GSD+ W+QC PC +CY Q+DPVF+P+ SSS+ GV C S +C 
Sbjct  136  VRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCYHQSDPVFNPADSSSYAGVSCASTVCS  195

Query  598  RL  603
             +
Sbjct  196  HV  197



>ref|XP_007152794.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
 gb|ESW24788.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
Length=486

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 96/170 (56%), Gaps = 17/170 (10%)
 Frame = +1

Query  142  LSSKPQ--YSQTLVQPDD----SGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAAR  303
            LS KPQ  + QTL Q       S +  SL LH  + + +A  +   K L + RL RD+AR
Sbjct  45   LSFKPQQAFQQTLTQKQTPTSRSSSFFSLQLHTRETLFNAQ-HPDYKTLVLSRLARDSAR  103

Query  304  AKTLSLLAAAA----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  453
              +L      A          P     R  D S+ V SG +QGSGEYF+R+GVG P K  
Sbjct  104  VNSLETKLQLALNSVKRSELYPTQTEIRPEDLSTPVSSGTSQGSGEYFSRVGVGQPAKPF  163

Query  454  FMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            FMVLDTGSDV WLQC PC  CY QTDPVFDP+ SSS+  + CD+  C+ L
Sbjct  164  FMVLDTGSDVNWLQCKPCSDCYQQTDPVFDPTSSSSYYPLTCDAQQCQDL  213



>ref|XP_006406427.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
 gb|ESQ47880.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
Length=468

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 103/174 (59%), Gaps = 10/174 (6%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+Q + +   P +   +L   P ++ T   PD+S  TL L LH     S +  N   +  
Sbjct  26   DFQIIDVSQPPLSVTGTL---PDFNNTTF-PDESKYTLRL-LHRDKFPSVSYRNHHHR--  78

Query  271  FVKRLQRDAARAKTL--SLLAAAAPPHNAT-RGRDFSSSVISGLAQGSGEYFTRLGVGTP  441
               R++RD+ R   +   +   + PP N+     DF S V+SG+ QGSGEYF R+GVG+P
Sbjct  79   LHARMRRDSDRVAAILRRISGKSVPPSNSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSP  138

Query  442  PKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P+  +MV+D+GSD+ W+QC PC+ CY Q+DPVFDP+ S S+ GV C S +C R+
Sbjct  139  PRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRI  192



>ref|XP_006847790.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
 gb|ERN09371.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
Length=524

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 89/148 (60%), Gaps = 14/148 (9%)
 Frame = +1

Query  178  QPDDS--GNTLSLDLHHIDLISSAAVNATPKALFVKRLQRD----AARAKTLSLLAAAAP  339
            QP  S  GN L L L H D       +++ K  F  R++RD    AA AK L L      
Sbjct  108  QPSASKPGNLLRLKLLHRDSFKPTN-SSSHKHRFESRMRRDLLRVAALAKKLGL------  160

Query  340  PHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCY  519
              +  +  DF + V+SG+ QGSGEYF R+GVG+P +  FMV+DTGSD+ W+QC PC +CY
Sbjct  161  -ESGYKLTDFGAEVVSGMEQGSGEYFVRIGVGSPARDQFMVIDTGSDIVWVQCRPCLQCY  219

Query  520  AQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             Q DPVFDP+ S +F GV C S +C RL
Sbjct  220  QQADPVFDPAASETFAGVSCTSSVCSRL  247



>ref|XP_010541885.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Tarenaya hassleriana]
Length=188

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 75/109 (69%), Gaps = 1/109 (1%)
 Frame = +1

Query  280  RLQRDAARAKTLSL-LAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  456
            R++RD  R   +S  ++       +    DF S V+SG+ QGSGEYF R+GVG+PP+  +
Sbjct  80   RMRRDVERVTAVSRRISGKTAADKSYEIDDFGSDVVSGMDQGSGEYFVRIGVGSPPRNQY  139

Query  457  MVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            MV+D+GSD+ W+QC PC+ CY Q+DPVFDP+ S+S+ GV C S +C R+
Sbjct  140  MVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAESASYTGVSCGSSVCDRV  188



>ref|XP_004297710.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Fragaria 
vesca subsp. vesca]
Length=477

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 100/174 (57%), Gaps = 10/174 (6%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQ--PDDSGNTLSLDLHHIDLISSAAVNATPK  264
            D+Q L ++     Q  + +S   Y + L +      G    + + H D I   A  +  K
Sbjct  32   DFQQLHVK-----QTIAAASTKLYKEELKEDSSGSGGGRWRVKVVHRDKIFPQA--SHNK  84

Query  265  ALFVKRLQRDAARAKTL-SLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTP  441
            ++F  R+ RD  R  +L   L   +      +  DF S V+SG+AQGSGEYF R+GVG+P
Sbjct  85   SIFHARIHRDVKRVDSLMRRLGGNSNDQVMNKKLDFGSEVVSGMAQGSGEYFVRIGVGSP  144

Query  442  PKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             +  ++V+D+GSD+ W+QC PC +CY Q+DP+FDPS S+S+ GV C S +C RL
Sbjct  145  ARSQYVVIDSGSDIVWVQCQPCSQCYHQSDPIFDPSRSASYSGVSCTSTVCDRL  198



>ref|XP_010533981.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=502

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 90/158 (57%), Gaps = 20/158 (13%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALF  273
            +Q LSL P  T    +L+S+P      V  + S  + SL+LH  + +  +  +   ++L 
Sbjct  53   HQILSLDPSGT----TLTSRPDLKSKPVFLNSS--SFSLELHSRETLVESQ-HKDYRSLL  105

Query  274  VKRLQRDAARAKTLSLLAAAA----------PPHN---ATRGRDFSSSVISGLAQGSGEY  414
            + RL+RD+AR   ++     A          P H+     R  D S+ V+SG +QGSGEY
Sbjct  106  LGRLERDSARVSGITAKVRLAIEGVERSKLHPVHDDDSLIRPEDMSTPVVSGASQGSGEY  165

Query  415  FTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQT  528
            F+R+GVGTPPK  FMVLDTGSDV W+QC PC  CY Q+
Sbjct  166  FSRVGVGTPPKEMFMVLDTGSDVNWIQCQPCSDCYQQS  203



>ref|XP_010279486.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=483

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 102/177 (58%), Gaps = 6/177 (3%)
 Frame = +1

Query  85   SLDYQTLSLRPLPTAQHY---SLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNA  255
             +D+Q L++     A       + S  ++S++    D++     L L H D+IS    + 
Sbjct  28   GVDFQYLNVHETMVATRIRPSEIKSFQEFSES-NNGDEAEGRWKLKLVHRDMISLGNFSN  86

Query  256  TPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGV  432
                L  +R++RD  R  +L+   +         G  DF+S V+SG+ QGSGEYF R+GV
Sbjct  87   HRHHL-SERIKRDVRRVASLTRRLSGGGGGGVNYGVEDFASEVVSGVDQGSGEYFVRIGV  145

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            G+PP+  +MV+D+GSD+ W+QC PC +CY Q DPVFDP+ S++F GV C S +C  L
Sbjct  146  GSPPRNQYMVIDSGSDIVWVQCQPCNQCYRQLDPVFDPADSATFAGVACSSTVCGLL  202



>gb|KJB79793.1| hypothetical protein B456_013G067200 [Gossypium raimondii]
Length=475

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 91/153 (59%), Gaps = 11/153 (7%)
 Frame = +1

Query  172  LVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL------FVKRLQRDAARAKTLSLLAAA  333
            L + DD     +L L H D + S   N +   L      F  R+QRD  R  +L      
Sbjct  48   LSETDDHRGKWNLKLVHRDKLLSP--NDSLSTLHNHGRRFHARMQRDVKRVASLLRRLPG  105

Query  334  APPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSP  504
               H+   A +  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC P
Sbjct  106  KGTHDGDAAYQVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQP  165

Query  505  CRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            C +CY Q+DPVFDP+ S+SF GV C S +C R+
Sbjct  166  CNQCYRQSDPVFDPANSASFSGVSCGSSVCDRI  198



>ref|XP_008351877.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 100/173 (58%), Gaps = 18/173 (10%)
 Frame = +1

Query  133  HYSLSSKPQYSQTLV------QPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRD  294
            H  LS  P+  Q L       QP +S +  SL LH  D + ++  +   K+L + RL RD
Sbjct  44   HAVLSFDPESLQPLEXQSQESQPLNS-SAFSLQLHPRDXLFNSQ-HKDYKSLTLTRLGRD  101

Query  295  AARAKTLSLLAAAA----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  444
            +AR  +L      A          P H   + +D S+ V+SG++QGSGEYF+R+GV TP 
Sbjct  102  SARVNSLHTKLQLALQGIKRGDLEPMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVXTPA  161

Query  445  KYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            K  +MVLDTGSDV WLQC PC  CY Q+DP  +P+ SS++  + CD+P C+ L
Sbjct  162  KSFYMVLDTGSDVNWLQCGPCSDCYQQSDPXXNPAGSSTYSQLTCDAPQCQAL  214



>ref|XP_010036867.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Eucalyptus grandis]
Length=496

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 78/124 (63%), Gaps = 10/124 (8%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTL-SLLAAA---------APPHNATRGRDFSSSVISGLAQGSGE  411
            KAL + RL RD+AR   L S L  A          P     +  D S+ V+SG +QGSGE
Sbjct  99   KALVLARLGRDSARVDALASKLNLALNNVTRTDLTPLRTEIQPEDLSTPVVSGTSQGSGE  158

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YF+R+GVGTP K  +MVLDTGSDV WLQC PC  CY QTDPVF PS SSS+  + C+SP 
Sbjct  159  YFSRIGVGTPAKQFYMVLDTGSDVNWLQCQPCTDCYQQTDPVFTPSSSSSYTALTCESPQ  218

Query  592  CRRL  603
            C  L
Sbjct  219  CGSL  222



>emb|CBI35367.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +1

Query  280  RLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  459
            RL+RDA R  +L +   ++    + R  DF + VISG+ QGSGEYF R+GVG+PP+  +M
Sbjct  158  RLKRDAKRVASL-IRRLSSGGGGSYRVDDFGTDVISGMEQGSGEYFVRIGVGSPPRSQYM  216

Query  460  VLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            V+D+GSD+ W+QC PC +CY Q+DPVFDP+ S+SF GV C S +C RL
Sbjct  217  VIDSGSDIVWVQCQPCTQCYHQSDPVFDPADSASFTGVSCSSSVCDRL  264



>ref|XP_003637421.1| Aspartic proteinase nepenthesin-1, partial [Medicago truncatula]
Length=280

 Score =   100 bits (250),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 89/139 (64%), Gaps = 10/139 (7%)
 Frame = +1

Query  190  SGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRD-  366
            S +TLSL LH    +SS   +A  K+L + RL RD+AR K ++         N     D 
Sbjct  66   STSTLSLQLHSRASLSS---HADYKSLTLSRLDRDSARVKYITT------KLNQNFNTDK  116

Query  367  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdp  546
             S  +ISG +QGSGEYF+R+G+G PP  A+MVLDTGSD+ W+QC+PC  CY Q DP+F+P
Sbjct  117  LSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCYRQADPIFEP  176

