BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045F06

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006347390.1|  PREDICTED: uncharacterized protein LOC102602040    162   7e-57   Solanum tuberosum [potatoes]
ref|XP_004241487.1|  PREDICTED: uncharacterized protein LOC101251098    159   6e-55   Solanum lycopersicum
ref|XP_009594854.1|  PREDICTED: testis-expressed sequence 2 prote...    143   2e-49   Nicotiana tomentosiformis
ref|XP_009594853.1|  PREDICTED: testis-expressed sequence 2 prote...    143   3e-49   Nicotiana tomentosiformis
ref|XP_009761973.1|  PREDICTED: uncharacterized protein LOC104214...    135   2e-47   Nicotiana sylvestris
ref|XP_009761972.1|  PREDICTED: uncharacterized protein LOC104214...    135   2e-47   Nicotiana sylvestris
ref|XP_009631470.1|  PREDICTED: testis-expressed sequence 2 prote...    128   2e-46   Nicotiana tomentosiformis
ref|XP_009631469.1|  PREDICTED: testis-expressed sequence 2 prote...    128   2e-46   Nicotiana tomentosiformis
ref|XP_011072097.1|  PREDICTED: uncharacterized protein LOC105157385    117   4e-46   
ref|XP_010317540.1|  PREDICTED: uncharacterized protein LOC101250...    120   3e-45   Solanum lycopersicum
ref|XP_009789860.1|  PREDICTED: uncharacterized protein LOC104237...    124   3e-45   Nicotiana sylvestris
ref|XP_009789863.1|  PREDICTED: uncharacterized protein LOC104237...    124   4e-45   Nicotiana sylvestris
gb|EPS62479.1|  hypothetical protein M569_12311                         108   8e-41   Genlisea aurea
ref|XP_006372281.1|  hypothetical protein POPTR_0018s14940g           92.0    3e-37   
ref|XP_006351568.1|  PREDICTED: uncharacterized protein LOC102588484  98.2    4e-37   
emb|CBI26392.3|  unnamed protein product                              94.0    5e-37   Vitis vinifera
ref|XP_010662020.1|  PREDICTED: testis-expressed sequence 2 prote...  94.0    5e-37   Vitis vinifera
ref|XP_011017543.1|  PREDICTED: uncharacterized protein LOC105120863  90.1    2e-36   Populus euphratica
ref|XP_010069545.1|  PREDICTED: uncharacterized protein LOC104456...    100   5e-36   Eucalyptus grandis [rose gum]
ref|XP_010069546.1|  PREDICTED: uncharacterized protein LOC104456...    100   6e-36   Eucalyptus grandis [rose gum]
gb|KDP46473.1|  hypothetical protein JCGZ_08445                       92.8    9e-36   Jatropha curcas
ref|XP_007022967.1|  Integral membrane protein conserved region (...  89.4    4e-35   
ref|XP_011046106.1|  PREDICTED: uncharacterized protein LOC105140810  91.7    6e-35   Populus euphratica
emb|CDY26213.1|  BnaA06g12040D                                        89.7    7e-35   Brassica napus [oilseed rape]
ref|XP_009149234.1|  PREDICTED: uncharacterized protein LOC103872560  89.7    8e-35   Brassica rapa
emb|CDX96454.1|  BnaA07g30650D                                        92.0    2e-34   
ref|XP_009105967.1|  PREDICTED: testis-expressed sequence 2 prote...  92.0    4e-34   Brassica rapa
ref|XP_010459394.1|  PREDICTED: testis-expressed sequence 2 prote...  88.2    5e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006306770.1|  hypothetical protein CARUB_v10008308mg           87.4    6e-34   Capsella rubella
emb|CDY19177.1|  BnaC05g13780D                                        85.9    7e-34   Brassica napus [oilseed rape]
ref|XP_006848627.1|  hypothetical protein AMTR_s00171p00040960        87.8    1e-33   
gb|KJB56355.1|  hypothetical protein B456_009G116400                  95.5    2e-33   Gossypium raimondii
gb|KJB56353.1|  hypothetical protein B456_009G116400                  95.9    2e-33   Gossypium raimondii
gb|KJB56354.1|  hypothetical protein B456_009G116400                  95.5    2e-33   Gossypium raimondii
ref|XP_002525667.1|  conserved hypothetical protein                   92.0    4e-33   Ricinus communis
ref|XP_010476945.1|  PREDICTED: uncharacterized protein LOC104756113  88.2    4e-33   Camelina sativa [gold-of-pleasure]
gb|KHG07655.1|  Testis-expressed sequence 2                           95.5    5e-33   Gossypium arboreum [tree cotton]
ref|XP_006416664.1|  hypothetical protein EUTSA_v10006829mg           91.3    7e-33   Eutrema salsugineum [saltwater cress]
ref|XP_006372649.1|  hypothetical protein POPTR_0017s03560g           92.8    8e-33   
ref|XP_010498158.1|  PREDICTED: uncharacterized protein LOC104775894  88.6    1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002888912.1|  hypothetical protein ARALYDRAFT_895179           88.6    3e-32   Arabidopsis lyrata subsp. lyrata
dbj|BAD94820.1|  hypothetical protein                                 87.8    3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177463.1|  putative integral membrane protein                  87.8    3e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDX72963.1|  BnaC06g34110D                                        92.0    4e-32   
ref|XP_010428228.1|  PREDICTED: testis-expressed sequence 2 prote...  88.2    2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010474308.1|  PREDICTED: testis-expressed sequence 2 prote...  87.8    5e-31   Camelina sativa [gold-of-pleasure]
emb|CDY21730.1|  BnaA09g44810D                                        88.2    8e-31   Brassica napus [oilseed rape]
ref|XP_009117641.1|  PREDICTED: uncharacterized protein LOC103842732  88.2    1e-30   Brassica rapa
emb|CDX81851.1|  BnaC08g37500D                                        87.8    2e-29   
emb|CDY66320.1|  BnaCnng50280D                                        88.6    3e-29   Brassica napus [oilseed rape]
ref|XP_006300617.1|  hypothetical protein CARUB_v10019838mg           84.7    6e-29   Capsella rubella
ref|XP_006300616.1|  hypothetical protein CARUB_v10019838mg           84.3    9e-29   
gb|KHG11075.1|  Testis-expressed sequence 2                           86.3    2e-28   Gossypium arboreum [tree cotton]
ref|XP_006478163.1|  PREDICTED: testis-expressed sequence 2 prote...  90.9    5e-28   Citrus sinensis [apfelsine]
gb|KDO56007.1|  hypothetical protein CISIN_1g003631mg                 90.9    7e-28   Citrus sinensis [apfelsine]
gb|KDO56010.1|  hypothetical protein CISIN_1g003631mg                 90.5    1e-27   Citrus sinensis [apfelsine]
gb|KDO56009.1|  hypothetical protein CISIN_1g003631mg                 90.5    1e-27   Citrus sinensis [apfelsine]
ref|XP_004301206.1|  PREDICTED: uncharacterized protein LOC101303523  89.4    2e-27   Fragaria vesca subsp. vesca
ref|XP_009789864.1|  PREDICTED: testis-expressed sequence 2 prote...  85.1    1e-23   Nicotiana sylvestris
ref|XP_004966560.1|  PREDICTED: testis-expressed sequence 2 prote...  84.3    2e-21   
ref|XP_004966559.1|  PREDICTED: testis-expressed sequence 2 prote...  84.3    2e-21   
ref|XP_004966561.1|  PREDICTED: testis-expressed sequence 2 prote...  84.0    2e-21   
ref|XP_010104942.1|  hypothetical protein L484_004290                 99.8    2e-20   Morus notabilis
ref|XP_010537536.1|  PREDICTED: testis-expressed sequence 2 protein   96.3    3e-19   Tarenaya hassleriana [spider flower]
emb|CDY48046.1|  BnaA02g16390D                                        96.3    3e-19   Brassica napus [oilseed rape]
ref|XP_008240431.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  95.9    4e-19   Prunus mume [ume]
ref|XP_007210364.1|  hypothetical protein PRUPE_ppa001510mg           95.9    5e-19   Prunus persica
emb|CDP18515.1|  unnamed protein product                              95.5    5e-19   Coffea canephora [robusta coffee]
ref|XP_010248365.1|  PREDICTED: uncharacterized protein LOC104591254  95.5    7e-19   Nelumbo nucifera [Indian lotus]
ref|XP_006390581.1|  hypothetical protein EUTSA_v10018153mg           94.0    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010662022.1|  PREDICTED: uncharacterized protein LOC100244...  94.0    2e-18   
gb|KFK41758.1|  hypothetical protein AALP_AA2G168400                  92.4    6e-18   Arabis alpina [alpine rockcress]
ref|NP_173224.2|  putative integral membrane protein conserved re...  92.0    1e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAF97262.1|AC034106_5  Strong similarity to a hypothetical pro...  91.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010687269.1|  PREDICTED: testis-expressed sequence 2 prote...  91.7    1e-17   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687270.1|  PREDICTED: testis-expressed sequence 2 prote...  91.3    1e-17   
ref|XP_009408154.1|  PREDICTED: uncharacterized protein LOC103990...  91.3    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006599669.1|  PREDICTED: uncharacterized protein LOC100812...  90.5    3e-17   Glycine max [soybeans]
gb|KHN24469.1|  Testis-expressed sequence 2 protein                   90.5    3e-17   Glycine soja [wild soybean]
ref|XP_010239262.1|  PREDICTED: testis-expressed sequence 2 prote...  90.5    3e-17   
ref|XP_010239258.1|  PREDICTED: testis-expressed sequence 2 prote...  90.5    3e-17   Brachypodium distachyon [annual false brome]
ref|XP_006599667.1|  PREDICTED: uncharacterized protein LOC100812...  90.5    3e-17   Glycine max [soybeans]
ref|XP_009127977.1|  PREDICTED: uncharacterized protein LOC103852830  90.1    4e-17   Brassica rapa
ref|XP_004512701.1|  PREDICTED: uncharacterized protein LOC101503...  89.7    5e-17   Cicer arietinum [garbanzo]
ref|XP_004512702.1|  PREDICTED: uncharacterized protein LOC101503...  89.7    6e-17   Cicer arietinum [garbanzo]
ref|XP_008802615.1|  PREDICTED: uncharacterized protein LOC103716408  89.4    7e-17   Phoenix dactylifera
ref|XP_002892968.1|  hypothetical protein ARALYDRAFT_889192           89.0    9e-17   Arabidopsis lyrata subsp. lyrata
ref|XP_004234314.1|  PREDICTED: testis-expressed sequence 2 prote...  88.6    1e-16   Solanum lycopersicum
ref|XP_007161563.1|  hypothetical protein PHAVU_001G080200g           88.6    2e-16   Phaseolus vulgaris [French bean]
ref|XP_010935611.1|  PREDICTED: testis-expressed sequence 2 prote...  88.2    2e-16   Elaeis guineensis
dbj|BAD23057.1|  unknown protein                                      88.2    2e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453085.1|  hypothetical protein SORBIDRAFT_04g038050        88.2    2e-16   
gb|EEC74285.1|  hypothetical protein OsI_09535                        87.8    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_004137541.1|  PREDICTED: uncharacterized protein LOC101209104  87.8    3e-16   Cucumis sativus [cucumbers]
ref|XP_004164497.1|  PREDICTED: uncharacterized LOC101209104          87.4    3e-16   
ref|XP_006649193.1|  PREDICTED: testis-expressed sequence 2 prote...  87.4    4e-16   Oryza brachyantha
ref|XP_004495486.1|  PREDICTED: testis-expressed sequence 2 prote...  87.4    4e-16   Cicer arietinum [garbanzo]
ref|XP_006587408.1|  PREDICTED: uncharacterized protein LOC100787...  87.4    4e-16   Glycine max [soybeans]
gb|KHM99770.1|  Testis-expressed sequence 2 protein                   87.4    4e-16   Glycine soja [wild soybean]
ref|XP_004954472.1|  PREDICTED: uncharacterized protein LOC101777078  87.0    4e-16   
ref|XP_003573002.1|  PREDICTED: testis-expressed sequence 2 prote...  87.0    4e-16   Brachypodium distachyon [annual false brome]
ref|XP_006587407.1|  PREDICTED: uncharacterized protein LOC100787...  87.0    5e-16   Glycine max [soybeans]
gb|KEH42874.1|  integral membrane protein, putative                   86.3    8e-16   Medicago truncatula
ref|XP_008645131.1|  PREDICTED: testis-expressed sequence 2 prote...  85.5    1e-15   Zea mays [maize]
ref|XP_008645130.1|  PREDICTED: testis-expressed sequence 2 prote...  85.5    1e-15   Zea mays [maize]
gb|KJB67990.1|  hypothetical protein B456_010G220600                  85.5    2e-15   Gossypium raimondii
ref|XP_003535400.1|  PREDICTED: uncharacterized protein LOC100816...  85.1    2e-15   Glycine max [soybeans]
gb|AFW63912.1|  hypothetical protein ZEAMMB73_732140                  85.1    2e-15   
gb|KEH26662.1|  integral membrane protein, putative                   84.7    2e-15   Medicago truncatula
ref|XP_009385248.1|  PREDICTED: uncharacterized protein LOC103972625  84.7    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002439079.1|  hypothetical protein SORBIDRAFT_10g031200        84.7    3e-15   Sorghum bicolor [broomcorn]
ref|XP_007152502.1|  hypothetical protein PHAVU_004G135600g           84.3    3e-15   Phaseolus vulgaris [French bean]
gb|EMT17801.1|  hypothetical protein F775_17825                       82.4    2e-14   
gb|EMS63454.1|  hypothetical protein TRIUR3_21249                     82.0    2e-14   Triticum urartu
ref|XP_008437259.1|  PREDICTED: uncharacterized protein LOC103482740  82.0    2e-14   Cucumis melo [Oriental melon]
ref|XP_010317541.1|  PREDICTED: testis-expressed sequence 2 prote...  80.9    5e-14   Solanum lycopersicum
dbj|BAK04177.1|  predicted protein                                    79.3    2e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT07633.1|  hypothetical protein F775_06998                       78.2    3e-13   
gb|EMS68899.1|  Testis-expressed sequence 2 protein                   78.2    3e-13   Triticum urartu
ref|XP_010419176.1|  PREDICTED: uncharacterized protein LOC104704851  74.3    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009408155.1|  PREDICTED: testis-expressed sequence 2 prote...  70.9    9e-11   
gb|AFW63911.1|  hypothetical protein ZEAMMB73_732140                  65.9    3e-10   
ref|NP_001145602.1|  uncharacterized protein LOC100279080             65.5    4e-10   
ref|XP_006589245.1|  PREDICTED: uncharacterized protein LOC100816...  65.9    4e-09   Glycine max [soybeans]
dbj|BAJ97472.1|  predicted protein                                    64.7    7e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001759215.1|  predicted protein                                44.3    4e-08   
ref|XP_002962707.1|  hypothetical protein SELMODRAFT_438325           60.5    2e-07   
ref|XP_002980385.1|  hypothetical protein SELMODRAFT_112533           60.5    2e-07   
ref|XP_001778334.1|  predicted protein                                54.3    2e-05   