Query  547  sxsssfvGVKCDSPLCRRL  603
            + S+S+  + C++  CR L
Sbjct  177  TASASYAPLSCEAAQCRYL  195



>ref|XP_002885351.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61610.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
Length=471

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 98/175 (56%), Gaps = 9/175 (5%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+Q++ +   P     +L   P ++ T    DDS +  +L L H D   S         L
Sbjct  26   DFQSIDVLQPPLTVTETL---PDFNNTHFS-DDSNSKYTLRLLHRDRFPSVTYRNHHHRL  81

Query  271  FVKRLQRDAARA----KTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  438
               R++RD  R     + +S     A   +     DF S V+SG+ QGSGEYF R+GVG+
Sbjct  82   HA-RMRRDTDRVSAILRRISGKVVVASSDSRYEVNDFGSDVVSGMDQGSGEYFVRIGVGS  140

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            PP+  +MV+D+GSD+ W+QC PC+ CY Q+DPVFDP+ S S+ GV C S +C R+
Sbjct  141  PPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRI  195



>ref|XP_009109887.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=482

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 102/180 (57%), Gaps = 24/180 (13%)
 Frame = +1

Query  106  SLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP----KALF  273
            S+R    A  + L+ + + S     P  S  + SL LH     S A+V  T      +L 
Sbjct  41   SIRKTKDASSFRLNQQEEQSH---YPTSS--SFSLQLH-----SRASVRGTEHPDYNSLT  90

Query  274  VKRLQRDAARAKTLSL--------LAAAAPPHN--ATRGRDFSSSVISGLAQGSGEYFTR  423
            + RL RD+ R K+L+         +  A   H    T   +  + +ISG  QGSGEYFTR
Sbjct  91   LARLHRDSTRVKSLTARLNLAINNITRANLKHTMYTTEQEEIEAPLISGTTQGSGEYFTR  150

Query  424  LGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +G+G+P +  +MVLDTGSDV WLQC+PC +CY QT+P+F+P+ SSS+  + CD+P C+ L
Sbjct  151  VGIGSPAREVYMVLDTGSDVNWLQCAPCAECYHQTEPIFEPTTSSSYATLSCDAPQCKAL  210



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 108/184 (59%), Gaps = 17/184 (9%)
 Frame = +1

Query  97   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSGNTLSLDLHHIDLISSAAVNATPKAL  270
            QT S+  L  ++    S++P+ S++L  P   +S + LSL+LH  D+   A+ +   K+L
Sbjct  45   QTQSILSLDPSRSSLTSTRPE-SESLFDPVFLNSSSPLSLELHSRDIFV-ASQHKDYKSL  102

Query  271  FVKRLQRDAARAKTL-------------SLLAAAAPPHNATRGRDFSSSVISGLAQGSGE  411
             + RL+RD++R   +             S L   +      +  D ++ V+SG +QGSGE
Sbjct  103  VLSRLERDSSRVNGIAAKVRFAVEGIDRSDLKPVSNEDTRYQPEDLTTPVVSGASQGSGE  162

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q+DPVF P+ SS++  + C +P 
Sbjct  163  YFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQSDPVFSPTSSSTYKSLTCAAPQ  222

Query  592  CRRL  603
            C  L
Sbjct  223  CSLL  226



>ref|XP_009607692.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=489

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 92/177 (52%), Gaps = 16/177 (9%)
 Frame = +1

Query  115  PLPTAQHYSLSSKPQYSQTLVQPD--------------DSGNTLSLDLHHIDLISSAAVN  252
            P P  +H+++    + S  +  P               + GN   L L H D +      
Sbjct  39   PFPIHEHFNVKQTIKESTRIHPPPSKTQGVAEEEEEFLEKGN-WKLKLLHRDKLPFPHFT  97

Query  253  ATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGV  432
              P  L   R++RD  R  TL         +N     +F S VISG+ QGSGEYF R+GV
Sbjct  98   DHPHRL-EARVKRDVKRVDTLIHKITGGNNNNVYEVEEFGSEVISGMEQGSGEYFVRIGV  156

Query  433  GTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            G+P +  +MV+D GSD+ W+QC PC  CY Q+DPVFDPS S+SF GV C S LC R+
Sbjct  157  GSPVREQYMVIDAGSDIVWVQCQPCTHCYHQSDPVFDPSLSASFSGVPCTSSLCERV  213



>ref|XP_008782298.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=513

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 91/151 (60%), Gaps = 18/151 (12%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAV--NATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRG-----  360
            L+L+LH  D + +AA   +   +AL + RL RD+AR K+++   A A  H   R      
Sbjct  80   LTLELHSRDFLPTAAQARHTDYRALTLARLHRDSARVKSIAARVALAA-HGVKRSDLKPL  138

Query  361  ----------RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCR  510
                      R     ++SG +QGSGEYF+R+G+G P K  +MVLDTGSDV W+QC PC 
Sbjct  139  AEEKELAASERAIKGPIVSGTSQGSGEYFSRVGIGNPAKPFYMVLDTGSDVTWVQCQPCT  198

Query  511  KCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             CY Q+DPVFDPS SSS+  + CDSP CR L
Sbjct  199  DCYQQSDPVFDPSASSSYSLLPCDSPRCRAL  229



>ref|XP_010103590.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXB96367.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=521

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 106/196 (54%), Gaps = 26/196 (13%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNT-----LSLDLHHIDLISSAAVNAT  258
            +Q L ++   +  +  L++  + +  + + DD G+        L L H D +SS   +  
Sbjct  50   FQDLDVKQTISGLNTKLTTPSEDATNVFEYDDLGSENGTRKWKLKLVHRDKLSSFTSSMN  109

Query  259  PK---------------ALFVKRLQRDAARAKTLSLLAAAAPPHNATRG------RDFSS  375
             K                +F +R++RDA R  +L    A +  ++   G       DF S
Sbjct  110  KKLDHNHNHNHDNDRHRRIFNERMKRDAHRVASLVRRLANSSNNSRISGSDKYEVEDFGS  169

Query  376  SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxs  555
             V+SG+ QGSGEYF R+GVG+P +  +MV+D+GSD+ W+QC PC +CY QTDPVFDP+ S
Sbjct  170  EVVSGMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCSQCYHQTDPVFDPADS  229

Query  556  ssfvGVKCDSPLCRRL  603
            +S+  V C S +C RL
Sbjct  230  ASYEFVSCSSAVCDRL  245



>ref|XP_002513132.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF49635.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=481

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 101/176 (57%), Gaps = 14/176 (8%)
 Frame = +1

Query  94   YQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL-  270
            +Q L+++   T    S     QY +     D+  +TL+     + L+    + A  K+  
Sbjct  38   FQLLNVKEAITETKAS-----QYQELF---DNQNDTLTEGKWKLKLVHRDKITAFNKSSY  89

Query  271  -----FVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVG  435
                 F  R+QRD  R  TL    +     ++    +F + V+SG+ QGSGEYF R+GVG
Sbjct  90   DHSHNFHARIQRDKKRVATLIRRLSPRDATSSYSVEEFGAEVVSGMNQGSGEYFIRIGVG  149

Query  436  TPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +PP+  ++V+D+GSD+ W+QC PC +CY QTDPVFDP+ S+SF+GV C S +C R+
Sbjct  150  SPPREQYVVIDSGSDIVWVQCQPCTQCYHQTDPVFDPADSASFMGVPCSSSVCERI  205



>ref|XP_009346910.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 98/161 (61%), Gaps = 11/161 (7%)
 Frame = +1

Query  151  KPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTL-SLLA  327
            KP  SQ+      + + LSL LH  D + ++  +   K+L   RL RD+AR  +L S L 
Sbjct  55   KPLESQSQESRPLNSSALSLQLHPRDALFNSQ-HKDYKSLTRTRLYRDSARVHSLHSKLQ  113

Query  328  AA---------APPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSD  480
             A          P H     +D S+ V+SG++QGSGEYF+R+GVGTP K  +MV DTGSD
Sbjct  114  LALQGIKKSDLEPMHAKILPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVPDTGSD  173

Query  481  VFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            V WLQC PC  CY Q+DPVF+P+ SSS+  + CD+P C+ L
Sbjct  174  VNWLQCDPCSDCYQQSDPVFNPAGSSSYSQLTCDAPQCQAL  214



>ref|XP_002970504.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
 gb|EFJ28634.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
Length=483

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 90/153 (59%), Gaps = 4/153 (3%)
 Frame = +1

Query  154  PQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNA--TPKALFVKRLQRDAARAKTLSLLA  327
            P  ++  + P D G TLSL+L H + +   A     T + L ++ LQRD  R + +   A
Sbjct  41   PVKNKLQLSPRD-GGTLSLELIHRNSLLREAKEKLHTHEQLLLETLQRDEQRVRWIESKA  99

Query  328  A-AAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSP  504
              A    +     D +  V SGL  GSGEYF RLGVGTP +  FMV+DTGSD+ WLQC P
Sbjct  100  QLAGKKKDEASSTDLNGPVTSGLLYGSGEYFVRLGVGTPARSLFMVVDTGSDLPWLQCQP  159

Query  505  CRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            C+ CY Q DP+FDP  SSSF  + C SPLC+ L
Sbjct  160  CKSCYKQADPIFDPRNSSSFQRIPCLSPLCKAL  192



>gb|EYU40681.1| hypothetical protein MIMGU_mgv1a005122mg [Erythranthe guttata]
Length=496

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 98/167 (59%), Gaps = 3/167 (2%)
 Frame = +1

Query  109  LRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLH--HIDLISSAAVNATPKALFVKR  282
            LRP  ++ H +       S+   +P  + N+ +  LH  H D ++  + +   +  F  R
Sbjct  55   LRPPQSSSHDTNHYAAVDSELTQKPTTNHNSTAAKLHLVHRDKLA-FSWHHDHRRRFESR  113

Query  283  LQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  462
            ++RDA R   L    +      A    DF S V+SG+ QGSGEYF R+GVG+P +  +MV
Sbjct  114  MKRDARRVGGLIRRLSGGGGAAAYEVADFGSEVVSGMDQGSGEYFVRIGVGSPARSQYMV  173

Query  463  LDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +D+GSD+ W+QC PC +CY Q+DPVFDP+ S+SF GV C S +C R+
Sbjct  174  IDSGSDIVWVQCQPCSQCYHQSDPVFDPADSASFTGVSCSSSVCDRV  220



>ref|XP_009760593.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=494

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 82/132 (62%), Gaps = 3/132 (2%)
 Frame = +1

Query  208  LDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVIS  387
            L L H D +  +   +    +F  R++RD  R  +L         +   R  +F S+VIS
Sbjct  90   LKLIHRDKLHFSNYFSNHSKMFEARMKRDIKRVSSLIHRITGGGVY---RVEEFGSNVIS  146

Query  388  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfv  567
            G+ QGSGEYF R+GVG+P +  +MV+D+GSD+ W+QC PC +CY Q+DPVFDPS S SF 
Sbjct  147  GMDQGSGEYFVRIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCYHQSDPVFDPSLSGSFA  206

Query  568  GVKCDSPLCRRL  603
            GV C S +C R+
Sbjct  207  GVSCGSSVCNRV  218