>ref|XP_006347390.1| PREDICTED: uncharacterized protein LOC102602040 [Solanum tuberosum]
Length=832

 Score =   162 bits (410),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  260
            M    +VF+LGA+TV+ VEA   VFLIRWL+RR++REVDKAK    LSS    D S Y K
Sbjct  1    MLLLFIVFVLGAVTVIAVEAVGVVFLIRWLNRRVAREVDKAKPDGSLSSTGDFDFSLYLK  60

Query  261  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  437
            QGIVW+L+ E+IP+A PVDKA+ Q+KSKKE+LEV+P QK+A+IKDH L L ESDGS+ EI
Sbjct  61   QGIVWVLESERIPKALPVDKAVTQQKSKKEILEVTPTQKFAQIKDHHLVLTESDGSHVEI  120

Query  438  QLRGCTIAA  464
             L+GC IAA
Sbjct  121  PLKGCIIAA  129


 Score = 85.9 bits (211),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  458  CSVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
             +VSA+ LS+RKWAKRYPIK+E ++S  Y+GSR  YIYLET W+KE+WCK+LRLAS
Sbjct  128  AAVSASSLSTRKWAKRYPIKIECRASTSYEGSRILYIYLETCWEKEAWCKSLRLAS  183



>ref|XP_004241487.1| PREDICTED: uncharacterized protein LOC101251098 [Solanum lycopersicum]
Length=830

 Score =   159 bits (402),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  260
            M    +VF+LGA+TV+ +EA   V+LIRWL+RRL+REVDKAK    LSS    D S Y K
Sbjct  1    MLLLFIVFVLGAVTVIAIEAVCVVYLIRWLNRRLAREVDKAKPDGSLSSTEDFDFSLYLK  60

Query  261  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  437
            QG VW+L+ E+IP+A PVDKA+ Q+KSKKEVLEV+P QK+A+IKDH L   ESDGS+ EI
Sbjct  61   QGTVWVLESERIPKALPVDKAVTQQKSKKEVLEVTPTQKFAQIKDHHLVFTESDGSHVEI  120

Query  438  QLRGCTIAA  464
             L+GC IAA
Sbjct  121  PLKGCIIAA  129


 Score = 82.4 bits (202),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSA+ LS+RKWAKRYPIK+E ++S   +GSR  YIYLET W+KE+WCK+LRLAS
Sbjct  129  AVSASSLSTRKWAKRYPIKIECRASTSCEGSRILYIYLETCWEKEAWCKSLRLAS  183



>ref|XP_009594854.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Nicotiana tomentosiformis]
Length=826

 Score =   143 bits (361),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 7/127 (6%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  260
            M    +VF+LGA+TV+ VEA   V LIRWL+RR++REVDKAK   +       D S + K
Sbjct  1    MLLLFIVFVLGAVTVLAVEAVGVVLLIRWLNRRVAREVDKAKPDGDF------DFSLHQK  54

Query  261  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  437
            QGIVW+L+ E++P+A PVDKAL Q+K KKE+LEV+P QK+A+IKDH L L ESDGS+ EI
Sbjct  55   QGIVWVLESERLPKAFPVDKALKQQKVKKEILEVTPTQKFAQIKDHYLVLTESDGSHVEI  114

Query  438  QLRGCTI  458
             L+GC I
Sbjct  115  LLKGCMI  121


 Score = 79.3 bits (194),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAKRYPIK+ES++S +Y+GSR  Y YLET W+KE+WCK+LRLAS
Sbjct  132  RKWAKRYPIKIESRASTLYEGSRILYFYLETCWEKEAWCKSLRLAS  177



>ref|XP_009594853.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Nicotiana tomentosiformis]
Length=830

 Score =   143 bits (361),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 95/128 (74%), Gaps = 9/128 (7%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPG-LDPSYYN  257
            M    +VF+LGA+TV+ VEA   V LIRWL+RR++REVDKAK       P G  D S + 
Sbjct  1    MLLLFIVFVLGAVTVLAVEAVGVVLLIRWLNRRVAREVDKAK-------PDGDFDFSLHQ  53

Query  258  KQGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  434
            KQGIVW+L+ E++P+A PVDKAL Q+K KKE+LEV+P QK+A+IKDH L L ESDGS+ E
Sbjct  54   KQGIVWVLESERLPKAFPVDKALKQQKVKKEILEVTPTQKFAQIKDHYLVLTESDGSHVE  113

Query  435  IQLRGCTI  458
            I L+GC I
Sbjct  114  ILLKGCMI  121


 Score = 79.3 bits (194),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAKRYPIK+ES++S +Y+GSR  Y YLET W+KE+WCK+LRLAS
Sbjct  132  RKWAKRYPIKIESRASTLYEGSRILYFYLETCWEKEAWCKSLRLAS  177



>ref|XP_009761973.1| PREDICTED: uncharacterized protein LOC104214066 isoform X2 [Nicotiana 
sylvestris]
Length=827

 Score =   135 bits (340),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  260
            M    +VF+LGA+TV+ VEA   V LIRWL+RR++REVDKAK    LSS    D S + K
Sbjct  1    MLLLFIVFVLGAVTVLAVEAVGVVLLIRWLNRRVAREVDKAKPDGSLSSLEDFDFSLHQK  60

Query  261  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  437
            QGIVW+L+ E+IP+A P DKAL Q+K+KKE+LEV+P QK+A+IKDH L L ESDGS+ EI
Sbjct  61   QGIVWVLESERIPKAFPADKALKQQKAKKELLEVTPTQKFAQIKDHYLVLTESDGSHVEI  120

Query  438  QLRGCTI  458
             L+GC I
Sbjct  121  LLKGCII  127


 Score = 81.3 bits (199),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAKRYPIK+ES++S +Y+GSR  YIYLET W+KE+WCK+LRLAS
Sbjct  138  RKWAKRYPIKIESRASTLYEGSRILYIYLETCWEKEAWCKSLRLAS  183



>ref|XP_009761972.1| PREDICTED: uncharacterized protein LOC104214066 isoform X1 [Nicotiana 
sylvestris]
Length=831

 Score =   135 bits (339),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 1/127 (1%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  260
            M    +VF+LGA+TV+ VEA   V LIRWL+RR++REVDKAK    LSS    D S + K
Sbjct  1    MLLLFIVFVLGAVTVLAVEAVGVVLLIRWLNRRVAREVDKAKPDGSLSSLEDFDFSLHQK  60

Query  261  QGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  437
            QGIVW+L+ E+IP+A P DKAL Q+K+KKE+LEV+P QK+A+IKDH L L ESDGS+ EI
Sbjct  61   QGIVWVLESERIPKAFPADKALKQQKAKKELLEVTPTQKFAQIKDHYLVLTESDGSHVEI  120

Query  438  QLRGCTI  458
             L+GC I
Sbjct  121  LLKGCII  127


 Score = 81.3 bits (199),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAKRYPIK+ES++S +Y+GSR  YIYLET W+KE+WCK+LRLAS
Sbjct  138  RKWAKRYPIKIESRASTLYEGSRILYIYLETCWEKEAWCKSLRLAS  183



>ref|XP_009631470.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Nicotiana tomentosiformis]
Length=810

 Score =   128 bits (321),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDPSYYN  257
            M   + VF+LG +TV+ VEA   V LI    RRLSR+  K K + E L     +DPS+Y 
Sbjct  1    MMLMLTVFVLGGVTVLAVEAVGIVMLIWCFMRRLSRQGGKGKPTEESLPFAGDIDPSFYK  60

Query  258  KQGIVWILDLEKIPR-APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  434
            KQG VW+L+ E+IP+ + VDKA  Q+K++KE+LEV P+QK+ KIKDHSL L ESDGS TE
Sbjct  61   KQGKVWVLESERIPKVSNVDKATKQQKAQKEILEVIPVQKFGKIKDHSLILTESDGSRTE  120

Query  435  IQLRGC  452
            I L+GC
Sbjct  121  IPLKGC  126


 Score = 85.5 bits (210),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAK+YPIK+E+ +SAIYKGS  FYIYLETSW+KESWCKALRLAS
Sbjct  139  RKWAKKYPIKIENGASAIYKGSSMFYIYLETSWEKESWCKALRLAS  184



>ref|XP_009631469.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Nicotiana tomentosiformis]
Length=815

 Score =   128 bits (321),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 88/126 (70%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDPSYYN  257
            M   + VF+LG +TV+ VEA   V LI    RRLSR+  K K + E L     +DPS+Y 
Sbjct  1    MMLMLTVFVLGGVTVLAVEAVGIVMLIWCFMRRLSRQGGKGKPTEESLPFAGDIDPSFYK  60

Query  258  KQGIVWILDLEKIPR-APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  434
            KQG VW+L+ E+IP+ + VDKA  Q+K++KE+LEV P+QK+ KIKDHSL L ESDGS TE
Sbjct  61   KQGKVWVLESERIPKVSNVDKATKQQKAQKEILEVIPVQKFGKIKDHSLILTESDGSRTE  120

Query  435  IQLRGC  452
            I L+GC
Sbjct  121  IPLKGC  126


 Score = 85.5 bits (210),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAK+YPIK+E+ +SAIYKGS  FYIYLETSW+KESWCKALRLAS
Sbjct  139  RKWAKKYPIKIENGASAIYKGSSMFYIYLETSWEKESWCKALRLAS  184



>ref|XP_011072097.1| PREDICTED: uncharacterized protein LOC105157385 [Sesamum indicum]
 ref|XP_011072098.1| PREDICTED: uncharacterized protein LOC105157385 [Sesamum indicum]
Length=793

 Score =   117 bits (292),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 86/124 (69%), Gaps = 1/124 (1%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
             V  FI GALT+V +EA     LIR L+R++ RE  K+K +   SSP   + S Y KQG 
Sbjct  5    LVSAFITGALTIVIMEAVGLWILIRHLTRKVEREEIKSKAATSFSSPGEPNSSLYEKQGA  64

Query  270  VWILDLEKIPRAPV-DKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  446
            +W+L+ +K+P++ + DK   +++ +KE+LEV+P++KYA+I+DH L LLESDGS  +I L 
Sbjct  65   LWVLEPDKVPKSGLEDKVPTEQRRRKEILEVTPVRKYARIRDHYLILLESDGSCVQILLN  124

Query  447  GCTI  458
            GCTI
Sbjct  125  GCTI  128


 Score = 95.1 bits (235),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS T L+S+KWAKRYPIKVES+ SAIYKG +T YIYLETSW+KESWCKALRLAS
Sbjct  130  TVSGTSLASKKWAKRYPIKVESRDSAIYKGCKTIYIYLETSWEKESWCKALRLAS  184



>ref|XP_010317540.1| PREDICTED: uncharacterized protein LOC101250278 isoform X1 [Solanum 
lycopersicum]
Length=812

 Score =   120 bits (301),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 84/126 (67%), Gaps = 6/126 (5%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKV-SAELSSPPGLDPSYYN  257
            M   + VF+LG + V+ VEA      I WL RR    VDK K     LS    +DPS+YN
Sbjct  2    MIMMLAVFVLGGIFVLAVEAVGIAIFIWWLMRR----VDKGKQPQGSLSFAGDIDPSFYN  57

Query  258  KQGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  434
            KQGIVW+L+ E+I +A   DKA  Q K++KE+LEV P QK+ KIK+HSL L+ESDGS+TE
Sbjct  58   KQGIVWVLESERILKALNTDKATKQNKAQKEILEVIPSQKFGKIKNHSLILIESDGSHTE  117

Query  435  IQLRGC  452
            I L+GC
Sbjct  118  IPLKGC  123


 Score = 88.6 bits (218),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAKRYPIKVES +SA+YKGSR FY+YLETSW+KE+WCKALRLAS
Sbjct  136  RKWAKRYPIKVESGASAVYKGSRIFYLYLETSWEKEAWCKALRLAS  181



>ref|XP_009789860.1| PREDICTED: uncharacterized protein LOC104237408 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009789861.1| PREDICTED: uncharacterized protein LOC104237408 isoform X1 [Nicotiana 
sylvestris]
Length=819

 Score =   124 bits (310),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 87/126 (69%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDPSYYN  257
            M   + VF+LG +TV+ VEA   V LI    RR+SR V K K + E L     +DPS+Y 
Sbjct  1    MMLLLTVFVLGGVTVLAVEAVGIVILIWCFMRRVSRRVGKGKPTEESLPFAGDIDPSFYK  60

Query  258  KQGIVWILDLEKIPR-APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  434
            KQGIVW+L+ EKIP+ +  DKA  Q+K++KE+LEV P +K+ KIKDHSL L +SDGS TE
Sbjct  61   KQGIVWVLESEKIPKVSNGDKATKQQKAQKEMLEVIPARKFGKIKDHSLILTDSDGSRTE  120

Query  435  IQLRGC  452
            I L+GC
Sbjct  121  IPLKGC  126


 Score = 85.1 bits (209),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAK+YPIK+E+ +SAIYKGS  FYIYLETSW+KESWCKALRLAS
Sbjct  139  RKWAKKYPIKIENGASAIYKGSGIFYIYLETSWEKESWCKALRLAS  184



>ref|XP_009789863.1| PREDICTED: uncharacterized protein LOC104237408 isoform X2 [Nicotiana 
sylvestris]
Length=814

 Score =   124 bits (310),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 87/126 (69%), Gaps = 2/126 (2%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDPSYYN  257
            M   + VF+LG +TV+ VEA   V LI    RR+SR V K K + E L     +DPS+Y 
Sbjct  1    MMLLLTVFVLGGVTVLAVEAVGIVILIWCFMRRVSRRVGKGKPTEESLPFAGDIDPSFYK  60