>ref|XP_008799310.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=507

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 93/155 (60%), Gaps = 26/155 (17%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATP-----KALFVKRLQRDAARAKTLSL-LAAAAPPHNATRG-  360
            L+L+LH  D + +   NA P     KAL + RL+RD+ R K+++  LA AA  H   R  
Sbjct  76   LTLELHSRDFLPT---NAQPRPTDYKALTLDRLRRDSTRVKSIAARLALAA--HGVKRSD  130

Query  361  --------------RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQC  498
                                ++SG +QGSGEYF+R+G+G+PPK  +MVLDTGSDV W QC
Sbjct  131  LKPVTEEEEFEASAEAIRGPIVSGTSQGSGEYFSRVGIGSPPKPLYMVLDTGSDVTWAQC  190

Query  499  SPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             PC  CY Q+DPVFDPS SSS+  + CDSP CR L
Sbjct  191  QPCADCYQQSDPVFDPSASSSYTPLPCDSPRCRAL  225



>ref|XP_008802841.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Phoenix 
dactylifera]
Length=470

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 74/106 (70%), Gaps = 7/106 (7%)
 Frame = +1

Query  280  RLQRDAARAK-TLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  456
            RL RD+ R    L  L A   P       DF S V+SGL +GSGEYF R+GVG+PPK  F
Sbjct  87   RLIRDSHRVSFLLRRLGAGYHPD------DFGSDVVSGLDEGSGEYFVRIGVGSPPKEQF  140

Query  457  MVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLC  594
            MV+D+GSD+ W+QC PC +CYAQ+DPVFDP+ S+SF G+ C SP+C
Sbjct  141  MVIDSGSDIVWVQCRPCTQCYAQSDPVFDPADSTSFAGISCKSPIC  186



>ref|XP_008446567.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=486

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 83/130 (64%), Gaps = 16/130 (12%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLSLLAAAA----------PPHNATRG------RDFSSSVISGL  393
            K+L + RL+RD+AR K+L+     A          P  N   G       DF S ++SG 
Sbjct  85   KSLTLSRLKRDSARVKSLTARIDLAIRGITGTDLEPLGNGDGGGSQFGAEDFESPIVSGA  144

Query  394  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGV  573
            +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY QTDP+F+P+ S+SF  +
Sbjct  145  SQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPIFEPTSSASFTSL  204

Query  574  KCDSPLCRRL  603
             C++  C+ L
Sbjct  205  SCETEQCKSL  214



>ref|XP_010935575.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=467

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 85/133 (64%), Gaps = 11/133 (8%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSS  375
            + LSLDL H D     ++     +    RL RD+ R   L  L      H      DF S
Sbjct  61   HKLSLDLLHRD-----SLPGRNHSTLHHRLIRDSHRVSFL--LRRLGGYHL----EDFGS  109

Query  376  SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxs  555
             V+SGL +GSGEYF R+G+G+PPK  FMV+D+GSD+ W+QC PC +CYAQ+DPVFDP+ S
Sbjct  110  DVVSGLDEGSGEYFVRIGLGSPPKEQFMVIDSGSDIVWVQCQPCTQCYAQSDPVFDPADS  169

Query  556  ssfvGVKCDSPLC  594
            +SF G+ C+SP+C
Sbjct  170  ASFAGISCNSPIC  182



>ref|XP_010487964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=470

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 99/175 (57%), Gaps = 11/175 (6%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+Q + +   P +   +L +   +S      DDS +  +L L H D   S +       L
Sbjct  27   DFQIIDVLQPPLSVTGTLLNDTHFS------DDSNSKHTLRLLHRDRFPSVSYRNHHHRL  80

Query  271  FVKRLQRDAARAKTLSLLAAAAPPHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGT  438
               R++RD  R   L    +     +++  R    DF S V+SG+ QGSGEYF R+GVG+
Sbjct  81   HA-RMRRDTDRVAALLRRISGKTVSSSSDARYEVDDFGSDVVSGMDQGSGEYFVRIGVGS  139

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            PP+  +MV+D+GSD+ W+QC PC+ CY Q+DPVFDP+ S S+ GV C S +C R+
Sbjct  140  PPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRV  194



>ref|XP_010477900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/164 (40%), Positives = 88/164 (54%), Gaps = 13/164 (8%)
 Frame = +1

Query  151  KPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSL---  321
             P   Q   Q + S +  SL LH    +     ++  K+L + RL RD AR K+L     
Sbjct  48   NPSSFQLNQQEEQSQSPFSLKLHSRASVRGGVEHSDYKSLTLARLDRDTARVKSLVTRLD  107

Query  322  ----------LAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDT  471
                      L         T   D  + +ISG  QGSGEYFTR+G+G P +  +MVLDT
Sbjct  108  LALNNISKADLKPVITTMYTTDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDT  167

Query  472  GSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            GSDV WLQC+PC  CY QT+P+F+P+ SSS+  + CD+  C+ L
Sbjct  168  GSDVNWLQCAPCADCYHQTEPIFEPASSSSYQPLSCDTSQCKAL  211



>ref|XP_004150193.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004170426.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
Length=476

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 78/111 (70%), Gaps = 3/111 (3%)
 Frame = +1

Query  271  FVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  450
            F +R+ RD+ R  +L  L ++      T   DF S V+SG  QGSGEYF R+GVG+PP+ 
Sbjct  93   FKERISRDSKRVSSLLRLLSSGSDEQVT---DFGSDVVSGTEQGSGEYFVRIGVGSPPRS  149

Query  451  AFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             ++V+D+GSD+ W+QC PC +CY Q+DPVFDP+ S+++ G+ CDS +C RL
Sbjct  150  QYVVIDSGSDIVWVQCQPCSECYQQSDPVFDPAGSATYAGISCDSSVCDRL  200



>ref|NP_173922.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50814.1|AC079281_16 hypothetical protein [Arabidopsis thaliana]
 gb|AAM20575.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15613.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00436.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30636.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=483

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 97/169 (57%), Gaps = 21/169 (12%)
 Frame = +1

Query  145  SSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP----KALFVKRLQRDAARAKT  312
            +S  + +Q   Q   + ++ SL LH     S  +V  T     K+L + RL RD AR K+
Sbjct  48   TSSFRLNQQEEQTHSASSSFSLQLH-----SRVSVRGTEHSDYKSLTLARLNRDTARVKS  102

Query  313  L---------SLLAAAAPPHNA---TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  456
            L         ++  A   P +    T  +D  + +ISG  QGSGEYFTR+G+G P +  +
Sbjct  103  LITRLDLAINNISKADLKPISTMYTTEEQDIEAPLISGTTQGSGEYFTRVGIGKPAREVY  162

Query  457  MVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            MVLDTGSDV WLQC+PC  CY QT+P+F+PS SSS+  + CD+P C  L
Sbjct  163  MVLDTGSDVNWLQCTPCADCYHQTEPIFEPSSSSSYEPLSCDTPQCNAL  211



>ref|XP_002275164.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=496

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/179 (41%), Positives = 99/179 (55%), Gaps = 16/179 (9%)
 Frame = +1

Query  112  RPLPTAQHYSLSSKP----QYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVK  279
            + L    H S  SKP        T   P    ++ SL+LH  +L+   + +   +AL + 
Sbjct  46   KTLDVLSHKSSVSKPSDQRDEKTTSFSPTSLASSFSLELHPRELLHGGS-HKDYRALMLS  104

Query  280  RLQRDAARAKTLSL---LAAAAPPHN--------ATRGRDFSSSVISGLAQGSGEYFTRL  426
            RL RD+AR K ++    LA +    +            +DFS+ V SG +QGSGEYF R+
Sbjct  105  RLARDSARVKAINTKLQLAVSGTDKSDLVPMDTEILHPQDFSTPVTSGTSQGSGEYFLRV  164

Query  427  GVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            G+G P K  +MV+DTGSDV WLQC PC  CY Q DP+FDP+ SSSF  + C +P CR L
Sbjct  165  GIGRPSKTFYMVIDTGSDVNWLQCKPCDDCYQQVDPIFDPASSSSFSRLGCQTPQCRNL  223



>ref|XP_010551288.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Tarenaya 
hassleriana]
Length=511

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/168 (43%), Positives = 102/168 (61%), Gaps = 18/168 (11%)
 Frame = +1

Query  139  SLSSKPQYSQTLVQPDDSG--NTLSLDLHHIDLISSAAVNATP----KALFVKRLQRDAA  300
            SLSSK    ++  Q +D    ++LSL LH     S A++        + L + RL+RD+A
Sbjct  77   SLSSKTTAFRSNKQEEDQFPPSSLSLKLH-----SRASIRGNEHRDYRTLTLARLERDSA  131

Query  301  RAKTLSL-----LAAAAPPHNATR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  459
            R ++L+      ++  +P    TR  G   +  V+SG +QGSGEYF+R+G+G PP+  +M
Sbjct  132  RVRSLTTRLDLAVSRVSPAALETRDGGAKINGPVVSGTSQGSGEYFSRVGIGNPPRQVYM  191

Query  460  VLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            VLDTGSDV WLQCSPC  CY Q+DP+FDP  SSS+  + C S  C+ L
Sbjct  192  VLDTGSDVNWLQCSPCADCYQQSDPLFDPLYSSSYSPLSCHSSECKAL  239



>ref|XP_004498098.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Cicer arietinum]
Length=465

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 94/170 (55%), Gaps = 25/170 (15%)
 Frame = +1

Query  121  PTAQHYSLSSK---PQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQR  291
            P+ QH  L  +   PQ+   L   D          H I+ I++A      K  F+ R++R
Sbjct  48   PSKQHSQLEKEQQQPQWKTKLFHRD----------HIINHINTAT---NHKTRFISRIKR  94

Query  292  DAARAKTLSLLAAAAPPH------NATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  453
            D  R   +S L      H        T    F S ++SG  +GSGEYF R+G+G+P  Y 
Sbjct  95   DIKR---VSFLHNRLNKHTQVTEQETTADTSFGSDIVSGSEEGSGEYFVRIGIGSPAIYQ  151

Query  454  FMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +MV+D+GSD+ W+QC PC +CY Q+DP+F+P+ S+SF+GV C S +C +L
Sbjct  152  YMVIDSGSDIVWIQCQPCHQCYNQSDPIFNPATSASFIGVSCSSSVCDQL  201



>ref|XP_010466176.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Camelina 
sativa]
Length=470

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 98/175 (56%), Gaps = 11/175 (6%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+Q + +   P +   +L +   +S      DDS +  +L L H D   S         L
Sbjct  27   DFQIIDVLQPPLSVTGTLLNDTHFS------DDSTSKYTLRLLHRDRFPSVTYRNHHHRL  80

Query  271  FVKRLQRDAARAKTLSLLAAAAPPHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGT  438
               R++RD  R   L    +     +++  R    DF S V+SG+ QGSGEYF R+GVG+
Sbjct  81   HA-RMRRDTDRVAALLRRISGKAVSSSSDARYEVDDFGSDVVSGMDQGSGEYFVRIGVGS  139

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            PP+  +MV+D+GSD+ W+QC PC+ CY Q+DPVFDP+ S S+ GV C S +C R+
Sbjct  140  PPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRV  194



>ref|XP_004498097.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Cicer arietinum]
Length=478

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 94/170 (55%), Gaps = 25/170 (15%)
 Frame = +1