Query  258  KQGIVWILDLEKIPR-APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  434
            KQGIVW+L+ EKIP+ +  DKA  Q+K++KE+LEV P +K+ KIKDHSL L +SDGS TE
Sbjct  61   KQGIVWVLESEKIPKVSNGDKATKQQKAQKEMLEVIPARKFGKIKDHSLILTDSDGSRTE  120

Query  435  IQLRGC  452
            I L+GC
Sbjct  121  IPLKGC  126


 Score = 85.1 bits (209),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAK+YPIK+E+ +SAIYKGS  FYIYLETSW+KESWCKALRLAS
Sbjct  139  RKWAKKYPIKIENGASAIYKGSGIFYIYLETSWEKESWCKALRLAS  184



>gb|EPS62479.1| hypothetical protein M569_12311 [Genlisea aurea]
Length=355

 Score =   108 bits (269),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 84/128 (66%), Gaps = 8/128 (6%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDK--AKVSAELSSPPGLDPSYYNKQ  263
             V  F+LGALTVV VE      LIR LSR+L R  D   A    +L+S   +D     KQ
Sbjct  6    LVTAFLLGALTVVAVELVMLGILIRRLSRKLERHDDTPPADSETDLTSSSAVD-----KQ  60

Query  264  GIVWILDLEKIPRAPV-DKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  440
            G +W+L+ EK+ ++ + DK   +++ +K+++EV+P++KYA++KDHSL LLESDGS+ +  
Sbjct  61   GFIWLLEPEKLLKSALQDKTTSERRKRKDIIEVTPVRKYARVKDHSLILLESDGSSVKFS  120

Query  441  LRGCTIAA  464
            L GCT+ A
Sbjct  121  LSGCTVVA  128


 Score = 86.3 bits (212),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 3/62 (5%)
 Frame = +2

Query  449  LYNCSVSATGLSS---RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  619
            L  C+V A   SS   RKWAKRYPIKVES +SA+YKGS+  YIYLET+W+KE+WCKALRL
Sbjct  121  LSGCTVVAVSSSSLSSRKWAKRYPIKVESNNSAVYKGSKIIYIYLETTWEKEAWCKALRL  180

Query  620  AS  625
            AS
Sbjct  181  AS  182



>ref|XP_006372281.1| hypothetical protein POPTR_0018s14940g [Populus trichocarpa]
 gb|ERP50078.1| hypothetical protein POPTR_0018s14940g [Populus trichocarpa]
Length=776

 Score = 92.0 bits (227),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 82/135 (61%), Gaps = 9/135 (7%)
 Frame = +3

Query  102  FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSP-PGLDPS---YY--NKQ  263
            F+ G LT+V ++A    F I+ L+R+    +   + ++  SSP   LDP    YY  NK+
Sbjct  12   FVSGLLTLVALQALGVYFFIKRLNRKT--HLQPQQQASHSSSPHQDLDPQQSLYYAFNKK  69

Query  264  GIVWILDLEKIP-RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  440
            GIVW+L+ +K+P   PV+K    +K K+E+LEV+PI+K+A IKD SL L +S GS+  I 
Sbjct  70   GIVWVLESDKVPGNWPVEKVPKDQKRKREILEVTPIRKHANIKDRSLILTDSGGSHRAIP  129

Query  441  LRGCTIAAFLQQACP  485
            L GC I A    + P
Sbjct  130  LTGCVIEAVSATSLP  144


 Score = 90.1 bits (222),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWA+R+PIKVESK+S IY  S+T +I+LETSW+KESWCKALRLAS
Sbjct  137  AVSATSLPSRKWAERFPIKVESKTSPIYNASKTVFIFLETSWEKESWCKALRLAS  191



>ref|XP_006351568.1| PREDICTED: uncharacterized protein LOC102588484 [Solanum tuberosum]
Length=815

 Score = 98.2 bits (243),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  458  CSVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
             +VSA+ LS+RKWAKRYPIKVES +SA+YKGSR FYIYLETSW+KE+WCKALRLAS
Sbjct  128  AAVSASSLSTRKWAKRYPIKVESGASAVYKGSRIFYIYLETSWEKEAWCKALRLAS  183


 Score = 83.6 bits (205),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
 Frame = +3

Query  246  SYYNKQGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  422
            S  ++QGIVW+L+ E+I +A   DKA  Q K++KE+LEV P QK+ KIK +SL L+ESDG
Sbjct  56   STTSRQGIVWVLESERILKALNTDKATKQHKAQKEILEVIPSQKFGKIKKNSLILIESDG  115

Query  423  SNTEIQLRGCTIAA  464
            S+TEI L+GC +AA
Sbjct  116  SHTEIPLKGCMVAA  129



>emb|CBI26392.3| unnamed protein product [Vitis vinifera]
Length=751

 Score = 94.0 bits (232),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  458  CSVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
             +VSAT L S+KWAK+YPIKVESK+  IY GS+TFY+YLETSW+KESWCKALRLAS
Sbjct  128  VAVSATDLPSKKWAKKYPIKVESKTLEIYNGSKTFYLYLETSWEKESWCKALRLAS  183


 Score = 87.8 bits (216),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 2/136 (1%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  260
            M+   + F+LGA T++ V+    + LI  L     ++ +   ++ +L     LD S Y K
Sbjct  2    MFTLFVGFLLGAFTILLVQVLGLLLLIGRLGHGRKQDSESPLLTRDLDLHQSLD-SAYKK  60

Query  261  QGIVWILDLEKIPRAP-VDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  437
            QG++WIL+ EK+P  P + K     K KKE+LEV P++KYA+IKD SL L ESDGS T I
Sbjct  61   QGVIWILEPEKVPTFPQIGKIQRDAKKKKEILEVFPMRKYARIKDRSLILTESDGSYTAI  120

Query  438  QLRGCTIAAFLQQACP  485
             L+GCTI A      P
Sbjct  121  PLKGCTIVAVSATDLP  136



>ref|XP_010662020.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Vitis vinifera]
Length=798

 Score = 94.0 bits (232),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  458  CSVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
             +VSAT L S+KWAK+YPIKVESK+  IY GS+TFY+YLETSW+KESWCKALRLAS
Sbjct  128  VAVSATDLPSKKWAKKYPIKVESKTLEIYNGSKTFYLYLETSWEKESWCKALRLAS  183


 Score = 87.8 bits (216),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 80/136 (59%), Gaps = 2/136 (1%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  260
            M+   + F+LGA T++ V+    + LI  L     ++ +   ++ +L     LD S Y K
Sbjct  2    MFTLFVGFLLGAFTILLVQVLGLLLLIGRLGHGRKQDSESPLLTRDLDLHQSLD-SAYKK  60

Query  261  QGIVWILDLEKIPRAP-VDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  437
            QG++WIL+ EK+P  P + K     K KKE+LEV P++KYA+IKD SL L ESDGS T I
Sbjct  61   QGVIWILEPEKVPTFPQIGKIQRDAKKKKEILEVFPMRKYARIKDRSLILTESDGSYTAI  120

Query  438  QLRGCTIAAFLQQACP  485
             L+GCTI A      P
Sbjct  121  PLKGCTIVAVSATDLP  136



>ref|XP_011017543.1| PREDICTED: uncharacterized protein LOC105120863 [Populus euphratica]
 ref|XP_011017544.1| PREDICTED: uncharacterized protein LOC105120863 [Populus euphratica]
 ref|XP_011017545.1| PREDICTED: uncharacterized protein LOC105120863 [Populus euphratica]
Length=797

 Score = 90.1 bits (222),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 81/135 (60%), Gaps = 9/135 (7%)
 Frame = +3

Query  102  FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSP-PGLDPS---YY--NKQ  263
            F+ G LT+V ++A    F I+ L+R+    +   + ++  SSP   LDP    YY  NK+
Sbjct  12   FLSGLLTLVALQALGVYFFIKRLNRKT--HLQPQQQASHSSSPHQDLDPQQSLYYAFNKK  69

Query  264  GIVWILDLEKIP-RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  440
            GIVW+L+ +K+P   P +K    +K K+E+LEV+PI+K+A IKD SL L +S GS+  I 
Sbjct  70   GIVWVLESDKVPGNWPAEKVPKDQKRKREILEVTPIRKHANIKDRSLILTDSGGSHRAIP  129

Query  441  LRGCTIAAFLQQACP  485
            L GC I A    + P
Sbjct  130  LTGCVIEAVSATSLP  144


 Score = 89.7 bits (221),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWA R+PIKVESK+S IY  S+T +I+LETSW+KESWCKALRLAS
Sbjct  137  AVSATSLPSRKWAARFPIKVESKTSPIYNASKTVFIFLETSWEKESWCKALRLAS  191



>ref|XP_010069545.1| PREDICTED: uncharacterized protein LOC104456447 isoform X1 [Eucalyptus 
grandis]
 gb|KCW57933.1| hypothetical protein EUGRSUZ_H00671 [Eucalyptus grandis]
Length=783

 Score =   100 bits (250),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWAKRYPIK+ESKSSAIYKGS+ FYIYL+TSW+KESWCKALRLAS
Sbjct  131  AVSATDLPSRKWAKRYPIKLESKSSAIYKGSKVFYIYLDTSWEKESWCKALRLAS  185


 Score = 77.8 bits (190),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +3

Query  246  SYYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  425
            S   KQG VWIL+ E++P+  V+K   ++K KK+  E+SP++K+A IKDHSL L E+DGS
Sbjct  59   SLRRKQGDVWILEPERVPKNRVEKVQREQKKKKDFFEISPVRKHAIIKDHSLILTEADGS  118

Query  426  NTEIQLRGCTIAAFLQQACP  485
             + + L+GC I A      P
Sbjct  119  PSAVLLKGCVIEAVSATDLP  138



>ref|XP_010069546.1| PREDICTED: uncharacterized protein LOC104456447 isoform X2 [Eucalyptus 
grandis]
 gb|KCW57932.1| hypothetical protein EUGRSUZ_H00671 [Eucalyptus grandis]
Length=781

 Score =   100 bits (249),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 47/55 (85%), Positives = 52/55 (95%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWAKRYPIK+ESKSSAIYKGS+ FYIYL+TSW+KESWCKALRLAS
Sbjct  131  AVSATDLPSRKWAKRYPIKLESKSSAIYKGSKVFYIYLDTSWEKESWCKALRLAS  185


 Score = 77.8 bits (190),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +3

Query  246  SYYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  425
            S   KQG VWIL+ E++P+  V+K   ++K KK+  E+SP++K+A IKDHSL L E+DGS
Sbjct  59   SLRRKQGDVWILEPERVPKNRVEKVQREQKKKKDFFEISPVRKHAIIKDHSLILTEADGS  118

Query  426  NTEIQLRGCTIAAFLQQACP  485
             + + L+GC I A      P
Sbjct  119  PSAVLLKGCVIEAVSATDLP  138



>gb|KDP46473.1| hypothetical protein JCGZ_08445 [Jatropha curcas]
Length=788

 Score = 92.8 bits (229),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWAKR+PIKVESK+S IY  S+T YIYL+TSW+KESWCKALRLAS
Sbjct  130  AVSATDLPSRKWAKRFPIKVESKTSVIYNASKTIYIYLDTSWEKESWCKALRLAS  184


 Score = 84.7 bits (208),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 80/138 (58%), Gaps = 4/138 (3%)
 Frame = +3

Query  81   MWQFVLVFI---LGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY  251
            MW  ++ F     GAL VV  EA      I+ L++++ +E  K+    +L     LD +Y
Sbjct  1    MWWLLVFFCGFSFGALAVVAFEALGVYVFIKRLNQKIRKEEHKSSSHEDLDPHQSLDYAY  60

Query  252  YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNT  431
             NK+G+VW+L+ +K+P+  + +   ++  KK+  EV+P+++ A+IKD SL L +SDGS+ 
Sbjct  61   -NKKGVVWVLESDKLPKNWLAEKAPKEPKKKKFFEVNPVKRNARIKDRSLILTDSDGSHA  119

Query  432  EIQLRGCTIAAFLQQACP  485
             I L+ CTI A      P
Sbjct  120  TIPLKSCTIDAVSATDLP  137



>ref|XP_007022967.1| Integral membrane protein conserved region (DUF2404), putative 
[Theobroma cacao]
 gb|EOY25589.1| Integral membrane protein conserved region (DUF2404), putative 
[Theobroma cacao]
Length=761

 Score = 89.4 bits (220),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWAK++PIK+E+++S IYKGS+  Y++LETSW+KESWCKALRLAS
Sbjct  121  AVSATNLPSRKWAKKFPIKMENQTSLIYKGSKIVYLFLETSWEKESWCKALRLAS  175


 Score = 85.9 bits (211),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 79/133 (59%), Gaps = 10/133 (8%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
            F++   +G L +V VEA   +F++  L+R++ +E D A    +L +   LD +Y +KQGI
Sbjct  5    FIVGLFVGVLAIVSVEALGVLFVLNRLNRKIKKESD-ATQHPKLQTQQPLDFAY-SKQGI  62

Query  270  VWILDLEKIP-RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  446
            VW+L+ EK+P R P       K+ K+ +LEVSP +K+ KI+ +SL L  SD S T I L+
Sbjct  63   VWVLEPEKVPPREP-------KRKKELLLEVSPSRKHGKIEGNSLILTHSDASRTTIPLK  115

Query  447  GCTIAAFLQQACP  485
            GC I A      P
Sbjct  116  GCVIEAVSATNLP  128



>ref|XP_011046106.1| PREDICTED: uncharacterized protein LOC105140810 [Populus euphratica]
Length=791

 Score = 91.7 bits (226),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 49/55 (89%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWAKR+PIKVESK+S IY  S+T +I+LETSW+KESWCKALRLAS
Sbjct  138  AVSATSLPSRKWAKRFPIKVESKTSPIYNASKTVFIFLETSWEKESWCKALRLAS  192


 Score = 83.2 bits (204),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 83/145 (57%), Gaps = 10/145 (7%)
 Frame = +3

Query  81   MWQFVLVF----ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPS  248
            MW  V++F    + G LT+V ++A     LI+ L+R+  ++      S+ L     LDP 
Sbjct  1    MWPVVVIFAGGFLSGLLTLVALQALGVYVLIKRLNRKTQQQHASHSYSSSLPHHQDLDPQ  60

Query  249  Y-----YNKQGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLL  410
                  +NK+G VW+LD +K+ +  PV+K    +K KKE+LEV+PI+K AKIK  SL L 
Sbjct  61   QSLDYAHNKKGYVWVLDSDKVLKNWPVEKVPKDQKKKKELLEVTPIRKQAKIKGSSLILT  120

Query  411  ESDGSNTEIQLRGCTIAAFLQQACP  485
            +S GS+  I L+GC I A    + P
Sbjct  121  DSGGSHRVIPLKGCAIEAVSATSLP  145



>emb|CDY26213.1| BnaA06g12040D [Brassica napus]
Length=779

 Score = 89.7 bits (221),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSA-IYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS + L +RKWAKR+PIKVESKSS+ +YKG++ FYIYLETSW+KESWCKALRLA+
Sbjct  133  AVSGSDLPTRKWAKRFPIKVESKSSSDVYKGNKVFYIYLETSWEKESWCKALRLAA  188


 Score = 85.1 bits (209),  Expect(2) = 7e-35, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 76/126 (60%), Gaps = 2/126 (2%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
            F+  F LG + V+G EAA  ++L+  L+R+    VD +K  ++ S+    +    NKQG 
Sbjct  9    FLSGFFLGIVAVLGAEAAGLMYLLNRLNRKSETRVD-SKPGSDQSTKEISNSRESNKQGT  67

Query  270  VWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  446
            +W+L+L E +     +K   + K K+  LE+ PI+K+A+IKDH L L ESDG+ T + L+
Sbjct  68   IWVLELDEGLKNLWKEKLPTEHKRKRAFLEIHPIRKFARIKDHKLILSESDGTMTTVSLK  127

Query  447  GCTIAA  464
             C++ A
Sbjct  128  CCSVEA  133



>ref|XP_009149234.1| PREDICTED: uncharacterized protein LOC103872560 [Brassica rapa]
Length=779

 Score = 89.7 bits (221),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSA-IYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS + L +RKWAKR+PIKVESKSS+ +YKG++ FYIYLETSW+KESWCKALRLA+
Sbjct  133  AVSGSDLPTRKWAKRFPIKVESKSSSDVYKGNKVFYIYLETSWEKESWCKALRLAA  188


 Score = 84.7 bits (208),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 76/126 (60%), Gaps = 2/126 (2%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
            F+  F LG + V+G EAA  ++L+  L+R+    VD +K  ++ S+    +    NKQG 
Sbjct  9    FLSGFFLGIVAVLGAEAAGLMYLLNRLNRKSETRVD-SKPGSDQSTKEISNSRESNKQGT  67

Query  270  VWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  446
            +W+L+L E +     +K   + K K+  LE+ PI+K+A+IKDH L L ESDG+ T + L+
Sbjct  68   IWVLELDEGLKNLWKEKLPTEHKRKRAFLEIHPIRKFARIKDHKLILSESDGTMTTVSLK  127

Query  447  GCTIAA  464
             C++ A
Sbjct  128  CCSVEA  133



>emb|CDX96454.1| BnaA07g30650D [Brassica napus]
Length=745

 Score = 92.0 bits (227),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS + L +RKWAKR+PI+VESK+S +YKG+R FYIYLETSW+KESWCKALRLA+
Sbjct  129  AVSGSQLPTRKWAKRFPIQVESKTSNLYKGNRVFYIYLETSWEKESWCKALRLAA  183


 Score = 81.3 bits (199),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 82/139 (59%), Gaps = 18/139 (13%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYN--KQ  263
            FV  F+LG L VV  E AA ++L++ L+R+     D    +++ S PP L+P  +N  KQ
Sbjct  9    FVTGFLLGLLAVVAAEVAAFLYLVKRLNRKQESSSDP---TSKGSDPPPLEPIDFNLNKQ  65

Query  264  GIVWILDL-----EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSN  428
            G++W+L+L     EK+P+        + K + + LEV P++K+A+IKDH L L ++D + 
Sbjct  66   GVIWVLELDESLKEKLPK--------ETKKRNDHLEVHPVRKFARIKDHKLILTDTDSNK  117

Query  429  TEIQLRGCTIAAFLQQACP  485
            T I L+GC++ A      P
Sbjct  118  TVITLKGCSVEAVSGSQLP  136



>ref|XP_009105967.1| PREDICTED: testis-expressed sequence 2 protein-like [Brassica 
rapa]
Length=744

 Score = 92.0 bits (227),  Expect(2) = 4e-34, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS + L +RKWAKR+PI+VESK+S +YKG+R FYIYLETSW+KESWCKALRLA+
Sbjct  129  AVSGSQLPTRKWAKRFPIQVESKTSDLYKGNRVFYIYLETSWEKESWCKALRLAA  183


 Score = 80.1 bits (196),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 82/139 (59%), Gaps = 18/139 (13%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYN--KQ  263
            FV  F+LG L VV  E AA ++L++ L+R+     D    +++ S PP L+P  +N  KQ
Sbjct  9    FVTGFLLGLLAVVAAEVAAFLYLVKRLNRKQESSSDP---TSKGSDPPPLEPIDFNLNKQ  65

Query  264  GIVWILDL-----EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSN  428
            G++W+L+L     EK+P+        + K + + +EV P++K+A+IKDH L L ++D + 
Sbjct  66   GVIWVLELDESLKEKLPK--------ETKKRNDHVEVHPVRKFARIKDHKLILTDTDSNK  117

Query  429  TEIQLRGCTIAAFLQQACP  485
            T I L+GC++ A      P
Sbjct  118  TVITLKGCSVEAVSGSQLP  136



>ref|XP_010459394.1| PREDICTED: testis-expressed sequence 2 protein-like [Camelina 
sativa]
Length=804

 Score = 88.2 bits (217),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 4/63 (6%)
 Frame = +2

Query  449  LYNCS---VSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWCKALR  616
            L  CS   VS + L +RKWAKRYPIKVESK S  +YKG++ FYIYLETSW+KESWCKALR
Sbjct  134  LKGCSIEAVSGSDLPTRKWAKRYPIKVESKISPDLYKGNQVFYIYLETSWEKESWCKALR  193

Query  617  LAS  625
            LA+
Sbjct  194  LAA  196


 Score = 83.6 bits (205),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 87/143 (61%), Gaps = 17/143 (12%)
 Frame = +3

Query  81   MWQFVLV------FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-----LSS  227
            M+ FV        F LG L V+  EAA  ++L++ L+R+  R+  ++K  ++      ++
Sbjct  1    MFSFVCFVFLLSGFFLGILAVLAAEAAGFMYLLKRLNRK--RDQIESKPGSDDDPTSTTN  58

Query  228  PPGLDPSYY--NKQGIVWILDLEKIPRAPV--DKALGQKKSKKEVLEVSPIQKYAKIKDH  395
            PP   P  +  NKQG+VWIL+L+++ +  +  +K   + K K++ LE+ P++K+A+IKDH
Sbjct  59   PPPRQPIDFSINKQGMVWILELDEVLKNWMMKEKLPKEHKKKRDFLEIHPLRKFARIKDH  118

Query  396  SLFLLESDGSNTEIQLRGCTIAA  464
             L L + DG+ T + L+GC+I A
Sbjct  119  KLILSDHDGTLTIVSLKGCSIEA  141



>ref|XP_006306770.1| hypothetical protein CARUB_v10008308mg [Capsella rubella]
 gb|EOA39668.1| hypothetical protein CARUB_v10008308mg [Capsella rubella]
Length=838

 Score = 87.4 bits (215),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS + L +RKWAKR+PIKVESK S  +YKG++ FYIYLETSW+KESWCKALRLA+
Sbjct  186  AVSGSDLPTRKWAKRFPIKVESKISPTLYKGNQVFYIYLETSWEKESWCKALRLAA  241


 Score = 84.3 bits (207),  Expect(2) = 6e-34, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 80/139 (58%), Gaps = 24/139 (17%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY------  251
            F+  F+LG L V+  EAA  ++L++ L+R+  R          + S P  DPS       
Sbjct  58   FLSGFLLGILAVLAAEAAGFMYLLKRLNRKRDR----------IESKPASDPSSKDLNPP  107

Query  252  -------YNKQGIVWILDLEKIPRAPVDKAL-GQKKSKKEVLEVSPIQKYAKIKDHSLFL  407
                    NKQG VW+L+L+++ +  + + L  ++K K++ LE+ P++K+A+IKDH L L
Sbjct  108  RDSVDFCINKQGTVWVLELDEVLKNWMKEKLPKEQKRKRDFLEIHPLRKFARIKDHKLIL  167

Query  408  LESDGSNTEIQLRGCTIAA  464
             ++DG+ T + L+ C+I A
Sbjct  168  SDADGTQTIVSLKACSIEA  186



>emb|CDY19177.1| BnaC05g13780D [Brassica napus]
Length=762

 Score = 85.9 bits (211),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 76/126 (60%), Gaps = 2/126 (2%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
            F+  F LG + V+  EAA  ++L+  L+R+    VD +K  ++ S+    +P   NKQG 
Sbjct  9    FLSGFFLGIVAVLAAEAAGLMYLLNRLNRKRDNRVD-SKPGSDQSTKEISNPRESNKQGT  67

Query  270  VWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  446
            +W+L+L E +     +K   ++K K+  LE+ P +K+A+IKDH L L ESDG+ T + L+
Sbjct  68   IWVLELDEGLKNMWKEKLPAEQKRKRAFLEIHPTRKFARIKDHKLILSESDGTLTTVSLK  127

Query  447  GCTIAA  464
             C++ A
Sbjct  128  CCSVEA  133


 Score = 85.5 bits (210),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 1/56 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSA-IYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS + L +RKWAKR+PIKVE+KSS+ +YKG++ FYIYLETS +KESWCKALRLAS
Sbjct  133  AVSGSDLPTRKWAKRFPIKVETKSSSDVYKGNKVFYIYLETSCEKESWCKALRLAS  188



>ref|XP_006848627.1| hypothetical protein AMTR_s00171p00040960 [Amborella trichopoda]
 gb|ERN10208.1| hypothetical protein AMTR_s00171p00040960 [Amborella trichopoda]
Length=796

 Score = 87.8 bits (216),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 75/123 (61%), Gaps = 6/123 (5%)
 Frame = +3

Query  108  LGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDL  287
            +GALTVV +EA A  F++R L +R  R  +    + EL +   L     NKQG++W+L+ 
Sbjct  1    MGALTVVILEAVALFFVVRRLGQR-RRCPNSESCAPELDANQSLH-FLLNKQGVIWVLEP  58

Query  288  EKIP----RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCT  455
            +KIP      P  K+  + KSKKE +EV P++KYAKI+D +L L + DGS   I+L GC 
Sbjct  59   DKIPMVFPNEPRSKSGKEPKSKKETVEVFPVKKYAKIQDRNLILTDLDGSEAIIELEGCR  118

Query  456  IAA  464
            I A
Sbjct  119  IMA  121


 Score = 82.8 bits (203),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSA   SSRKWAKRYPI +ESK++AI  G +T YIYLETSW+KESWCKALRL S
Sbjct  121  AVSAGPSSSRKWAKRYPIILESKNAAILNGKKTCYIYLETSWEKESWCKALRLTS  175



>gb|KJB56355.1| hypothetical protein B456_009G116400 [Gossypium raimondii]
Length=571

 Score = 95.5 bits (236),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWAKR+PIKVESK+SAIY GS+  Y+YLETSW+KESWCKALRLAS
Sbjct  120  AVSATNLPSRKWAKRFPIKVESKTSAIYNGSKIIYLYLETSWEKESWCKALRLAS  174


 Score = 73.9 bits (180),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  123  VVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPR  302
            +V +E     F++  L+RR+ +E   +  +    S P LD +Y NKQG VW+L+ EKIP 
Sbjct  16   IVSLEVVVFFFVLNRLNRRIKQE---SLAALNPPSQPSLDFAY-NKQGTVWVLESEKIP-  70

Query  303  APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAFLQQAC  482
             P +    QK+ K   LEVSP +K+AKI++  L    SD S T + L+GC I A      
Sbjct  71   VPRE----QKRKKDVTLEVSPARKHAKIQEKCLVFTHSDASRTSVPLKGCVIEAVSATNL  126

Query  483  P  485
            P
Sbjct  127  P  127



>gb|KJB56353.1| hypothetical protein B456_009G116400 [Gossypium raimondii]
Length=744

 Score = 95.9 bits (237),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWAKR+PIKVESK+SAIY GS+  Y+YLETSW+KESWCKALRLAS
Sbjct  120  AVSATNLPSRKWAKRFPIKVESKTSAIYNGSKIIYLYLETSWEKESWCKALRLAS  174


 Score = 73.9 bits (180),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 67/121 (55%), Gaps = 9/121 (7%)
 Frame = +3

Query  123  VVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPR  302
            +V +E     F++  L+RR+ +E   +  +    S P LD +Y NKQG VW+L+ EKIP 
Sbjct  16   IVSLEVVVFFFVLNRLNRRIKQE---SLAALNPPSQPSLDFAY-NKQGTVWVLESEKIP-  70

Query  303  APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAFLQQAC  482
             P +    QK+ K   LEVSP +K+AKI++  L    SD S T + L+GC I A      
Sbjct  71   VPRE----QKRKKDVTLEVSPARKHAKIQEKCLVFTHSDASRTSVPLKGCVIEAVSATNL  126

Query  483  P  485
            P
Sbjct  127  P  127



>gb|KJB56354.1| hypothetical protein B456_009G116400 [Gossypium raimondii]
Length=465

 Score = 95.5 bits (236),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWAKR+PIKVESK+SAIY GS+  Y+YLETSW+KESWCKALRLAS
Sbjct  120  AVSATNLPSRKWAKRFPIKVESKTSAIYNGSKIIYLYLETSWEKESWCKALRLAS  174


 Score = 73.9 bits (180),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 66/114 (58%), Gaps = 9/114 (8%)
 Frame = +3

Query  123  VVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPR  302
            +V +E     F++  L+RR+ +E   +  +    S P LD +Y NKQG VW+L+ EKIP 
Sbjct  16   IVSLEVVVFFFVLNRLNRRIKQE---SLAALNPPSQPSLDFAY-NKQGTVWVLESEKIP-  70