Query  121  PTAQHYSLSSK---PQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQR  291
            P+ QH  L  +   PQ+   L   D          H I+ I++A      K  F+ R++R
Sbjct  48   PSKQHSQLEKEQQQPQWKTKLFHRD----------HIINHINTAT---NHKTRFISRIKR  94

Query  292  DAARAKTLSLLAAAAPPH------NATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  453
            D  R   +S L      H        T    F S ++SG  +GSGEYF R+G+G+P  Y 
Sbjct  95   DIKR---VSFLHNRLNKHTQVTEQETTADTSFGSDIVSGSEEGSGEYFVRIGIGSPAIYQ  151

Query  454  FMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +MV+D+GSD+ W+QC PC +CY Q+DP+F+P+ S+SF+GV C S +C +L
Sbjct  152  YMVIDSGSDIVWIQCQPCHQCYNQSDPIFNPATSASFIGVSCSSSVCDQL  201



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 95/152 (63%), Gaps = 14/152 (9%)
 Frame = +1

Query  187  DSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAA----------  336
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++     A          
Sbjct  74   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLK  132

Query  337  PPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPC  507
            P +N   + +  D ++ V+SG +QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  133  PVYNDETSYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  192

Query  508  RKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
              CY Q+DPVFDP+ SS+F  + C +P C  L
Sbjct  193  SDCYQQSDPVFDPASSSTFKSLSCSAPQCGSL  224



>gb|KEH44258.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=467

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 89/139 (64%), Gaps = 10/139 (7%)
 Frame = +1

Query  190  SGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRD-  366
            S +TLSL LH    +SS   +A  K+L + RL RD+AR K ++         N     D 
Sbjct  66   STSTLSLQLHSRASLSS---HADYKSLTLSRLDRDSARVKYIT------TKLNQNFNTDK  116

Query  367  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdp  546
             S  +ISG +QGSGEYF+R+G+G PP  A+MVLDTGSD+ W+QC+PC  CY Q DP+F+P
Sbjct  117  LSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCYRQADPIFEP  176

Query  547  sxsssfvGVKCDSPLCRRL  603
            + S+S+  + C++  CR L
Sbjct  177  TASASYAPLSCEAAQCRYL  195



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 94/152 (62%), Gaps = 14/152 (9%)
 Frame = +1

Query  187  DSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAA----------  336
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++     A          
Sbjct  76   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITTKIRFAVEGIDRSDLK  134

Query  337  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPC  507
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  135  PVYNDETLYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  194

Query  508  RKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
              CY Q+DPVFDP+ SS+F  + C +P C  L
Sbjct  195  SDCYQQSDPVFDPASSSTFKSLSCSAPQCGSL  226



>ref|XP_004157423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=491

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 93/156 (60%), Gaps = 11/156 (7%)
 Frame = +1

Query  166  QTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKT--------LSL  321
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+        LS 
Sbjct  64   QVHLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  122

Query  322  LAAA--APPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQ  495
            L  +   P        D S+ +ISG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  123  LKRSDLEPLKTEILPEDLSTPIISGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  182

Query  496  CSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            C PC  CY QTDP+FDP  SSSF  + C+S  C+ L
Sbjct  183  CQPCTDCYQQTDPIFDPRSSSSFASLPCESQQCQAL  218



>gb|KFK39328.1| hypothetical protein AALP_AA3G230300 [Arabis alpina]
Length=460

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 97/171 (57%), Gaps = 12/171 (7%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+Q + +   P        + P ++QT    D+S    +L L H D  SS         L
Sbjct  26   DFQIIDVLQQPPLSVSVTGTIPDFNQT---HDES----TLRLLHRDRFSSVTYRNHHHRL  78

Query  271  FVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  450
               R++RD AR   + L   +   +      DF S V+SG+ QGSGEYF R+GVG+PP+ 
Sbjct  79   HA-RMRRDTARVAAI-LRRISGTKYKVD---DFGSDVVSGMDQGSGEYFVRIGVGSPPRD  133

Query  451  AFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             +MV+D+GSD+ W+QC PC+ CY Q+DPVFDP+ S S+ GV C S +C R+
Sbjct  134  QYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRI  184



>ref|NP_188636.2| protein ASPARTIC PROTEASE IN GUARD CELL 2 [Arabidopsis thaliana]
 sp|Q9LHE3.1|ASPG2_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 2; Short=AtASPG2; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03167.1| nucleoid chloroplast DNA-binding protein-like [Arabidopsis thaliana]
 gb|AAO41867.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76319.1| protein aspartic protease in guard cell 2 [Arabidopsis thaliana]
Length=470

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 100/174 (57%), Gaps = 8/174 (5%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+Q + +   P     +L   P ++ T    D+S +  +L L H D   S         L
Sbjct  26   DFQIIDVLQPPLTVTATL---PDFNNTHFS-DESSSKYTLRLLHRDRFPSVTYRNHHHRL  81

Query  271  FVKRLQRDAAR-AKTLSLLAAAAPPHNATRGR--DFSSSVISGLAQGSGEYFTRLGVGTP  441
               R++RD  R +  L  ++    P + +R    DF S ++SG+ QGSGEYF R+GVG+P
Sbjct  82   HA-RMRRDTDRVSAILRRISGKVIPSSDSRYEVNDFGSDIVSGMDQGSGEYFVRIGVGSP  140

Query  442  PKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P+  +MV+D+GSD+ W+QC PC+ CY Q+DPVFDP+ S S+ GV C S +C R+
Sbjct  141  PRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRI  194



>ref|XP_004137465.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN64110.1| hypothetical protein Csa_1G042220 [Cucumis sativus]
Length=491

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 93/156 (60%), Gaps = 11/156 (7%)
 Frame = +1

Query  166  QTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKT--------LSL  321
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+        LS 
Sbjct  64   QVHLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  122

Query  322  LAAA--APPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQ  495
            L  +   P        D S+ +ISG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  123  LKRSDLEPLKTEILPEDLSTPIISGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  182

Query  496  CSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            C PC  CY QTDP+FDP  SSSF  + C+S  C+ L
Sbjct  183  CQPCTDCYQQTDPIFDPRSSSSFASLPCESQQCQAL  218



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 93/152 (61%), Gaps = 14/152 (9%)
 Frame = +1

Query  187  DSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAA----------  336
            +S + LSL LH  D +  A+ +   K+L + RL+RD++R   ++     A          
Sbjct  74   NSSSPLSLTLHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLK  132

Query  337  PPHN-ATR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPC  507
            P +N  TR    D ++ V+SG  QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  133  PVYNDETRYQTEDLTTPVVSGAGQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  192

Query  508  RKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
              CY Q+DP+FDP+ SS+F  + C +P C  L
Sbjct  193  SDCYQQSDPIFDPTSSSTFKSLTCSAPQCSSL  224



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 111/184 (60%), Gaps = 17/184 (9%)
 Frame = +1

Query  97   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSGNTLSLDLHHIDLISSAAVNATPKAL  270
            QT ++  L  A+    S++P+ S +L  P   +S + LSL+LH  D+   A+ +   K+L
Sbjct  45   QTQTILSLDPARSSFTSTRPE-SVSLSDPVFLNSSSPLSLELHSRDIFV-ASQHKDYKSL  102

Query  271  FVKRLQRDAARAKTLSLLAAAA----------PPHNAT---RGRDFSSSVISGLAQGSGE  411
             + RL+RD++R   ++     A          P +N     + ++ ++ V+SG +QGSGE
Sbjct  103  VLSRLERDSSRVAGIAAKIRFAVEGIDRSDLKPVYNEDTRYQTQELTTPVVSGASQGSGE  162

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q+DPVF+P+ SS++  + C +P 
Sbjct  163  YFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFNPTSSSTYKSLTCSAPQ  222

Query  592  CRRL  603
            C  L
Sbjct  223  CSLL  226



>ref|XP_011008360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=484

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 92/143 (64%), Gaps = 16/143 (11%)
 Frame = +1

Query  223  IDLISSAAVNATP----KALFVKRLQRDAARAKTL---------SLLAAAAPP---HNAT  354
            ++L+S  ++  T     K+L + RLQRD+AR K+L         S+ ++   P    +  
Sbjct  70   VELLSRTSIQKTTHTDYKSLTLSRLQRDSARVKSLVTRLDLAINSISSSDLKPLETDSEF  129

Query  355  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdp  534
            +  D  S +ISG +QGSGEYF+R+G+G PP  A+++LDTGSDV W+QC+PC +CY Q DP
Sbjct  130  KSEDLQSPIISGTSQGSGEYFSRVGIGKPPSQAYLILDTGSDVNWVQCAPCAECYQQADP  189

Query  535  vfdpsxsssfvGVKCDSPLCRRL  603
            +F+PS S+SF  + C++  CR L
Sbjct  190  IFEPSSSASFSTLSCNTRQCRSL  212



>ref|XP_006360843.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=479

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 89/163 (55%), Gaps = 11/163 (7%)
 Frame = +1

Query  142  LSSKPQ---------YSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRD  294
            L +KPQ         +    ++ ++    L L L H D +           +F  R+ RD
Sbjct  43   LDTKPQTPFENQEEFHVDNEIEQENGNWKLKLKLIHRDKLQIPHFPYNNNKVFEGRINRD  102

Query  295  AARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTG  474
              R    S++          R  +F S +ISG+ QGSGEYF R+GVG+P K  +MVLD+G
Sbjct  103  LKRVS--SIIHRIENGGVNYRVEEFGSDLISGMDQGSGEYFVRIGVGSPAKNQYMVLDSG  160

Query  475  SDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            SD+ W+QC PC +CY Q+DPVFDPS S SF GV C S +C R+
Sbjct  161  SDIVWVQCQPCTQCYHQSDPVFDPSLSVSFTGVPCGSSVCDRV  203



>ref|XP_004960076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=468

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 87/133 (65%), Gaps = 5/133 (4%)
 Frame = +1

Query  205  SLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVI  384
            SL + H D IS A   +   A+ + R+ RD ARA+ L+     +P +  T   D  S V+
Sbjct  61   SLAMVHRDAISGATYPSRRHAV-LDRVARDNARAEYLA--RRLSPTYLPTT--DLGSEVV  115

Query  385  SGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssf  564
            SGL +GSGEYF R+GVG+PP   ++V+D+GSDV W+QC PC +CYAQ DP+FDP+ S++F
Sbjct  116  SGLDEGSGEYFVRVGVGSPPTEQYLVVDSGSDVIWVQCKPCSQCYAQADPLFDPASSTTF  175

Query  565  vGVKCDSPLCRRL  603
              V C S +CR L
Sbjct  176  SAVSCGSAICRML  188



>ref|XP_009103072.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=487

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 104/183 (57%), Gaps = 25/183 (14%)
 Frame = +1

Query  106  SLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP----KALF  273
            S+R    A  + L+ + + S T   P  S ++ SL LH     S A+V        K+L 
Sbjct  41   SIRRTKGAPSFQLNQQEEQSHT---PSFSSSSFSLQLH-----SRASVQGNEHSDYKSLT  92

Query  274  VKRLQRDAARAKTL---------SLLAAAAPP----HNATRGRDFSSSVISGLAQGSGEY  414
            + RL RD+AR K+L         ++  A   P       T  ++  + +ISG  QGSGEY
Sbjct  93   LARLDRDSARVKSLMARLDLAVNNITKADLKPVITTMYTTEQQEIEAPLISGTTQGSGEY  152