Query  303  APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAA  464
             P +    QK+ K   LEVSP +K+AKI++  L    SD S T + L+GC I A
Sbjct  71   VPRE----QKRKKDVTLEVSPARKHAKIQEKCLVFTHSDASRTSVPLKGCVIEA  120



>ref|XP_002525667.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36785.1| conserved hypothetical protein [Ricinus communis]
Length=792

 Score = 92.0 bits (227),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            SVSAT L SRKWAKR+PIKVESK+S IY  S+  YIYLETSW+KESWCKALRLAS
Sbjct  132  SVSATDLPSRKWAKRFPIKVESKTSLIYNASKKVYIYLETSWEKESWCKALRLAS  186


 Score = 76.6 bits (187),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 85/133 (64%), Gaps = 8/133 (6%)
 Frame = +3

Query  81   MWQFVLVF----ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDP  245
            M +++LVF     +G++ +V +EA    F ++ L+ ++ +E   A  S + L S   LD 
Sbjct  3    MMRWLLVFGGGFFVGSVAIVALEALLLYFFLKRLNHKIRQEDGAADSSLQHLDSQQSLDF  62

Query  246  SYYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  425
            ++ +K+G+VWI++ +K+P+   DK   + K KKEV+EV+P++KYA IKD  L L +SDGS
Sbjct  63   AF-DKKGVVWIIESDKVPKN--DKVSKEPKKKKEVIEVNPVRKYANIKDRILILTDSDGS  119

Query  426  NTEIQLRGCTIAA  464
            +  I L+GC I +
Sbjct  120  HVAIPLKGCIIES  132



>ref|XP_010476945.1| PREDICTED: uncharacterized protein LOC104756113 [Camelina sativa]
Length=803

 Score = 88.2 bits (217),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 4/63 (6%)
 Frame = +2

Query  449  LYNCS---VSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWCKALR  616
            L  CS   VS + L +RKWAKRYPIKVESK S  +YKG++ FYIYLETSW+KESWCKALR
Sbjct  135  LKGCSIEAVSGSDLPTRKWAKRYPIKVESKISPDLYKGNQVFYIYLETSWEKESWCKALR  194

Query  617  LAS  625
            LA+
Sbjct  195  LAA  197


 Score = 80.1 bits (196),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 78/129 (60%), Gaps = 8/129 (6%)
 Frame = +3

Query  102  FILGALTVVGVEAAAAVFLIRWLSRRLSR-EVDKAKVSAELSSPPGLDPSY-----YNKQ  263
            F LG L V+  EAA  ++L++ L+R+  + E   A    + SS   L P        NKQ
Sbjct  14   FFLGILAVLAAEAAGFMYLLKRLNRKRDQIESKPASSDDDPSSTTNLPPRQPTDFSINKQ  73

Query  264  GIVWILDLEKIPRAPV--DKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  437
            G+V+IL+L+++ +  +  +K   + K K++ LE+ P++K+A+IKDH L L E DG+ T +
Sbjct  74   GMVYILELDEVLKNWMMKEKLPKENKRKRDFLEIHPLRKFARIKDHKLILSEPDGTLTIV  133

Query  438  QLRGCTIAA  464
             L+GC+I A
Sbjct  134  SLKGCSIEA  142



>gb|KHG07655.1| Testis-expressed sequence 2 [Gossypium arboreum]
Length=744

 Score = 95.5 bits (236),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWAKR+PIKVESK+SAIY GS+  Y+YLETSW+KESWCKALRLAS
Sbjct  120  AVSATNLPSRKWAKRFPIKVESKTSAIYNGSKIIYLYLETSWEKESWCKALRLAS  174


 Score = 72.8 bits (177),  Expect(2) = 5e-33, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 66/114 (58%), Gaps = 9/114 (8%)
 Frame = +3

Query  123  VVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPR  302
            +V +E     F++  L+RR+ +E   +  +    S P LD +Y NKQG VW+L+ EKIP 
Sbjct  16   IVSLEVVVFFFVLNRLNRRIKQE---SLAALNPPSQPSLDFAY-NKQGTVWVLESEKIP-  70

Query  303  APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAA  464
             P +    QK+ K   LEVSP +K+AKI++  L    SD S T + L+GC I A
Sbjct  71   VPRE----QKRKKDVPLEVSPARKHAKIQEKCLVFTHSDASRTSVPLKGCVIEA  120



>ref|XP_006416664.1| hypothetical protein EUTSA_v10006829mg [Eutrema salsugineum]
 gb|ESQ35017.1| hypothetical protein EUTSA_v10006829mg [Eutrema salsugineum]
Length=802

 Score = 91.3 bits (225),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 1/56 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS + L +RKWAKR+PIKVESK SSA+YKGS+ FYIYLETSW+KESWCKALRLA+
Sbjct  136  AVSGSDLPTRKWAKRFPIKVESKISSALYKGSQVFYIYLETSWEKESWCKALRLAA  191


 Score = 76.6 bits (187),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 77/146 (53%), Gaps = 39/146 (27%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY------  251
            F+  F LG + ++  EAA  ++L++ L+R+  R          L S PG  PS       
Sbjct  9    FLSGFFLGIVAILAAEAAGLMYLVKRLNRKRDR----------LESKPGSAPSTKDYNPG  58

Query  252  ------YNKQGIVWILD---------LEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKI  386
                   NKQG++WIL+          EK+P+       GQK+ K++ LE+ P++K+A+I
Sbjct  59   ESLDFCLNKQGVIWILEGNEGLKNWMKEKLPK-------GQKR-KRDFLEIHPLRKFARI  110

Query  387  KDHSLFLLESDGSNTEIQLRGCTIAA  464
            K+H L L ++DG+   + L+ C+I A
Sbjct  111  KNHELILSDADGTQATVSLKCCSIEA  136



>ref|XP_006372649.1| hypothetical protein POPTR_0017s03560g [Populus trichocarpa]
 gb|ERP50446.1| hypothetical protein POPTR_0017s03560g [Populus trichocarpa]
Length=802

 Score = 92.8 bits (229),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT LSSRKWAKR+PIKVESK+S IY  S+T +I+LETSW+KESWCKALRLAS
Sbjct  137  AVSATSLSSRKWAKRFPIKVESKTSPIYNASKTVFIFLETSWEKESWCKALRLAS  191


 Score = 74.7 bits (182),  Expect(2) = 8e-33, Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 83/138 (60%), Gaps = 11/138 (8%)
 Frame = +3

Query  81   MWQFVLVF----ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPS  248
            MW  V++F    + G LT+V ++A     LI+ L+R+ +++   +  S+       LDP 
Sbjct  1    MWPVVVIFAGGFLSGLLTLVALQALGVYVLIKRLNRK-TQQQQASHSSSSSPHHQDLDPQ  59

Query  249  Y-----YNKQGIVWILDLEKIPRA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLL  410
                  +NK+G VW+LD +++ +  PV+K    +K KKE+LEV+PI+K AKIKD SL L 
Sbjct  60   QSLDYAHNKKGYVWVLDSDQVLKNWPVEKVQKDQKKKKELLEVTPIRKQAKIKDRSLILT  119

Query  411  ESDGSNTEIQLRGCTIAA  464
            +S GS+  I L+GC I A
Sbjct  120  DSGGSHRVIPLKGCAIEA  137



>ref|XP_010498158.1| PREDICTED: uncharacterized protein LOC104775894 [Camelina sativa]
Length=805

 Score = 88.6 bits (218),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 4/63 (6%)
 Frame = +2

Query  449  LYNCS---VSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWCKALR  616
            L  CS   VS + L +RKWAKRYPIKVESK S  +YKG++ FYIYLETSW+KESWCKALR
Sbjct  135  LKGCSIEAVSGSDLPTRKWAKRYPIKVESKISPDLYKGNQVFYIYLETSWEKESWCKALR  194

Query  617  LAS  625
            LA+
Sbjct  195  LAA  197


 Score = 78.6 bits (192),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 83/144 (58%), Gaps = 18/144 (13%)
 Frame = +3

Query  81   MWQFVLV------FILGALTVVGVEAAAAVFLIRWLSRR--------LSREVDKAKVSAE  218
            M+ FV        F LG L V+  EAA  ++L++ L+R+         S + D +  +  
Sbjct  1    MFSFVCFVFLLSGFFLGILAVLAAEAAGFMYLLKRLNRKRDQIESKPASSDDDPSSTTNP  60

Query  219  LSSPPGLDPSYYNKQGIVWILDLEKIPRAPV--DKALGQKKSKKEVLEVSPIQKYAKIKD  392
                P +D S  NKQG+VWIL+L+++ +  +  +K   + K K++ LE+ P++K+A+IKD
Sbjct  61   PPPQP-IDFSI-NKQGMVWILELDEVLKNWMMKEKLPKEHKRKRDFLEIHPLRKFARIKD  118

Query  393  HSLFLLESDGSNTEIQLRGCTIAA  464
            H L L E DG+ T + L+GC+I A
Sbjct  119  HKLILSEPDGTLTIVSLKGCSIEA  142



>ref|XP_002888912.1| hypothetical protein ARALYDRAFT_895179 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65171.1| hypothetical protein ARALYDRAFT_895179 [Arabidopsis lyrata subsp. 
lyrata]
Length=779

 Score = 88.6 bits (218),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 1/55 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS +G  +RKWAKR+PI+VESK+S +YKG+R FYI+LETSW+KESWCKALRLA+
Sbjct  138  AVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRVFYIFLETSWEKESWCKALRLAA  191


 Score = 77.4 bits (189),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 78/133 (59%), Gaps = 11/133 (8%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY-----Y  254
            F+   +LG L +V  E    +++++ L+R+  R+   +   +   +    DP        
Sbjct  9    FLSGILLGILAIVTAEVIGFLYILKRLNRKRDRQESNSSSDSNFKN---FDPRQSIDFSL  65

Query  255  NKQGIVWILDLEKIPRAPVDKAL--GQKKSKKEVLEVSPIQKYAKIKDHSLFLLES-DGS  425
            NKQG++WIL+L++  +  + + L   QKK + ++LEV P++++A+IKDH LFL +S DG+
Sbjct  66   NKQGVIWILELDENVKDWMKEKLPTEQKKKRVDLLEVHPVRRFARIKDHKLFLSDSLDGT  125

Query  426  NTEIQLRGCTIAA  464
             T I L+GC + A
Sbjct  126  QTPITLKGCFVHA  138



>dbj|BAD94820.1| hypothetical protein [Arabidopsis thaliana]
Length=499

 Score = 87.8 bits (216),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 1/55 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS +G  +RKWAKR+PI+VESK+S +YKG+R FYI+LETSW+KESWCKALRLA+
Sbjct  138  AVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRVFYIFLETSWEKESWCKALRLAA  191


 Score = 77.8 bits (190),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 74/140 (53%), Gaps = 25/140 (18%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY-----Y  254
            FV   +LG L +V  E    ++L++ L+R+  R+   +       S    DP        
Sbjct  9    FVFGILLGILAIVTAEVVGFLYLLKRLNRKRDRQESNSSSDPNFKS---FDPRQSIDFSL  65

Query  255  NKQGIVWILDL---------EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFL  407
            NKQG++WIL+L         EK+P+        QKK + ++LEV P++++A+IKDH L L
Sbjct  66   NKQGVIWILELDENVKDWMKEKLPKE-------QKKKRVDLLEVHPVRRFARIKDHKLIL  118

Query  408  LES-DGSNTEIQLRGCTIAA  464
             +S DG  T I L+GC + A
Sbjct  119  SDSLDGPQTPITLKGCFVDA  138



>ref|NP_177463.1| putative integral membrane protein [Arabidopsis thaliana]
 gb|AAG52130.1|AC010556_12 hypothetical protein; 41134-44253 [Arabidopsis thaliana]
 gb|AEE35428.1| putative integral membrane protein [Arabidopsis thaliana]
Length=779

 Score = 87.8 bits (216),  Expect(2) = 3e-32, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 1/55 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS +G  +RKWAKR+PI+VESK+S +YKG+R FYI+LETSW+KESWCKALRLA+
Sbjct  138  AVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRVFYIFLETSWEKESWCKALRLAA  191


 Score = 77.8 bits (190),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 74/140 (53%), Gaps = 25/140 (18%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY-----Y  254
            FV   +LG L +V  E    ++L++ L+R+  R+   +       S    DP        
Sbjct  9    FVFGILLGILAIVTAEVVGFLYLLKRLNRKRDRQESNSSSDPNFKS---FDPRQSIDFSL  65

Query  255  NKQGIVWILDL---------EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFL  407
            NKQG++WIL+L         EK+P+        QKK + ++LEV P++++A+IKDH L L
Sbjct  66   NKQGVIWILELDENVKDWMKEKLPKE-------QKKKRVDLLEVHPVRRFARIKDHKLIL  118

Query  408  LES-DGSNTEIQLRGCTIAA  464
             +S DG  T I L+GC + A
Sbjct  119  SDSLDGPQTPITLKGCFVDA  138



>emb|CDX72963.1| BnaC06g34110D [Brassica napus]
Length=749

 Score = 92.0 bits (227),  Expect(2) = 4e-32, Method: Composition-based stats.
 Identities = 40/55 (73%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS + L +RKWAKR+PI+VESK+S +YKG+R FYIYLETSW+KESWCKALRLA+
Sbjct  129  AVSGSQLPTRKWAKRFPIQVESKTSDLYKGNRVFYIYLETSWEKESWCKALRLAA  183


 Score = 73.6 bits (179),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 81/134 (60%), Gaps = 8/134 (6%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYN--KQ  263
            FV  F+LG L VV  E AA ++L++ L+R+     D    +++ S PP L+P  +N  KQ
Sbjct  9    FVTGFLLGLLAVVAAEVAAFLYLVKRLNRKQESSSDP---TSKGSDPPPLEPIDFNLNKQ  65

Query  264  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  443
            G++W+L+L++   +  +K   + K K   LEV P++K+A+IKDH L L ++D + T I L
Sbjct  66   GVIWVLELDE---SLKEKLPKEPKKKINHLEVHPVRKFARIKDHKLILTDTDSNKTVITL  122

Query  444  RGCTIAAFLQQACP  485
            +GC++ A      P
Sbjct  123  KGCSVEAVSGSQLP  136



>ref|XP_010428228.1| PREDICTED: testis-expressed sequence 2 protein-like [Camelina 
sativa]
Length=776

 Score = 88.2 bits (217),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 42/61 (69%), Positives = 51/61 (84%), Gaps = 2/61 (3%)
 Frame = +2

Query  449  LYNCSVSATGLS--SRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLA  622
            L  C V+A   S  +RKWAKR+PI+VESKSS +YKG+R FYI+LETSW+KESWCKALRLA
Sbjct  132  LKGCFVNAVSGSGPTRKWAKRFPIQVESKSSVLYKGNRVFYIFLETSWEKESWCKALRLA  191

Query  623  S  625
            +
Sbjct  192  A  192


 Score = 74.7 bits (182),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 28/137 (20%)
 Frame = +3

Query  105  ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPP--GLDPSY-----YNKQ  263
            +LG L +V  E    +F+++    RL+R+ +K   S   S P     DP        +KQ
Sbjct  14   LLGILAIVAAEVIGFLFVLK----RLNRKSNKRHESNSGSDPTSKNFDPRRSIDFSLSKQ  69

Query  264  GIVWILDL----------EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE  413
            G++WI+++          EK+P+        QKK + +++EV PI+++A+IKDH L L +
Sbjct  70   GVIWIMEMDESVKDWMKKEKLPKE-------QKKKRVDLMEVHPIRRFARIKDHKLILSD  122

Query  414  SDGSNTEIQLRGCTIAA  464
            SDG+ T I L+GC + A
Sbjct  123  SDGTQTCITLKGCFVNA  139



>ref|XP_010474308.1| PREDICTED: testis-expressed sequence 2 protein-like [Camelina 
sativa]
Length=735

 Score = 87.8 bits (216),  Expect(2) = 5e-31, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 1/55 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS +G  +RKWAKR+PI+VESK+S +YKG+R FYI+LETSW+KESWCKALRLA+
Sbjct  139  AVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRVFYIFLETSWEKESWCKALRLAA  192


 Score = 73.9 bits (180),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 75/137 (55%), Gaps = 28/137 (20%)
 Frame = +3

Query  105  ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPP--GLDPSY-----YNKQ  263
            +LG L +V  E    +F+++    RL+R+ +K   S   S P     DP        +KQ
Sbjct  14   LLGILAIVAAEVIGFLFVLK----RLNRKSNKRHESNSGSDPTLKNFDPRRSIDFSLSKQ  69

Query  264  GIVWILDLE----------KIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE  413
            G++WIL+++          K+P+        QKK + +++EV PI+++A+IKDH L L +
Sbjct  70   GVIWILEMDENVKDWMKKDKLPKE-------QKKKRVDLMEVHPIRRFARIKDHKLILSD  122

Query  414  SDGSNTEIQLRGCTIAA  464
            SDG+ T I L+GC + A
Sbjct  123  SDGTQTCITLKGCFVNA  139



>emb|CDY21730.1| BnaA09g44810D [Brassica napus]
Length=768

 Score = 88.2 bits (217),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS   L +RKWAKR+PIKVESK SS +YKG++ FYIYLETSW+KESWCKALRLA+
Sbjct  134  AVSGNHLPTRKWAKRFPIKVESKISSELYKGNKVFYIYLETSWEKESWCKALRLAA  189


 Score = 73.2 bits (178),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 81/143 (57%), Gaps = 10/143 (7%)
 Frame = +3

Query  81   MWQFV-LVFI----LGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDP  245
            M+ FV  VF+    LG + ++  EAA  ++L++ L+R+   +      + ++ +PP  + 
Sbjct  1    MFSFVGFVFLSGVFLGIVAILAAEAAGLMYLVKRLNRKRDSKPASDPSTDDIVNPP--NE  58

Query  246  SYYNKQGIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE--S  416
               NKQG+VWIL++ E +     +K   + K K++ LEV P++K+A+IKDH L L +  S
Sbjct  59   FSLNKQGMVWILEVDEGVKNWGKEKVPKEHKKKRDFLEVHPLRKFARIKDHKLLLSDAGS  118

Query  417  DGSNTEIQLRGCTIAAFLQQACP  485
            D + T + L+ C+I A      P
Sbjct  119  DSTPTMVSLKCCSIEAVSGNHLP  141



>ref|XP_009117641.1| PREDICTED: uncharacterized protein LOC103842732 [Brassica rapa]
Length=786

 Score = 88.2 bits (217),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS   L +RKWAKR+PIKVESK SS +YKG++ FYIYLETSW+KESWCKALRLA+
Sbjct  134  AVSGNHLPTRKWAKRFPIKVESKISSELYKGNKVFYIYLETSWEKESWCKALRLAA  189


 Score = 72.4 bits (176),  Expect(2) = 1e-30, Method: Composition-based stats.
 Identities = 46/136 (34%), Positives = 80/136 (59%), Gaps = 10/136 (7%)
 Frame = +3

Query  81   MWQFV-LVFI----LGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDP  245
            M+ FV  VF+    LG + ++  EAA  ++L++ L+R+   +      + ++ +PP  + 
Sbjct  1    MFSFVGFVFLSGVFLGIVAILAAEAAGLMYLVKRLNRKRDSKPASDPSTDDIVNPP--NE  58

Query  246  SYYNKQGIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE--S  416
               NKQG+VWIL++ E +     +K   + K K++ LEV P++K+A+IKDH L L +  S
Sbjct  59   FSLNKQGMVWILEVDEGVKNWGKEKVPKEHKKKRDFLEVHPLRKFARIKDHKLLLSDAGS  118

Query  417  DGSNTEIQLRGCTIAA  464
            D + T + L+ C+I A
Sbjct  119  DSTPTMVSLKCCSIEA  134



>emb|CDX81851.1| BnaC08g37500D [Brassica napus]
Length=771

 Score = 87.8 bits (216),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 1/56 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS   L +RKWAKR+PIKVESK SS +YKG++ FYIYLETSW+KESWCKALRLA+
Sbjct  134  AVSGNHLPTRKWAKRFPIKVESKISSELYKGNKVFYIYLETSWEKESWCKALRLAA  189


 Score = 68.2 bits (165),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 75/135 (56%), Gaps = 5/135 (4%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
            F+    LG + ++  EAA  ++L+  L+R+   +      + ++ +PP  D S  NKQG+
Sbjct  9    FLSGVFLGIVAILAAEAAGLMYLVNRLNRKRGSKPASDPSTDDIVNPPA-DFSL-NKQGM  66

Query  270  VWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE--SDGSNTEIQ  440
            VWIL++ E +     +K   + K K++ LEV P++K+A+IKDH L L +  SD +   + 
Sbjct  67   VWILEVDEGVKNWGKEKVPKEHKKKRDFLEVHPLRKFARIKDHKLLLSDAGSDSTPAIVS  126

Query  441  LRGCTIAAFLQQACP  485
            L+ C+I A      P
Sbjct  127  LKCCSIEAVSGNHLP  141



>emb|CDY66320.1| BnaCnng50280D [Brassica napus]
Length=742

 Score = 88.6 bits (218),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 39/55 (71%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS + L +RKWAKRYPIKVESK+S ++KG+R FYI+LETSW+KESWCKALR+A+
Sbjct  132  AVSGSDLPTRKWAKRYPIKVESKTSNLHKGNRVFYIFLETSWEKESWCKALRVAA  186


 Score = 67.4 bits (163),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 78/135 (58%), Gaps = 7/135 (5%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
            F+  F+LG LT+V  E A  ++L++    RL+R+ +  + +   S PP       NKQG+
Sbjct  9    FITGFLLGILTIVAAEVAGFLYLLK----RLNRKRNLHESNKTSSDPPNSIDFSLNKQGV  64

Query  270  VWILDLEKIPRAPVDKALGQKKSKKEVLE---VSPIQKYAKIKDHSLFLLESDGSNTEIQ  440
            +WIL+ ++  +  +++ L +++ KK+  +   V P++K + IKDH L LL +DG+   + 
Sbjct  65   IWILESDEGLKDWMNEKLPKEQKKKKKKDLLEVHPVRKSSHIKDHKLILLNADGTQKIVF  124

Query  441  LRGCTIAAFLQQACP  485
            L+GC++ A      P
Sbjct  125  LKGCSVEAVSGSDLP  139



>ref|XP_006300617.1| hypothetical protein CARUB_v10019838mg [Capsella rubella]
 gb|EOA33515.1| hypothetical protein CARUB_v10019838mg [Capsella rubella]
Length=775

 Score = 84.7 bits (208),  Expect(2) = 6e-29, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS +G  +RKWAKR+PI+VESK+S +YKG+R  YI+LETSW+KESWCKALRLA+
Sbjct  137  AVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRLLYIFLETSWEKESWCKALRLAA  190


 Score = 70.1 bits (170),  Expect(2) = 6e-29, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 76/134 (57%), Gaps = 24/134 (18%)
 Frame = +3

Query  105  ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYN---------  257
            +LG L +V  E    ++L++ L+R+ +R+        E SS  G DP++ N         
Sbjct  14   LLGILAIVAAEVIGFLYLVKRLNRKSNRQ--------EPSS--GSDPTHKNFDPRQSVDF  63

Query  258  ---KQGIVWILDLEKIPR--APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  422
               KQG++WIL++++  +          QKK + ++LEV P++++A+IKDH L L +SDG
Sbjct  64   SLSKQGVIWILEMDESVKDWMKEKLQKEQKKKRLDLLEVHPVRRFARIKDHKLILSDSDG  123

Query  423  SNTEIQLRGCTIAA  464
            + T I L+GC + A
Sbjct  124  TQTSITLKGCFVDA  137



>ref|XP_006300616.1| hypothetical protein CARUB_v10019838mg [Capsella rubella]
 gb|EOA33514.1| hypothetical protein CARUB_v10019838mg [Capsella rubella]
Length=591

 Score = 84.3 bits (207),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 49/55 (89%), Gaps = 1/55 (2%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS +G  +RKWAKR+PI+VESK+S +YKG+R  YI+LETSW+KESWCKALRLA+
Sbjct  137  AVSGSG-PTRKWAKRFPIQVESKTSVLYKGNRLLYIFLETSWEKESWCKALRLAA  190


 Score = 69.7 bits (169),  Expect(2) = 9e-29, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 76/134 (57%), Gaps = 24/134 (18%)
 Frame = +3

Query  105  ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYN---------  257
            +LG L +V  E    ++L++ L+R+ +R+        E SS  G DP++ N         
Sbjct  14   LLGILAIVAAEVIGFLYLVKRLNRKSNRQ--------EPSS--GSDPTHKNFDPRQSVDF  63

Query  258  ---KQGIVWILDLEKIPR--APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  422
               KQG++WIL++++  +          QKK + ++LEV P++++A+IKDH L L +SDG
Sbjct  64   SLSKQGVIWILEMDESVKDWMKEKLQKEQKKKRLDLLEVHPVRRFARIKDHKLILSDSDG  123

Query  423  SNTEIQLRGCTIAA  464
            + T I L+GC + A
Sbjct  124  TQTSITLKGCFVDA  137



>gb|KHG11075.1| Testis-expressed sequence 2 [Gossypium arboreum]
Length=814

 Score = 86.3 bits (212),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L SRKWAKRYPIKVESK+  IY  S+  Y+YL+T+W+KESWCK LRLAS
Sbjct  124  AVSATSLPSRKWAKRYPIKVESKTKVIYNASKIIYLYLDTAWEKESWCKGLRLAS  178


 Score = 66.2 bits (160),  Expect(2) = 2e-28, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 74/134 (55%), Gaps = 9/134 (7%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE--LSSPPGLDPSYYNKQ  263
            F++ F+ G   ++  E    +F++  L+R++ + + K   +A+  + +P     S  N Q
Sbjct  5    FLVGFVAGICAILSFELLVVLFVLNLLNRKIKQRIKKETHAADAAVRNPQDSFDSICNLQ  64

Query  264  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  443
            GIVW+L+  KIP         ++K K+E +EVSP +++AKI+D  L L  SD S T I L
Sbjct  65   GIVWVLEPGKIPTK-------EQKRKRETVEVSPARRHAKIQDGYLTLANSDSSCTIIPL  117

Query  444  RGCTIAAFLQQACP  485
            +GC I A    + P
Sbjct  118  KGCIIQAVSATSLP  131



>ref|XP_006478163.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Citrus sinensis]
Length=806

 Score = 90.9 bits (224),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSA+ LSSRKWAKR+PIKVE+KSS +Y GS+  YI+LETSW+KE+WCKALRLAS
Sbjct  130  AVSASSLSSRKWAKRFPIKVENKSSVLYNGSKLIYIFLETSWEKEAWCKALRLAS  184


 Score = 60.8 bits (146),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 73/133 (55%), Gaps = 8/133 (6%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY---  251
            M  F +  I+GA+ VV VEAAA ++ I  L+++  +    +   + L S   LDP     
Sbjct  1    MISFFVGLIIGAIGVVAVEAAAVLYFIYKLNQKTKKVASFSPSPSSLDSSEVLDPQQSLE  60

Query  252  --YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  425
              Y KQG VW+L+ EK+P+    K   +KK   EV    PI+KYAKIK  +L L  +DGS
Sbjct  61   FAYKKQGYVWVLEPEKVPKEKFSKEQKKKKEFLEVY---PIRKYAKIKHRALILTSTDGS  117

Query  426  NTEIQLRGCTIAA  464
             T   L+GC I A
Sbjct  118  QTSFPLKGCEIKA  130



>gb|KDO56007.1| hypothetical protein CISIN_1g003631mg [Citrus sinensis]
Length=806

 Score = 90.9 bits (224),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSA+ LSSRKWAKR+PIKVE+KSS +Y GS+  YI+LETSW+KE+WCKALRLAS
Sbjct  130  AVSASSLSSRKWAKRFPIKVENKSSVLYNGSKLIYIFLETSWEKEAWCKALRLAS  184


 Score = 60.1 bits (144),  Expect(2) = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 73/133 (55%), Gaps = 8/133 (6%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY---  251
            M  F +  I+GA+ VV VEAAA ++ I  L+++  +    +   + L S   LDP     
Sbjct  1    MISFFVGLIIGAIGVVAVEAAAVLYFIYKLNQKTKKVASFSPSPSSLDSSEVLDPQQSLE  60