Query  415  FTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLC  594
            FTR+G+G P +  +MVLDTGSDV WLQC+PC  CY QT+P+F+PS SSS+  + CD+P C
Sbjct  153  FTRVGIGNPAREVYMVLDTGSDVNWLQCAPCADCYHQTEPIFEPSSSSSYSTLSCDTPQC  212

Query  595  RRL  603
            + L
Sbjct  213  KAL  215



>ref|XP_008457107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=489

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 93/156 (60%), Gaps = 11/156 (7%)
 Frame = +1

Query  166  QTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKT--------LSL  321
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+        LS 
Sbjct  62   QVRLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  120

Query  322  LAAA--APPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQ  495
            L  +   P        D S+ ++SG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  121  LKRSDLEPLKTEILPEDLSTPIVSGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  180

Query  496  CSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            C PC  CY QTDP+FDP  SSSF  + C+S  C+ L
Sbjct  181  CQPCTDCYQQTDPIFDPRSSSSFASLPCESQQCQAL  216



>gb|ABR16474.1| unknown [Picea sitchensis]
Length=538

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 87/144 (60%), Gaps = 16/144 (11%)
 Frame = +1

Query  214  LHHIDLISSAAVNATPKALFVKRLQ----RDAARA--------KTLSLLAAAAPPHN--A  351
            +H   L+   A NAT  A + +RL+    RDA R         K L L    A  H   A
Sbjct  119  VHRDSLLVKDAANAT--ASYERRLEETLRRDARRVRGLEQRIEKRLRLNKDPAGSHENVA  176

Query  352  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTd  531
                +F   V+SG+AQGSGEYFTR+GVGTP +  +MVLDTGSDV W+QC PC KCY+Q D
Sbjct  177  EVAAEFGGEVVSGMAQGSGEYFTRIGVGTPMREQYMVLDTGSDVVWIQCEPCSKCYSQVD  236

Query  532  pvfdpsxsssfvGVKCDSPLCRRL  603
            P+F+PS S+SF  + C+S +C  L
Sbjct  237  PIFNPSLSASFSTLGCNSAVCSYL  260



>ref|XP_003520035.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 83/126 (66%), Gaps = 12/126 (10%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLSLL-------AAAAPPHNATRGRDFSSS-----VISGLAQGS  405
            K+L + RL RD+AR K+L           + +  H A    +F ++     V+SG +QGS
Sbjct  87   KSLTLSRLARDSARVKSLQTRLDLVLKRVSNSDLHPAESNAEFEANALQGPVVSGTSQGS  146

Query  406  GEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDS  585
            GEYF R+G+G PP  A++VLDTGSDV W+QC+PC +CY Q+DP+FDP  S+S+  ++CD+
Sbjct  147  GEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCAPCSECYQQSDPIFDPVSSNSYSPIRCDA  206

Query  586  PLCRRL  603
            P C+ L
Sbjct  207  PQCKSL  212



>ref|XP_003517994.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 81/126 (64%), Gaps = 12/126 (10%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLSLL-------AAAAPPHNATRGRDFSSS-----VISGLAQGS  405
            K+L + RL RD+AR K L           + +  H A    +F S+     V+SG +QGS
Sbjct  87   KSLTLSRLARDSARVKALQTRLDLFLKRVSNSDLHPAESKAEFESNALQGPVVSGTSQGS  146

Query  406  GEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDS  585
            GEYF R+G+G PP  A++VLDTGSDV W+QC+PC +CY Q+DP+FDP  S+S+  ++CD 
Sbjct  147  GEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCAPCSECYQQSDPIFDPISSNSYSPIRCDE  206

Query  586  PLCRRL  603
            P C+ L
Sbjct  207  PQCKSL  212



>ref|XP_002315953.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEF02124.1| aspartyl protease family protein [Populus trichocarpa]
Length=484

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 91/143 (64%), Gaps = 16/143 (11%)
 Frame = +1

Query  223  IDLISSAAVNATP----KALFVKRLQRDAARAKTL---------SLLAAAAPP---HNAT  354
            ++L+S  ++  T     K+L + RLQRD+AR K+L         S+ ++   P    +  
Sbjct  70   VELLSRTSIQKTTHTGYKSLTLSRLQRDSARVKSLVTRLDLAINSISSSDLKPLETDSEF  129

Query  355  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdp  534
            +  D  S +ISG +QGSGEYF+R+G+G PP  A+++LDTGSDV W+QC+PC  CY Q DP
Sbjct  130  KPEDLQSPIISGTSQGSGEYFSRVGIGKPPSQAYLILDTGSDVNWVQCAPCADCYQQADP  189

Query  535  vfdpsxsssfvGVKCDSPLCRRL  603
            +F+P+ S+SF  + C++  CR L
Sbjct  190  IFEPASSASFSTLSCNTRQCRSL  212



>emb|CDY51131.1| BnaA07g37140D [Brassica napus]
Length=436

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 99/170 (58%), Gaps = 20/170 (12%)
 Frame = +1

Query  106  SLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP----KALF  273
            S+R    A  + L+ + + S T   P  S ++ SL LH     S A+V        K+L 
Sbjct  41   SIRRTKGAPSFQLNQQEEQSHT---PSFSSSSFSLQLH-----SRASVQGNEHSDYKSLT  92

Query  274  VKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  453
            + RL RD+AR    ++          T  ++  + +ISG  QGSGEYFTR+G+G P +  
Sbjct  93   LARLDRDSARPVITTMYT--------TEQQEIEAPLISGTTQGSGEYFTRVGIGNPAREV  144

Query  454  FMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +MVLDTGSDV WLQC+PC  CY QT+P+F+PS SSS+  + CD+P C+ L
Sbjct  145  YMVLDTGSDVNWLQCAPCADCYHQTEPIFEPSSSSSYSTLSCDTPQCKAL  194



>ref|XP_004241622.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
lycopersicum]
Length=495

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 79/123 (64%), Gaps = 10/123 (8%)
 Frame = +1

Query  265  ALFVKRLQRDAARAKTLSLLAAAAPPHNATRGR----------DFSSSVISGLAQGSGEY  414
            +L + RL RD+AR  +L+ +   +P +     R          +F + +ISG +QGSGEY
Sbjct  100  SLTLSRLARDSARVSSLNAMLQLSPTNFTYSHRKSVRTMSGPGEFQTPLISGTSQGSGEY  159

Query  415  FTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLC  594
            F RLG+G P K  +MV+DTGSD+ WLQC PC  CY QTDP+F+PS SS++  V C+SP+C
Sbjct  160  FARLGIGEPAKEFYMVIDTGSDINWLQCEPCDVCYQQTDPIFNPSDSSTYNQVSCNSPVC  219

Query  595  RRL  603
              L
Sbjct  220  AAL  222



>dbj|BAK07248.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 103/180 (57%), Gaps = 21/180 (12%)
 Frame = +1

Query  112  RPLPTAQHYSLSSKPQYSQTLVQPDD-SGNTLSLDLHHIDLI-SSAAVNATPKALFVKRL  285
            RPL    H SL+S    +  LV+ +  SG  L+L LH  D +      + +  +L + RL
Sbjct  52   RPL---LHQSLASTD--TDALVKEEQRSGGKLALRLHSRDFLPEEQGRHESYSSLVLARL  106

Query  286  QRDAARAKTLS--------------LLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTR  423
            +RD+ARA  LS              L  A A P       +    V+SG+ QGSGEYF+R
Sbjct  107  RRDSARAAALSARASLAADGISRADLRPANATPVFEASAAEIQGPVVSGVGQGSGEYFSR  166

Query  424  LGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +GVG P +  +MVLDTGSDV WLQC PC  CYAQ+DPV+DPS S+S+  V CDSP CR L
Sbjct  167  VGVGRPARQLYMVLDTGSDVTWLQCQPCADCYAQSDPVYDPSVSTSYATVGCDSPRCRDL  226



>ref|XP_009145693.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=467

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 13/174 (7%)
 Frame = +1

Query  91   DYQTLS-LRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKA  267
            D+Q +  L+PL      +L   P ++ T    D+S  TL L   H D   S +       
Sbjct  28   DFQIIDVLQPLTVTGTGTL---PDFNNT----DESKYTLRL--LHRDRFPSVSYRNHHHR  78

Query  268  LFVKRLQRDAAR-AKTLSLLAAAAPPHNAT-RGRDFSSSVISGLAQGSGEYFTRLGVGTP  441
            L   RL+RD  R A  L  ++    P+ +     DF S V+SG+ QGSGEYF R+GVG+P
Sbjct  79   LHA-RLRRDTDRVAAILRRISGKTVPYGSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSP  137

Query  442  PKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            P+  +MV+D+GSD+ W+QC PC+ CY Q+DPVFDP+ S S+ GV C S +C R+
Sbjct  138  PRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRI  191



>ref|XP_010460347.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 85/146 (58%), Gaps = 12/146 (8%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTL---------SLLAAAAPPHNA-  351
             SL LH    +     ++  K+L + RL RD AR K+L         ++  A   P    
Sbjct  65   FSLKLHSRASVRGGVEHSDYKSLTLARLDRDTARVKSLVTRLDLALNNISKADLKPVTTM  124

Query  352  --TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQ  525
              T   D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV WLQCSPC  CY Q
Sbjct  125  YTTDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNWLQCSPCADCYHQ  184

Query  526  TdpvfdpsxsssfvGVKCDSPLCRRL  603
            T+P+F+P+ SSS+  + C++  C+ L
Sbjct  185  TEPIFEPASSSSYQPLSCETSQCKAL  210



>ref|XP_004172253.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=486

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 108/193 (56%), Gaps = 28/193 (15%)
 Frame = +1

Query  106  SLRPLPTAQHYSLSSKPQYSQTL--VQPDDSG---------NTLSLDLHHIDLISSAAVN  252
            +L P PT     +++  Q +Q +  V+P  S          ++LSL L+    +  A+ +
Sbjct  23   TLHPTPTTSVLDVAASIQRTQQVFAVEPKSSTPDETTVSDPSSLSLQLNSRISVMKAS-H  81

Query  253  ATPKALFVKRLQRDAARAKTLSL----------------LAAAAPPHNATRGRDFSSSVI  384
            +  K+L + RL+RD+AR ++L+                 L       +     DF S ++
Sbjct  82   SDYKSLTLSRLKRDSARVRSLTARIDLAIRGITGTDLEPLGNGGGGGSQFGTEDFESPIV  141

Query  385  SGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssf  564
            SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY QTDP F+P+ S+SF
Sbjct  142  SGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPXFEPTSSASF  201

Query  565  vGVKCDSPLCRRL  603
              + C++  C+ L
Sbjct  202  TSLSCETEQCKSL  214



>ref|XP_004135107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN52057.1| hypothetical protein Csa_5G608450 [Cucumis sativus]
Length=486

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 109/193 (56%), Gaps = 28/193 (15%)
 Frame = +1

Query  106  SLRPLPTAQHYSLSSKPQYSQTL--VQPDDSG---------NTLSLDLHHIDLISSAAVN  252
            +L P PT     +++  Q +Q +  V+P  S          ++LSL L+    +  A+ +
Sbjct  23   TLHPTPTTSVLDVAASIQRTQQVFAVEPKSSTPDETTVSDPSSLSLQLNSRISVMKAS-H  81