Query  252  --YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  425
              Y KQG VW+L+ EK+P+    K   +KK   EV    P++KYAKIK  +L L  +DGS
Sbjct  61   FAYKKQGYVWVLEPEKVPKEKFSKEQKKKKEFLEVY---PVRKYAKIKHRALILTSTDGS  117

Query  426  NTEIQLRGCTIAA  464
             T   L+GC I A
Sbjct  118  QTSFPLKGCEIKA  130



>gb|KDO56010.1| hypothetical protein CISIN_1g003631mg [Citrus sinensis]
Length=501

 Score = 90.5 bits (223),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSA+ LSSRKWAKR+PIKVE+KSS +Y GS+  YI+LETSW+KE+WCKALRLAS
Sbjct  130  AVSASSLSSRKWAKRFPIKVENKSSVLYNGSKLIYIFLETSWEKEAWCKALRLAS  184


 Score = 60.1 bits (144),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 73/133 (55%), Gaps = 8/133 (6%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY---  251
            M  F +  I+GA+ VV VEAAA ++ I  L+++  +    +   + L S   LDP     
Sbjct  1    MISFFVGLIIGAIGVVAVEAAAVLYFIYKLNQKTKKVASFSPSPSSLDSSEVLDPQQSLE  60

Query  252  --YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  425
              Y KQG VW+L+ EK+P+    K   +KK   EV    P++KYAKIK  +L L  +DGS
Sbjct  61   FAYKKQGYVWVLEPEKVPKEKFSKEQKKKKEFLEVY---PVRKYAKIKHRALILTSTDGS  117

Query  426  NTEIQLRGCTIAA  464
             T   L+GC I A
Sbjct  118  QTSFPLKGCEIKA  130



>gb|KDO56009.1| hypothetical protein CISIN_1g003631mg [Citrus sinensis]
Length=608

 Score = 90.5 bits (223),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSA+ LSSRKWAKR+PIKVE+KSS +Y GS+  YI+LETSW+KE+WCKALRLAS
Sbjct  130  AVSASSLSSRKWAKRFPIKVENKSSVLYNGSKLIYIFLETSWEKEAWCKALRLAS  184


 Score = 59.7 bits (143),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 73/133 (55%), Gaps = 8/133 (6%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY---  251
            M  F +  I+GA+ VV VEAAA ++ I  L+++  +    +   + L S   LDP     
Sbjct  1    MISFFVGLIIGAIGVVAVEAAAVLYFIYKLNQKTKKVASFSPSPSSLDSSEVLDPQQSLE  60

Query  252  --YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  425
              Y KQG VW+L+ EK+P+    K   +KK   EV    P++KYAKIK  +L L  +DGS
Sbjct  61   FAYKKQGYVWVLEPEKVPKEKFSKEQKKKKEFLEVY---PVRKYAKIKHRALILTSTDGS  117

Query  426  NTEIQLRGCTIAA  464
             T   L+GC I A
Sbjct  118  QTSFPLKGCEIKA  130



>ref|XP_004301206.1| PREDICTED: uncharacterized protein LOC101303523 [Fragaria vesca 
subsp. vesca]
Length=803

 Score = 89.4 bits (220),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VS+T L+SRKWAKR+P+K+ESK++ +YKGS+ FYIYLETSW+KESWCKALR AS
Sbjct  134  AVSSTSLASRKWAKRFPLKLESKTAILYKGSKIFYIYLETSWEKESWCKALRSAS  188


 Score = 60.5 bits (145),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 6/79 (8%)
 Frame = +3

Query  246  SYYNKQGIVWILDLEKIPRAPVD------KALGQKKSKKEVLEVSPIQKYAKIKDHSLFL  407
            S  +KQG+VW+L+ EK+P++  D      +   ++K KKE  EVSP++K+AK+K+  L L
Sbjct  56   SLESKQGVVWVLEPEKVPKSWQDSVSREQRVSREQKRKKEFYEVSPVKKHAKLKNQLLLL  115

Query  408  LESDGSNTEIQLRGCTIAA  464
             ESDGS T + L+ CTI A
Sbjct  116  KESDGSQTAVPLKSCTIEA  134



>ref|XP_009789864.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Nicotiana sylvestris]
Length=728

 Score = 85.1 bits (209),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAK+YPIK+E+ +SAIYKGS  FYIYLETSW+KESWCKALRLAS
Sbjct  48   RKWAKKYPIKIENGASAIYKGSGIFYIYLETSWEKESWCKALRLAS  93


 Score = 52.0 bits (123),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  348  VLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGC  452
            +LEV P +K+ KIKDHSL L +SDGS TEI L+GC
Sbjct  1    MLEVIPARKFGKIKDHSLILTDSDGSRTEIPLKGC  35



>ref|XP_004966560.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Setaria italica]
Length=781

 Score = 84.3 bits (207),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  458  CSVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
             +VSA+ L SRKWAKRYPIK+ESK S + +GS+  Y+Y +TSW+KESWCKALRLAS
Sbjct  145  VAVSASNLPSRKWAKRYPIKLESKESQVSRGSKVCYVYAQTSWEKESWCKALRLAS  200


 Score = 45.4 bits (106),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 9/85 (11%)
 Frame = +3

Query  258  KQGIVWILDLEKIP----RAPVDKA--LGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESD  419
            +QG +WIL+ EK+P      P + A   G  K KK V+EV P++  AK++ HSL L   D
Sbjct  69   RQGFLWILEQEKMPAKASHHPSNDAQSHGGIKDKKTVVEVFPVKMLAKLEGHSLTLSAPD  128

Query  420  GSN---TEIQLRGCTIAAFLQQACP  485
             ++   T I L   TI A      P
Sbjct  129  DASQQTTTIHLLDSTIVAVSASNLP  153



>ref|XP_004966559.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Setaria italica]
Length=784

 Score = 84.3 bits (207),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  458  CSVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
             +VSA+ L SRKWAKRYPIK+ESK S + +GS+  Y+Y +TSW+KESWCKALRLAS
Sbjct  145  VAVSASNLPSRKWAKRYPIKLESKESQVSRGSKVCYVYAQTSWEKESWCKALRLAS  200


 Score = 45.4 bits (106),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 9/85 (11%)
 Frame = +3

Query  258  KQGIVWILDLEKIP----RAPVDKA--LGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESD  419
            +QG +WIL+ EK+P      P + A   G  K KK V+EV P++  AK++ HSL L   D
Sbjct  69   RQGFLWILEQEKMPAKASHHPSNDAQSHGGIKDKKTVVEVFPVKMLAKLEGHSLTLSAPD  128

Query  420  GSN---TEIQLRGCTIAAFLQQACP  485
             ++   T I L   TI A      P
Sbjct  129  DASQQTTTIHLLDSTIVAVSASNLP  153



>ref|XP_004966561.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Setaria italica]
Length=763

 Score = 84.0 bits (206),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +2

Query  458  CSVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
             +VSA+ L SRKWAKRYPIK+ESK S + +GS+  Y+Y +TSW+KESWCKALRLAS
Sbjct  145  VAVSASNLPSRKWAKRYPIKLESKESQVSRGSKVCYVYAQTSWEKESWCKALRLAS  200


 Score = 45.4 bits (106),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 44/85 (52%), Gaps = 9/85 (11%)
 Frame = +3

Query  258  KQGIVWILDLEKIP----RAPVDKA--LGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESD  419
            +QG +WIL+ EK+P      P + A   G  K KK V+EV P++  AK++ HSL L   D
Sbjct  69   RQGFLWILEQEKMPAKASHHPSNDAQSHGGIKDKKTVVEVFPVKMLAKLEGHSLTLSAPD  128

Query  420  GSN---TEIQLRGCTIAAFLQQACP  485
             ++   T I L   TI A      P
Sbjct  129  DASQQTTTIHLLDSTIVAVSASNLP  153



>ref|XP_010104942.1| hypothetical protein L484_004290 [Morus notabilis]
 gb|EXC02509.1| hypothetical protein L484_004290 [Morus notabilis]
Length=796

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 88/132 (67%), Gaps = 9/132 (7%)
 Frame = +3

Query  81   MWQFVLVFI---LGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE-LSSPPGLDPS  248
            MW  +L  +   +GA+ ++G EA    FL+  + +RLSR+ +++    E L     LD S
Sbjct  1    MWWLILFGLGIAVGAVAILGAEA----FLLFVVVKRLSRKTEQSDRKIEHLDHNQSLDYS  56

Query  249  YYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSN  428
            + NKQG+VW+L+  K+P+  +DKA  ++K KKE  EVSP++K+A+IKD SL L +S+GS 
Sbjct  57   H-NKQGVVWVLESNKVPKDWLDKAPKEQKRKKEFFEVSPVRKHARIKDQSLILTDSNGSK  115

Query  429  TEIQLRGCTIAA  464
            T ++L+GC+I A
Sbjct  116  TTMKLKGCSIEA  127


 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/66 (73%), Positives = 56/66 (85%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCS---VSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T +L  CS   VSA+ LSSRKWAKR+PIK+E+K SAIYK S+T YIYLETSW+KESWCK
Sbjct  116  TTMKLKGCSIEAVSASMLSSRKWAKRFPIKLENKVSAIYKDSKTVYIYLETSWEKESWCK  175

Query  608  ALRLAS  625
            ALRLAS
Sbjct  176  ALRLAS  181



>ref|XP_010537536.1| PREDICTED: testis-expressed sequence 2 protein [Tarenaya hassleriana]
Length=771

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 56/66 (85%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T  L  CSV   SATGL SRKWAK++PIKVESK+SA+YKGS+ F IYLETSW+KE+WCK
Sbjct  125  TTVPLKGCSVEAVSATGLQSRKWAKKFPIKVESKTSALYKGSQMFCIYLETSWEKEAWCK  184

Query  608  ALRLAS  625
            ALRLA+
Sbjct  185  ALRLAA  190


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 80/136 (59%), Gaps = 19/136 (14%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPG-----LDPSY-  251
            FV  F+LG L +V  EAA  V+L+R LSRR        K  +E +  PG     LDP   
Sbjct  9    FVSGFVLGILAIVAAEAAGLVYLVRRLSRR--------KDLSESNLDPGQSFKDLDPRQS  60

Query  252  ----YNKQGIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLES  416
                 NKQG +W+L+  E + +   DK   ++K +K+ +EV P++++A+IK+H L L ++
Sbjct  61   VDFCLNKQGAIWVLEFDESLKKWTNDKLPKEQKRRKDFVEVHPVRRFARIKEHKLILSDA  120

Query  417  DGSNTEIQLRGCTIAA  464
            DGS T + L+GC++ A
Sbjct  121  DGSQTTVPLKGCSVEA  136



>emb|CDY48046.1| BnaA02g16390D [Brassica napus]
Length=739

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 57/74 (77%), Gaps = 6/74 (8%)
 Frame = +2

Query  422  FQH*NSTQR---LYNCSVSATG---LSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETS  583
            F + + TQ+   L  CSV A     L +RKWAKRYPIKVESK+S +YKGSR FYI+LETS
Sbjct  113  FSNGDGTQKIVSLKGCSVEAVSGSELPTRKWAKRYPIKVESKTSDLYKGSRVFYIFLETS  172

Query  584  WDKESWCKALRLAS  625
            W+KESWCKALRLA+
Sbjct  173  WEKESWCKALRLAA  186


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 74/135 (55%), Gaps = 7/135 (5%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
            F+  F+LG LT+V  E AA ++L++    RL+R+ +  + +   S PP       NKQG+
Sbjct  9    FITGFLLGILTIVAAEVAAFLYLLK----RLNRKRNLHESNKTSSDPPNSIDFSLNKQGV  64

Query  270  VWILDLEKIPR---APVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  440
            +W+L+ ++  +           QKK KK++LEV P++K A IKDH L     DG+   + 
Sbjct  65   IWVLESDESLKDWMKEKLPKEEQKKKKKDILEVHPVRKSAHIKDHKLIFSNGDGTQKIVS  124

Query  441  LRGCTIAAFLQQACP  485
            L+GC++ A      P
Sbjct  125  LKGCSVEAVSGSELP  139



>ref|XP_008240431.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103338940 
[Prunus mume]
Length=807

 Score = 95.9 bits (237),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 3/63 (5%)
 Frame = +2

Query  446  RLYNCS---VSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  616
            +L  C+   VSAT L SRKWAKR+PIK++SKS+ IYKGS+ FYIYLETSW+KESWCKALR
Sbjct  131  QLKGCTIEAVSATSLPSRKWAKRFPIKLDSKSTIIYKGSKVFYIYLETSWEKESWCKALR  190

Query  617  LAS  625
            LAS
Sbjct  191  LAS  193


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 81/146 (55%), Gaps = 11/146 (8%)
 Frame = +3

Query  81   MWQFVL----VFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSA--ELSSPPGLD  242
            MW  +L     F+ G + ++  E      +I  L  +  +  +K  +    E+ S P L 
Sbjct  1    MWSCLLWLSVGFVAGVVAILAAEVLVVHVVINRLQHKTKQHQEKEAIQKYQEIESKPDLH  60

Query  243  PSY-----YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFL  407
            P         K+G VW+L+ EK+P+   +KAL ++K KKE  EVSPI+KYAKIK+  L L
Sbjct  61   PRQALEFASIKEGAVWVLEPEKVPKNWQEKALREQKRKKEFFEVSPIKKYAKIKNQLLIL  120

Query  408  LESDGSNTEIQLRGCTIAAFLQQACP  485
            +ESDGS T IQL+GCTI A    + P
Sbjct  121  IESDGSQTAIQLKGCTIEAVSATSLP  146



>ref|XP_007210364.1| hypothetical protein PRUPE_ppa001510mg [Prunus persica]
 gb|EMJ11563.1| hypothetical protein PRUPE_ppa001510mg [Prunus persica]
Length=811

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 3/63 (5%)
 Frame = +2

Query  446  RLYNCS---VSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  616
            +L  C+   VSAT L SRKWAKR+PIK++SKS+ IYKGS+ FYIYLETSW+KESWCKALR
Sbjct  131  QLKGCTIEAVSATSLPSRKWAKRFPIKLDSKSTIIYKGSKVFYIYLETSWEKESWCKALR  190

Query  617  LAS  625
            LAS
Sbjct  191  LAS  193


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 81/146 (55%), Gaps = 11/146 (8%)
 Frame = +3