Query  253  ATPKALFVKRLQRDAARAKTLSL----------------LAAAAPPHNATRGRDFSSSVI  384
            +  K+L + RL+RD+AR ++L+                 L       +     DF S ++
Sbjct  82   SDYKSLTLSRLKRDSARVRSLTARIDLAIRGITGTDLEPLGNGGGGGSQFGTEDFESPIV  141

Query  385  SGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssf  564
            SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY QTDP+F+P+ S+SF
Sbjct  142  SGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPIFEPTSSASF  201

Query  565  vGVKCDSPLCRRL  603
              + C++  C+ L
Sbjct  202  TSLSCETEQCKSL  214



>ref|XP_009409187.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 90/155 (58%), Gaps = 17/155 (11%)
 Frame = +1

Query  190  SGNTLSLDLHHIDLISSAAVNATP--KALFVKRLQRDAARAKTLSLLAAAAPPHNATR--  357
            S   +SL  H  D + S+A +  P  KAL + RL+RDAAR ++++  AA A    A    
Sbjct  78   SAAAISLAFHSRDFLPSSAGHRHPDYKALTLARLRRDAARVRSIAARAALAVSGVAASDL  137

Query  358  -------------GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQC  498
                                V+SG + GSGEYF+R+GVG+P +  +MVLDTGSDV WLQC
Sbjct  138  KPVAEEKAAPIAAADSIEGPVVSGTSVGSGEYFSRVGVGSPARPFYMVLDTGSDVSWLQC  197

Query  499  SPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             PC  CY QTDPVFDPS SSS+  + CDS  CR L
Sbjct  198  LPCADCYQQTDPVFDPSASSSYAPISCDSSQCRSL  232



>ref|XP_010508355.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=471

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 97/175 (55%), Gaps = 11/175 (6%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+Q + +   P +   +L +   +S      DDS +  +L L H D   S         L
Sbjct  28   DFQIIDVLQPPLSVTGTLLNDTHFS------DDSTSKHTLRLLHRDRFPSVTYRNHHHRL  81

Query  271  FVKRLQRDAARAKTLSLLAAAAPPHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGT  438
               R++RD  R   L          +++  R    DF S V+SG+ QGSGEYF R+GVG+
Sbjct  82   HA-RMRRDTDRVAALLRRICGKAVSSSSDARYEVDDFGSDVVSGMDQGSGEYFVRIGVGS  140

Query  439  PPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            PP+  +MV+D+GSD+ W+QC PC+ CY Q+DPVFDP+ S S+ GV C S +C R+
Sbjct  141  PPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRV  195



>ref|XP_004238952.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=482

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 96/178 (54%), Gaps = 24/178 (13%)
 Frame = +1

Query  142  LSSKPQYSQTLVQPDDSGNTLSLDLHHI-------DLISSAAVNATP----KALFVKRLQ  288
            +SS  Q +  L   D S N+L  + + +        L S  AV  T      +L + RL+
Sbjct  32   VSSSIQKTHNLFSLDSSLNSLKHEENQVYSSLLSFQLHSRVAVQGTSHKDYDSLMLARLE  91

Query  289  RDAARAKTL-------------SLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLG  429
            RD+ARAK+L             S L          +  +    +ISG +QGSGEYF+R+G
Sbjct  92   RDSARAKSLQTRVDLVVQGIGKSDLKPMETEFREIQAEEIEGPIISGTSQGSGEYFSRIG  151

Query  430  VGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +G PP   +MVLDTGSDV W+QCSPC  CY Q DP+F+P+ SS+F  + C++  C+ L
Sbjct  152  IGHPPSQVYMVLDTGSDVNWVQCSPCADCYQQADPIFEPASSSTFSPLTCETQQCKSL  209



>ref|XP_008791252.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=469

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 84/133 (63%), Gaps = 1/133 (1%)
 Frame = +1

Query  205  SLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRDFSSSVI  384
            +L+L H D IS    ++     F + + RD+ R   L+   AA      +  +DF S V+
Sbjct  60   ALNLVHRDAISGRNYSSHHHR-FQELMNRDSRRVAGLTRRVAALTGLAYSSLQDFGSEVV  118

Query  385  SGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssf  564
            SGL +GSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY Q  PVFDP+ S++F
Sbjct  119  SGLEEGSGEYFVRVGVGSPPREQYMVIDSGSDITWVQCQPCSQCYHQAGPVFDPAQSTTF  178

Query  565  vGVKCDSPLCRRL  603
              V CDS +C  L
Sbjct  179  YNVGCDSTVCGLL  191



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 70/184 (38%), Positives = 112/184 (61%), Gaps = 17/184 (9%)
 Frame = +1

Query  97   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSGNTLSLDLHHIDLISSAAVNATPKAL  270
            QT ++  L  A+    S++P+ S +L  P   +S + LSL+LH  D++  A+ +   K+L
Sbjct  46   QTQTILSLDPARSSFTSTRPE-SVSLSDPVFLNSSSPLSLELHSRDILV-ASQHKDYKSL  103

Query  271  FVKRLQRDAARAKTLSLLAAAA----------PPHNAT---RGRDFSSSVISGLAQGSGE  411
             + RL+R+++R   ++     A          P +N     + ++ ++ V+SG +QGSGE
Sbjct  104  VLSRLERESSRVAGIAAKIQFAVEGIDRSDLKPVYNEDTRYQTQELTTPVVSGASQGSGE  163

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q+DPVF+P+ SS++  + C +P 
Sbjct  164  YFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQSDPVFNPTSSSTYKSLTCSAPQ  223

Query  592  CRRL  603
            C  L
Sbjct  224  CSLL  227



>emb|CAE05761.2| OSJNBa0064G10.12 [Oryza sativa Japonica Group]
Length=451

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 85/137 (62%), Gaps = 5/137 (4%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLS-LLAAAAPPHNATRGRDFS  372
            N  SL L H D IS  A   + +   V  + RD AR + L   L A+  P+      D  
Sbjct  61   NNPSLSLVHRDAIS-GATYPSRRHQVVGLVARDNARVEHLEKRLVASTSPYLP---EDLV  116

Query  373  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsx  552
            S V+ G+  GSGEYF R+GVG+PP   ++V+D+GSDV W+QC PC +CYAQTDP+FDP+ 
Sbjct  117  SEVVPGVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPLFDPAA  176

Query  553  sssfvGVKCDSPLCRRL  603
            SSSF GV C S +CR L
Sbjct  177  SSSFSGVSCGSAICRTL  193



>ref|NP_001054261.2| Os04g0677100 [Oryza sativa Japonica Group]
 dbj|BAF16175.2| Os04g0677100 [Oryza sativa Japonica Group]
Length=464

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 85/137 (62%), Gaps = 5/137 (4%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLS-LLAAAAPPHNATRGRDFS  372
            N  SL L H D IS  A   + +   V  + RD AR + L   L A+  P+      D  
Sbjct  61   NNPSLSLVHRDAIS-GATYPSRRHQVVGLVARDNARVEHLEKRLVASTSPYLP---EDLV  116

Query  373  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsx  552
            S V+ G+  GSGEYF R+GVG+PP   ++V+D+GSDV W+QC PC +CYAQTDP+FDP+ 
Sbjct  117  SEVVPGVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPLFDPAA  176

Query  553  sssfvGVKCDSPLCRRL  603
            SSSF GV C S +CR L
Sbjct  177  SSSFSGVSCGSAICRTL  193



>ref|XP_006362549.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=482

 Score = 99.4 bits (246),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 86/153 (56%), Gaps = 17/153 (11%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATP----KALFVKRLQRDAARAKTL-------------SLL  324
            N +S  L    L S  AV  T      +L + RL+RD+ARAK+L             S L
Sbjct  57   NQISSSLLSFQLHSRVAVRGTSHKDYNSLMLARLERDSARAKSLQTRVDLVVQGIGKSDL  116

Query  325  AAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSP  504
                      +  +    +ISG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QCSP
Sbjct  117  KPMETEFREIQAEEIEGPIISGTSQGSGEYFSRIGIGHPPSQVYMVLDTGSDVNWVQCSP  176

Query  505  CRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            C  CY Q DP+F+P+ SS+F  + C++  C+ L
Sbjct  177  CADCYQQADPIFEPASSSTFSPLTCETQQCKSL  209



>emb|CAJ86229.1| H0402C08.5 [Oryza sativa Indica Group]
 gb|EAY96049.1| hypothetical protein OsI_17922 [Oryza sativa Indica Group]
Length=473

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 85/137 (62%), Gaps = 5/137 (4%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLS-LLAAAAPPHNATRGRDFS  372
            N  SL L H D IS A    + +   V  + RD AR + L   L A+  P+      D  
Sbjct  61   NNPSLSLVHRDAISGATY-PSRRHQVVGLVARDNARVEHLEKRLVASTSPYLP---EDLV  116

Query  373  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsx  552
            S V+ G+  GSGEYF R+GVG+PP   ++V+D+GSDV W+QC PC +CYAQTDP+FDP+ 
Sbjct  117  SEVVPGVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPLFDPAA  176

Query  553  sssfvGVKCDSPLCRRL  603
            SSSF GV C S +CR L
Sbjct  177  SSSFSGVSCGSAICRTL  193



>ref|XP_006297584.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
 gb|EOA30482.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 103/178 (58%), Gaps = 14/178 (8%)
 Frame = +1

Query  91   DYQTLSLRPLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKAL  270
            D+Q + +   P +   +L +   +S      DDS +  +L L H D   S +       L
Sbjct  29   DFQIIDVLQPPLSVTSTLPNDTHFS------DDSNSKYTLRLLHRDRFPSVSYRNHHHRL  82

Query  271  FVKRLQRDAARAKTL-------SLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLG  429
               R++RD+ R  +L        + ++++   +  +  DF S V+SG+ QGSGEYF R+G
Sbjct  83   HA-RMRRDSDRVSSLLRRISGKVVSSSSSSSDSRYQVDDFGSDVVSGMDQGSGEYFVRIG  141

Query  430  VGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            VG+PP+  +MV+D+GSD+ W+QC PC+ CY Q+DPVFDP+ S S+ GV C S +C R+
Sbjct  142  VGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFDPAKSGSYTGVSCGSSVCDRV  199



>gb|EAZ32412.1| hypothetical protein OsJ_16623 [Oryza sativa Japonica Group]
Length=473

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 85/137 (62%), Gaps = 5/137 (4%)
 Frame = +1

Query  196  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLS-LLAAAAPPHNATRGRDFS  372
            N  SL L H D IS A    + +   V  + RD AR + L   L A+  P+      D  
Sbjct  61   NNPSLSLVHRDAISGATY-PSRRHQVVGLVARDNARVEHLEKRLVASTSPYLP---EDLV  116

Query  373  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsx  552
            S V+ G+  GSGEYF R+GVG+PP   ++V+D+GSDV W+QC PC +CYAQTDP+FDP+ 
Sbjct  117  SEVVPGVDDGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCEQCYAQTDPLFDPAA  176

Query  553  sssfvGVKCDSPLCRRL  603
            SSSF GV C S +CR L
Sbjct  177  SSSFSGVSCGSAICRTL  193



>ref|XP_010551158.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=495

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 74/126 (59%), Gaps = 14/126 (11%)
 Frame = +1

Query  190  SGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTL-------------SLLAA  330
            + ++ SL+LH  + +  +  +   ++L + RL+RD+AR   +             S L  
Sbjct  72   NASSFSLELHSRETLLESQ-HRDYRSLVLARLERDSARVAGIASKVRLAIEGVDRSKLQP  130

Query  331  AAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCR  510
            A       R  D S+ V+SG +QGSGEYF+R+GVGTPPK  FMVLDTGSDV W+QC PC 
Sbjct  131  AYDDDTRIRPEDLSTPVVSGASQGSGEYFSRIGVGTPPKDMFMVLDTGSDVNWIQCQPCS  190

Query  511  KCYAQT  528
             CY Q+
Sbjct  191  DCYQQS  196



>ref|XP_006354732.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=491

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 96/173 (55%), Gaps = 33/173 (19%)
 Frame = +1

Query  115  PLPTAQHYSLSSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRD  294
            PL ++  +S+S  P+ S  LV+P            H D  S          L + RL RD
Sbjct  69   PLYSSSAFSVSIYPRSS--LVKP-----------QHTDYTS----------LTLSRLARD  105

Query  295  AARAKTLSLLAAAAPPH----------NATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  444
            +AR  +L+ +   +P +            +   +F + +ISG +QGSGEYF RLGVG P 
Sbjct  106  SARVSSLNAMLQLSPTNFTYSHLKSVRTMSGLEEFQTPLISGSSQGSGEYFARLGVGEPA  165

Query  445  KYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            K  +M +DTGSD+ WLQC PC +CY QTDP+F+PS SS++  + CDSP+C  L
Sbjct  166  KEFYMAIDTGSDINWLQCEPCDECYQQTDPIFNPSDSSTYNQLSCDSPVCAAL  218



>ref|XP_007153018.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
 gb|ESW25012.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
Length=464

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 92/147 (63%), Gaps = 9/147 (6%)
 Frame = +1

Query  178  QPDD----SGNTLSLDLHHIDLISSAA-VNATPKALFVKRLQRDAARAKTLSLLAAAAPP  342
            +P+D     GN   + L H D IS A  +N + +  F +R++RDA R  ++    + A  
Sbjct  46   EPEDLEEKQGN-WKVQLLHRDKISKAPPMNHSTR--FNQRMKRDAKRVSSIVNKNSDART  102

Query  343  HNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYA  522
              A     F S V+SG+ +GSGEYF R+G+G+P  Y +MV+D+GSD+ W+QC PC  CY 
Sbjct  103  EAAEEA-SFGSDVVSGMEEGSGEYFVRIGIGSPATYQYMVIDSGSDIVWVQCQPCDLCYN  161

Query  523  QTdpvfdpsxsssfvGVKCDSPLCRRL  603
            Q+DP+F+P+ S+SF GV C S +C +L
Sbjct  162  QSDPIFNPALSASFAGVPCSSSVCDQL  188



>ref|XP_002965292.1| hypothetical protein SELMODRAFT_83230 [Selaginella moellendorffii]
 gb|EFJ34130.1| hypothetical protein SELMODRAFT_83230 [Selaginella moellendorffii]
Length=423

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 78/131 (60%), Gaps = 13/131 (10%)
 Frame = +1

Query  250  NATPKALFVKRLQRDAAR----AKTLSLLAAAAPPHNATR---------GRDFSSSVISG  390
            NAT   L   RL RD  R    +  +SL  A  P  + T           +DF + + SG
Sbjct  14   NATVHGLVRNRLHRDELRLLSISSRISLGVAGIPKSSLTNPLKNTNPFLQQDFETPLRSG  73

Query  391  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvG  570
            L+ GSGEYF  LGVGTPP+   MV DTGSDV WLQC PC+ CY QTDP+F+PS SS+F  
Sbjct  74   LSDGSGEYFVSLGVGTPPRTVNMVADTGSDVLWLQCLPCQSCYGQTDPLFNPSFSSTFQS  133

Query  571  VKCDSPLCRRL  603
            + C S LC++L
Sbjct  134  ITCGSSLCQQL  144



>ref|XP_002986620.1| hypothetical protein SELMODRAFT_124369 [Selaginella moellendorffii]
 gb|EFJ12477.1| hypothetical protein SELMODRAFT_124369 [Selaginella moellendorffii]
Length=423

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 78/131 (60%), Gaps = 13/131 (10%)
 Frame = +1

Query  250  NATPKALFVKRLQRDAAR----AKTLSLLAAAAPPHNATR---------GRDFSSSVISG  390
            NAT   L   RL RD  R    +  +SL  A  P  + T           +DF + + SG
Sbjct  14   NATVHGLVRNRLHRDELRLLSISSRISLGVAGIPKSSLTNPLKNTNPFLQQDFETPLRSG  73

Query  391  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvG  570
            L+ GSGEYF  LGVGTPP+   MV DTGSDV WLQC PC+ CY QTDP+F+PS SS+F  
Sbjct  74   LSDGSGEYFVSLGVGTPPRTVNMVADTGSDVLWLQCLPCQSCYGQTDPLFNPSFSSTFQS  133

Query  571  VKCDSPLCRRL  603
            + C S LC++L
Sbjct  134  ITCGSSLCQQL  144



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 109/184 (59%), Gaps = 17/184 (9%)
 Frame = +1

Query  97   QTLSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSGNTLSLDLHHIDLISSAAVNATPKAL  270
            QT ++  L  A+    S++P  S +L  P   +S + LSL+LH  D+   A+ +   K+L
Sbjct  45   QTQTILSLDPARSSFTSTRP-VSVSLSDPVFLNSSSPLSLELHSRDIFV-ASQHKDYKSL  102

Query  271  FVKRLQRDAARAKTLSLLAAAA----------PPHNAT---RGRDFSSSVISGLAQGSGE  411
             + RL+RD++R   ++     A          P  N     + ++ ++ V+SG +QGSGE
Sbjct  103  VLSRLERDSSRVSGIAAKIRFAVEGIDRSDLKPVDNEDTRYQTQELTTPVVSGASQGSGE  162

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q+DPVF+P+ SS++  + C +P 
Sbjct  163  YFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFNPTSSSTYKSLTCSAPQ  222

Query  592  CRRL  603
            C  L
Sbjct  223  CSLL  226



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 93/157 (59%), Gaps = 24/157 (15%)
 Frame = +1

Query  187  DSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRGRD  366
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   +     AA    A  G D
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGI-----AAKIRFAVEGID  128

Query  367  ------------------FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWL  492
                               ++ V+SG++QGSGEYF+R+GVGTP K  ++VLDTGSDV W+
Sbjct  129  RSDLKPVNNEDTRYQPEALTTPVVSGVSQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWI  188

Query  493  QCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            QC PC  CY Q+DPVF+P+ SS++  + C +P C  L
Sbjct  189  QCEPCSDCYQQSDPVFNPTSSSTYKSLTCSAPQCSLL  225



>ref|XP_010044282.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Eucalyptus grandis]
Length=495

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 14/128 (11%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLS---------LLAAAAPPHNATRGRD-----FSSSVISGLAQ  399
            ++L + RL+RD+AR K+L          +  +   P  A+  R+     F S V+SG +Q
Sbjct  96   RSLTLARLERDSARVKSLGARVDLAVDGIAKSDLKPLEASAEREIGAEGFESPVVSGTSQ  155

Query  400  GSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKC  579
            GSGEYF+RLGVG PP   +MV+DTGSDV W+QC+PC  CY Q DP+F+P+ S+SF  + C
Sbjct  156  GSGEYFSRLGVGDPPSQVYMVVDTGSDVNWVQCAPCADCYQQADPIFEPASSASFSPLSC  215

Query  580  DSPLCRRL  603
            D+  CR L
Sbjct  216  DTRQCRSL  223



>ref|XP_010265215.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nelumbo 
nucifera]
Length=494

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 81/132 (61%), Gaps = 22/132 (17%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLS------------------LLAAAAPPHNATRGRDFSSSVIS  387
            K L + RL+RDAAR ++L+                  L+  A  P +    +D    VIS
Sbjct  94   KTLTLARLKRDAARVRSLNTKVDLAVKGIKKSDLKPLLMENAVQPSS----KDLEGPVIS  149

Query  388  GLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfv  567
            G++QGSGEYF+RLG+G P K  +MV+DTGSDV W+QC+PC  CY Q DP+++PS SSS+ 
Sbjct  150  GMSQGSGEYFSRLGIGVPAKQLYMVIDTGSDVNWVQCAPCTDCYDQADPIYEPSSSSSYS  209

Query  568  GVKCDSPLCRRL  603
             + CDS  C+ L
Sbjct  210  PLSCDSEQCKSL  221



>gb|KCW86348.1| hypothetical protein EUGRSUZ_B03036 [Eucalyptus grandis]
Length=492

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 14/128 (11%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLS---------LLAAAAPPHNATRGRD-----FSSSVISGLAQ  399
            ++L + RL+RD+AR K+L          +  +   P  A+  R+     F S V+SG +Q
Sbjct  96   RSLTLARLERDSARVKSLGARVDLAVDGIAKSDLKPLEASAEREIGAEGFESPVVSGTSQ  155

Query  400  GSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKC  579
            GSGEYF+RLGVG PP   +MV+DTGSDV W+QC+PC  CY Q DP+F+P+ S+SF  + C
Sbjct  156  GSGEYFSRLGVGDPPSQVYMVVDTGSDVNWVQCAPCADCYQQADPIFEPASSASFSPLSC  215

Query  580  DSPLCRRL  603
            D+  CR L
Sbjct  216  DTRQCRSL  223



>ref|XP_010499100.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 89/158 (56%), Gaps = 21/158 (13%)
 Frame = +1

Query  178  QPDDSGNTLSLDLHHIDLISSAAVNATP----KALFVKRLQRDAARAKTL---------S  318
            Q + +    SL LH     S A+V        K+L + RL RD AR K+L         +
Sbjct  58   QEEQNQTPFSLKLH-----SRASVRGVEHSDYKSLTLARLDRDTARVKSLVTRLDLALNN  112

Query  319  LLAAAAPPHNA---TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFW  489
            +  A   P      T   D  + +ISG  QGSGEYFTR+G+G P +  +MVLDTGSDV W
Sbjct  113  ISKADLKPVTTMYTTDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVLDTGSDVNW  172

Query  490  LQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            LQC+PC  CY QT+P+F+P+ SSS+  + CD+  C+ L
Sbjct  173  LQCAPCADCYHQTEPIFEPASSSSYQPLSCDTSQCKAL  210



>gb|KFK44545.1| hypothetical protein AALP_AA1G270600 [Arabis alpina]
Length=485

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 79/126 (63%), Gaps = 12/126 (10%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTL---------SLLAAAAPP---HNATRGRDFSSSVISGLAQGS  405
            K+L + RL RD AR K+L         ++  A   P      T  ++  + +ISG  QGS
Sbjct  86   KSLTLARLNRDTARVKSLITRLDLALSNISQANLKPITTTTYTTEQEIEAPLISGTTQGS  145

Query  406  GEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDS  585
            GEYFTR+G+G P +  +MVLDTGSDV WLQC+PC  CY QT+P+++P+ SSS+  + CD+
Sbjct  146  GEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCSDCYHQTEPIYEPASSSSYTTLSCDT  205

Query  586  PLCRRL  603
            P C  L
Sbjct  206  PQCNAL  211



>gb|KDP20100.1| hypothetical protein JCGZ_05869 [Jatropha curcas]
Length=493

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 60/98 (61%), Gaps = 10/98 (10%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLSLLAAAA----------PPHNATRGRDFSSSVISGLAQGSGE  411
            K+L + RLQRD++R K ++     A          P     +  DFS+ V SG +QGSGE
Sbjct  97   KSLVLSRLQRDSSRVKAITTQVELAVNGISKNDLKPLVTEIQPEDFSTPVTSGTSQGSGE  156

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQ  525
            YF+R+GVG P K  +MVLDTGSD+ WLQC PC  CY Q
Sbjct  157  YFSRVGVGNPEKSFYMVLDTGSDITWLQCEPCSDCYQQ  194



>ref|XP_006306517.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
 gb|EOA39415.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
Length=482

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 78/126 (62%), Gaps = 12/126 (10%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTL---------SLLAAAAPPHNA---TRGRDFSSSVISGLAQGS  405
            K+L + RL RD AR K+L         ++  A   P      T   D  + +ISG  QGS
Sbjct  85   KSLTLARLDRDTARVKSLFTRLDLALNNISKADLKPVTTMYTTEQEDIEAPLISGTTQGS  144

Query  406  GEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDS  585
            GEYFTR+G+G P +  +MVLDTGSDV WLQC+PC  CY QT+P+F+P+ SSS+  + CD+
Sbjct  145  GEYFTRVGIGNPAREVYMVLDTGSDVNWLQCAPCADCYHQTEPIFEPASSSSYQSLSCDT  204

Query  586  PLCRRL  603
              C+ L
Sbjct  205  SQCKAL  210



>ref|XP_002890686.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66945.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 69/170 (41%), Positives = 93/170 (55%), Gaps = 22/170 (13%)
 Frame = +1

Query  145  SSKPQYSQTLVQPDDSGNTLSLDLHHIDLISSAAVNATP----KALFVKRLQRDAARAKT  312
            +S  + +Q   Q     ++ SL LH     S  +V  T     K+L + RL RD AR K+
Sbjct  50   TSSFRLNQQEEQTHSRSSSFSLQLH-----SRVSVRGTEHSDYKSLTLARLNRDTARVKS  104

Query  313  L-------------SLLAAAAPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  453
            L             + L      +  T   D  + +ISG  QGSGEYFTR+G+G P +  
Sbjct  105  LITRLDLAINNISKADLKPVTTMYTTTEEEDIEAPLISGTTQGSGEYFTRVGIGNPAREV  164

Query  454  FMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            +MVLDTGSDV WLQC+PC  CY QT+P+F+PS SSS+  + CD+P C  L
Sbjct  165  YMVLDTGSDVNWLQCTPCADCYHQTEPIFEPSSSSSYEPLSCDTPQCNAL  214



>ref|XP_010031370.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
Length=496

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 89/148 (60%), Gaps = 11/148 (7%)
 Frame = +1

Query  187  DSGNTLSLDLHHID-LISSAAVNATPKALFVKRLQRDAAR--------AKTLSLLAAAAP  339
            + G    L L H D L S+++   +    F  R+ RDA R        +  +++ +    
Sbjct  77   EHGGGYKLSLFHRDRLPSASSHGGSHSRRFQDRMNRDALRVAGVLRRLSGDVAVRSGGGA  136

Query  340  PHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCY  519
             + A    DF S V+SG+ QGSGEYF R+GVG+P +  +MV+D+GSD+ W+QC PC +CY
Sbjct  137  GYEAVE--DFGSDVVSGMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCNQCY  194

Query  520  AQTdpvfdpsxsssfvGVKCDSPLCRRL  603
             Q+DPVFDPS S+SF GV C S +C RL
Sbjct  195  RQSDPVFDPSASASFSGVPCGSTVCDRL  222



>gb|KDO70057.1| hypothetical protein CISIN_1g0117491mg, partial [Citrus sinensis]
Length=235

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 81/126 (64%), Gaps = 12/126 (10%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLSLLAAAAPPHNATR-------GRDFSSS-----VISGLAQGS  405
            K+L + RL+RD+AR ++LS     A    AT        G +F +      ++SG +QGS
Sbjct  88   KSLTLARLERDSARVRSLSARLDLAIRGIATSDLKPLDSGSEFEAEEIQGPIVSGSSQGS  147

Query  406  GEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDS  585
            GEYF+R+G+G PP   +MVLDTGSDV WLQC+PC  CY Q DP+F+P+ SSS+  + C++
Sbjct  148  GEYFSRVGIGKPPSQVYMVLDTGSDVNWLQCAPCADCYQQADPIFEPTSSSSYSPLTCNT  207

Query  586  PLCRRL  603
              C+ L
Sbjct  208  KQCQSL  213



>ref|XP_006653026.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=477

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 84/134 (63%), Gaps = 8/134 (6%)
 Frame = +1

Query  205  SLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTL-SLLAAAAPPHNATRGRDFSSSV  381
            SL L H D +S A    + +   +  + R  AR + L   LA+   P       D  S V
Sbjct  71   SLSLLHRDAVSGATY-PSRRHEVLGLVARGNARVEYLVKRLASTYLPE------DLGSDV  123

Query  382  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsss  561
            +SGL +GSGEYF R+GVG+PP   ++V+D+GSDV W+QC PC +CYAQTDP+FDP+ SSS
Sbjct  124  VSGLGEGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCDQCYAQTDPLFDPATSSS  183

Query  562  fvGVKCDSPLCRRL  603
            F GV C S +CR L
Sbjct  184  FSGVACGSAICRML  197



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 95/152 (63%), Gaps = 14/152 (9%)
 Frame = +1

Query  187  DSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAAR-AKTLSLLAAAA---------  336
            +S + LSL+LH  D    A+ +   K+L + RL+RD++R A  ++ +  A          
Sbjct  75   NSSSPLSLELHSRDTFV-ASQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLK  133

Query  337  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPC  507
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  134  PVYNEDTRYQTEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC  193

Query  508  RKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
              CY Q+DPVF+P+ SS++  + C +P C  L
Sbjct  194  ADCYQQSDPVFNPTSSSTYKSLTCSAPQCSLL  225



>gb|KDP29378.1| hypothetical protein JCGZ_18299 [Jatropha curcas]
Length=484

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 88/146 (60%), Gaps = 13/146 (9%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNAT---------  354
            ++++LH  + I   + +   K+L + RLQRD+AR ++L+          +T         
Sbjct  68   VTMELHSRNSIQKTS-HTDYKSLTLARLQRDSARVRSLTTRLDLVIQGFSTSDLKPLGSD  126

Query  355  ---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQ  525
               +  D    ++SG +QGSGEYF+R+G+G PP   ++VLDTGSDV WLQC+PC  CY Q
Sbjct  127  LEFKAEDLQGPIVSGTSQGSGEYFSRVGIGKPPSSVYLVLDTGSDVNWLQCAPCADCYQQ  186

Query  526  TdpvfdpsxsssfvGVKCDSPLCRRL  603
             DP+F+P+ S+S+  + CDS  C+ L
Sbjct  187  ADPIFEPASSTSYSPLTCDSKECKSL  212



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 92/157 (59%), Gaps = 24/157 (15%)
 Frame = +1

Query  187  DSGNTLSLDLHHIDLISSAAVNATPKALFVKRLQRDAARAKTLSLLAAAAPPHNATRG--  360
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   +     AA    A  G  
Sbjct  77   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGI-----AAKIRFAVEGID  130

Query  361  ----------------RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWL  492
                             D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+
Sbjct  131  RSDLKPVDIDETRFQPEDLTTPVVSGTSQGSGEYFSRIGVGTPAKEMYVVLDTGSDVNWI  190

Query  493  QCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            QC PC +CY Q+DP+FDP+ SS+F  + C  P C  L
Sbjct  191  QCLPCSECYQQSDPIFDPTSSSTFKSLTCSDPKCASL  227



>ref|XP_010926497.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Elaeis guineensis]
Length=508

 Score = 97.1 bits (240),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 89/150 (59%), Gaps = 16/150 (11%)
 Frame = +1

Query  202  LSLDLHHIDLISSAAV--NATPKALFVKRLQRDAARAKTLSL---LAA-----------A  333
             +L+LH  D + +AA   +   K L + RL RD+AR K+++    LAA           A
Sbjct  80   FTLELHSRDFLPTAAQARHTDYKTLTLARLHRDSARVKSIAARLALAAHGVKRSDLKPLA  139

Query  334  APPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRK  513
                 A   +     ++SG +QGSGEYF+R+G+G P K  +MVLDTGSDV W+QC PC  
Sbjct  140  EEKELAAMAQAIKGPIVSGTSQGSGEYFSRVGIGKPAKPLYMVLDTGSDVTWVQCQPCTD  199

Query  514  CYAQTdpvfdpsxsssfvGVKCDSPLCRRL  603
            CY Q+DPVF+PS SSS+  + CDSP C  L
Sbjct  200  CYQQSDPVFEPSASSSYSPLPCDSPRCHDL  229



>ref|XP_002511962.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF50631.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=495

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 78/124 (63%), Gaps = 10/124 (8%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLS-----LLAAAA-----PPHNATRGRDFSSSVISGLAQGSGE  411
            KAL + RL RD++R + ++     +L   +     P     + +D S+ V SG +QGSGE
Sbjct  99   KALVLSRLHRDSSRVQAITTRLQLILNGVSKSDLKPLQTEIQPQDLSTPVSSGTSQGSGE  158

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YFTR+GVG P K  +MVLDTGSD+ W+QC PC  CY Q+DP+F P+ SSS+  + CDS  
Sbjct  159  YFTRVGVGNPAKSYYMVLDTGSDINWIQCQPCSDCYQQSDPIFTPAASSSYSPLTCDSQQ  218

Query  592  CRRL  603
            C  L
Sbjct  219  CNSL  222



>ref|XP_004299230.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Fragaria 
vesca subsp. vesca]
Length=492

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 76/121 (63%), Gaps = 10/121 (8%)
 Frame = +1

Query  262  KALFVKRLQRDAARAKTLSL----------LAAAAPPHNATRGRDFSSSVISGLAQGSGE  411
            K+L + RL RD+AR  +L+            A   P     R    S+ V SG++ GSGE
Sbjct  96   KSLVLTRLGRDSARVNSLNTKLQLALQGVNRADLEPMQTEIRPEGLSTPVSSGISLGSGE  155

Query  412  YFTRLGVGTPPKYAFMVLDTGSDVFWLQCSPCRKCYAQTdpvfdpsxsssfvGVKCDSPL  591
            YFTR+GVG+P K  +MVLDTGSDV WLQC PC  CY Q+DP+F+P+ SS+F  + CD+P 
Sbjct  156  YFTRVGVGSPAKQFYMVLDTGSDVNWLQCQPCSDCYQQSDPIFNPTGSSTFRQLTCDAPQ  215

Query  592  C  594
            C
Sbjct  216  C  216



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370