Query  81   MWQFVL----VFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKV--SAELSSPPGLD  242
            MW  +L     F+ G + ++  E      ++  L  +  +  +K  +  S E+ S P L 
Sbjct  1    MWSCLLWLSVGFVAGVVAILAAEVLVVYVVVNRLQHKTKQHQEKEAIQKSQEIESKPDLH  60

Query  243  PSY-----YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFL  407
            P         K+G VW+LD EK+P+   +KAL ++K KKE  EVSP++KYAKIK+  L L
Sbjct  61   PRQALEFASIKEGAVWVLDPEKVPKNWQEKALREQKRKKEFFEVSPVKKYAKIKNQLLIL  120

Query  408  LESDGSNTEIQLRGCTIAAFLQQACP  485
             ESDGS T IQL+GCTI A    + P
Sbjct  121  TESDGSQTAIQLKGCTIEAVSATSLP  146



>emb|CDP18515.1| unnamed protein product [Coffea canephora]
Length=664

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  458  CSVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
             +VSAT L SRKWAK+YPIKVE+K + +YKGS TFYIYLETSW+KESWCKALRLAS
Sbjct  3    AAVSATSLPSRKWAKKYPIKVENKETTLYKGSTTFYIYLETSWEKESWCKALRLAS  58



>ref|XP_010248365.1| PREDICTED: uncharacterized protein LOC104591254 [Nelumbo nucifera]
Length=796

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 55/66 (83%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T +L  C   +VS + LSS+KWAKRYPIKVES+ S IY GS+TFY+YLETSW+KE+WCK
Sbjct  116  ATIQLVGCIVLAVSGSNLSSKKWAKRYPIKVESRDSVIYNGSKTFYVYLETSWEKEAWCK  175

Query  608  ALRLAS  625
            ALRLA+
Sbjct  176  ALRLAA  181


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 72/116 (62%), Gaps = 3/116 (3%)
 Frame = +3

Query  120  TVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIP  299
            TV+ VE    + ++  L+R+      K+    +L S   +    YNKQG+VW+L+ E++ 
Sbjct  14   TVIVVEVLGFLHILDRLARKKEVGRRKSLSDGDLDSEQSI-AFAYNKQGVVWVLESERVS  72

Query  300  RA-PVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAA  464
            +  P +K L ++K+ KE+LEVSP++K+AKIK+ SL L + DGS   IQL GC + A
Sbjct  73   KLWPEEKVLREQKN-KEILEVSPVKKHAKIKNRSLVLTDPDGSQATIQLVGCIVLA  127



>ref|XP_006390581.1| hypothetical protein EUTSA_v10018153mg [Eutrema salsugineum]
 gb|ESQ27867.1| hypothetical protein EUTSA_v10018153mg [Eutrema salsugineum]
Length=779

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 55/70 (79%), Gaps = 6/70 (9%)
 Frame = +2

Query  434  NSTQR---LYNCSVSATG---LSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKE  595
            N+TQ    L  CSV A     L +RKWAKR+PI+VESK+S +YKG+R FYIYLETSW+KE
Sbjct  121  NNTQTIITLKGCSVDAVSGSELPTRKWAKRFPIQVESKTSELYKGNRVFYIYLETSWEKE  180

Query  596  SWCKALRLAS  625
            SWCKALRLA+
Sbjct  181  SWCKALRLAA  190


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 79/135 (59%), Gaps = 3/135 (2%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELS--SPPGLDPSYYNKQ  263
            FV  F+LG LT+V  E A  ++L+  L+R+ +R+         L+   PP       NKQ
Sbjct  9    FVTGFLLGILTIVTAELAGFLYLLNRLNRKRNRQESSTGSDPALTEFDPPQSSALSLNKQ  68

Query  264  GIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  440
            G++W+L+L E +     +K   ++K KK++L+V P++K+A+IKDH L L E++ + T I 
Sbjct  69   GVIWVLELDESLKEWMKEKLPKEQKKKKDLLDVHPVRKFARIKDHKLILSETNNTQTIIT  128

Query  441  LRGCTIAAFLQQACP  485
            L+GC++ A      P
Sbjct  129  LKGCSVDAVSGSELP  143



>ref|XP_010662022.1| PREDICTED: uncharacterized protein LOC100244234 isoform X2 [Vitis 
vinifera]
Length=796

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  458  CSVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
             +VSAT L S+KWAK+YPIKVESK+  IY GS+TFY+YLETSW+KESWCKALRLAS
Sbjct  128  VAVSATDLPSKKWAKKYPIKVESKTLEIYNGSKTFYLYLETSWEKESWCKALRLAS  183


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 2/142 (1%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNK  260
            M+   + F+LGA T++ V+    + LI  L     ++ +   ++ +L     LD S Y K
Sbjct  2    MFTLFVGFLLGAFTILLVQVLGLLLLIGRLGHGRKQDSESPLLTRDLDLHQSLD-SAYKK  60

Query  261  QGIVWILDLEKIPRAP-VDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  437
            QG++WIL+ EK+P  P + K     K KKE+LEV P++KYA+IKD SL L ESDGS T I
Sbjct  61   QGVIWILEPEKVPTFPQIGKIQRDAKKKKEILEVFPMRKYARIKDRSLILTESDGSYTAI  120

Query  438  QLRGCTIAAFLQQACPQENGQK  503
             L+GCTI A      P +   K
Sbjct  121  PLKGCTIVAVSATDLPSKKWAK  142



>gb|KFK41758.1| hypothetical protein AALP_AA2G168400 [Arabis alpina]
Length=764

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 3/62 (5%)
 Frame = +2

Query  449  LYNCSVSA---TGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  619
            L  CSV A   + L +RKWAKR+PI++ESKSS +YKG+  FYIYLETSW+KESWCKALRL
Sbjct  124  LKGCSVDAVSGSALPTRKWAKRFPIQIESKSSVLYKGNHVFYIYLETSWEKESWCKALRL  183

Query  620  AS  625
            A+
Sbjct  184  AA  185


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 83/135 (61%), Gaps = 8/135 (6%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
            FV  F+LG L++V +E A  +F+++    RL+R+ +  + ++       +D +  NKQG+
Sbjct  9    FVSGFLLGILSIVAIEVAGFLFIVK----RLNRKRNPHESNSNSDPTQSIDFTL-NKQGV  63

Query  270  VWILDL-EKIPRAPVDKALG--QKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  440
            +W+L+L E +     +  L   QKK + E+LEV P++++A+IKDH L L  +DGS T+I 
Sbjct  64   IWMLELDESLKDWTKENGLQKEQKKKRGEILEVHPVRRFARIKDHKLILTNADGSTTDIA  123

Query  441  LRGCTIAAFLQQACP  485
            L+GC++ A    A P
Sbjct  124  LKGCSVDAVSGSALP  138



>ref|NP_173224.2| putative integral membrane protein conserved region (DUF2404) 
[Arabidopsis thaliana]
 gb|AAM91570.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ56797.1| At1g17820 [Arabidopsis thaliana]
 gb|AEE29640.1| putative integral membrane protein conserved region (DUF2404) 
[Arabidopsis thaliana]
Length=803

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 4/67 (6%)
 Frame = +2

Query  437  STQRLYNCS---VSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWC  604
            +T  L  CS   VS + L +RKWAKR+PIKVESK S A+YKG++ FYIYLETSW+KESWC
Sbjct  128  TTVSLIGCSIEAVSGSDLPTRKWAKRFPIKVESKISPALYKGNQVFYIYLETSWEKESWC  187

Query  605  KALRLAS  625
            KALRLAS
Sbjct  188  KALRLAS  194


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 77/140 (55%), Gaps = 25/140 (18%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY------  251
            F+  F LG L V+  EAA  ++L++ L+R+  R          + S P  DPS       
Sbjct  10   FLSGFFLGILAVLSAEAAGFMYLLKRLNRKRDR----------IESKPVSDPSIKDFNPR  59

Query  252  ------YNKQGIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLL  410
                   NKQG+VWIL+L E +     +K   ++K K+ +LE+ P++K+A+IKDH L L 
Sbjct  60   ESIDFCINKQGVVWILELDEGLKNWMKEKLPKEQKRKRGLLEIHPLRKFARIKDHKLILS  119

Query  411  ESDGSNTE--IQLRGCTIAA  464
            ++D + +E  + L GC+I A
Sbjct  120  DADSTQSETTVSLIGCSIEA  139



>gb|AAF97262.1|AC034106_5 Strong similarity to a hypothetical protein T18K17.13 gi|6598861 
from Arabidopsis thaliana BAC T18K17 gb|AC010556 and contains 
a PH PF|00169 domain [Arabidopsis thaliana]
Length=797

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 4/67 (6%)
 Frame = +2

Query  437  STQRLYNCS---VSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWC  604
            +T  L  CS   VS + L +RKWAKR+PIKVESK S A+YKG++ FYIYLETSW+KESWC
Sbjct  128  TTVSLIGCSIEAVSGSDLPTRKWAKRFPIKVESKISPALYKGNQVFYIYLETSWEKESWC  187

Query  605  KALRLAS  625
            KALRLAS
Sbjct  188  KALRLAS  194


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 77/140 (55%), Gaps = 25/140 (18%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY------  251
            F+  F LG L V+  EAA  ++L++ L+R+  R          + S P  DPS       
Sbjct  10   FLSGFFLGILAVLSAEAAGFMYLLKRLNRKRDR----------IESKPVSDPSIKDFNPR  59

Query  252  ------YNKQGIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLL  410
                   NKQG+VWIL+L E +     +K   ++K K+ +LE+ P++K+A+IKDH L L 
Sbjct  60   ESIDFCINKQGVVWILELDEGLKNWMKEKLPKEQKRKRGLLEIHPLRKFARIKDHKLILS  119

Query  411  ESDGSNTE--IQLRGCTIAA  464
            ++D + +E  + L GC+I A
Sbjct  120  DADSTQSETTVSLIGCSIEA  139



>ref|XP_010687269.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=787

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 81/141 (57%), Gaps = 14/141 (10%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPG-LDP----  245
            M    L FILG L V+ +E    +F+IR L+     +  K+  S  ++SP   LDP    
Sbjct  3    MILLFLGFILGVLAVIALEGLVILFVIRRLT-----QTTKSTESVLVNSPQNTLDPGQSL  57

Query  246  -SYYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  422
             S   KQG VW+L+ +K P+ P   A  ++  KK++LEVSP+QK+A+IKD +L L E+DG
Sbjct  58   TSLCQKQGFVWVLEPDKHPKVP---ASAEQTRKKDILEVSPVQKHAEIKDRTLILTEADG  114

Query  423  SNTEIQLRGCTIAAFLQQACP  485
            S   I+L+GC + A      P
Sbjct  115  SLATIKLKGCLVVAVSATTFP  135


 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T +L  C   +VSAT   SRKWAKR+PIKVESK++A+Y+GS+ F IY ETS +KESWC+
Sbjct  117  ATIKLKGCLVVAVSATTFPSRKWAKRFPIKVESKNTALYQGSKVFLIYAETSSEKESWCR  176

Query  608  ALRLAS  625
            ALRLAS
Sbjct  177  ALRLAS  182



>ref|XP_010687270.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687271.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Beta vulgaris subsp. vulgaris]
Length=771

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 81/141 (57%), Gaps = 14/141 (10%)
 Frame = +3

Query  81   MWQFVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPG-LDP----  245
            M    L FILG L V+ +E    +F+IR L+     +  K+  S  ++SP   LDP    
Sbjct  3    MILLFLGFILGVLAVIALEGLVILFVIRRLT-----QTTKSTESVLVNSPQNTLDPGQSL  57

Query  246  -SYYNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG  422
             S   KQG VW+L+ +K P+ P   A  ++  KK++LEVSP+QK+A+IKD +L L E+DG
Sbjct  58   TSLCQKQGFVWVLEPDKHPKVP---ASAEQTRKKDILEVSPVQKHAEIKDRTLILTEADG  114

Query  423  SNTEIQLRGCTIAAFLQQACP  485
            S   I+L+GC + A      P
Sbjct  115  SLATIKLKGCLVVAVSATTFP  135


 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T +L  C   +VSAT   SRKWAKR+PIKVESK++A+Y+GS+ F IY ETS +KESWC+
Sbjct  117  ATIKLKGCLVVAVSATTFPSRKWAKRFPIKVESKNTALYQGSKVFLIYAETSSEKESWCR  176

Query  608  ALRLAS  625
            ALRLAS
Sbjct  177  ALRLAS  182



>ref|XP_009408154.1| PREDICTED: uncharacterized protein LOC103990667 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=799

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            N T +L  C   +VSA+ LSSRKWAKRYPIK+ESK S IYK S+T Y+Y +TSW+KESWC
Sbjct  121  NITIQLVGCMVVAVSASNLSSRKWAKRYPIKLESKESKIYKESKTCYLYFDTSWEKESWC  180

Query  605  KALRLAS  625
            KALRLAS
Sbjct  181  KALRLAS  187


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 78/131 (60%), Gaps = 8/131 (6%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAK---VSAELSSPPGLDPSYYNK  260
            F+L F++G   +V VE  A ++LI  L RR    V+ A+   V+ +L     L      K
Sbjct  5    FLLGFLVGFAALVAVEGLALLWLIDRL-RRKRPTVNAARPQPVAQDLGDERSLTVPL-EK  62

Query  261  QGIVWILDLEKIPRAPVDKALGQKKSKKE---VLEVSPIQKYAKIKDHSLFLLESDGSNT  431
            +G +W+L+ EK+P+   D++  ++  ++E   ++EV P++KYAKIKDHSL L + D SN 
Sbjct  63   KGSIWVLEPEKVPKIKTDESPTRRTKEQENKSIMEVIPVRKYAKIKDHSLILSDPDDSNI  122

Query  432  EIQLRGCTIAA  464
             IQL GC + A
Sbjct  123  TIQLVGCMVVA  133



>ref|XP_006599669.1| PREDICTED: uncharacterized protein LOC100812281 isoform X3 [Glycine 
max]
Length=815

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T +L  C   +VSAT L S+KWAK++PIKVE+K+S IY  S+TFYIYLET+ DKE+WC
Sbjct  122  HTTIQLKGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHASKTFYIYLETACDKEAWC  181

Query  605  KALRLAS  625
            KALRLAS
Sbjct  182  KALRLAS  188


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 79/134 (59%), Gaps = 2/134 (1%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPS--YYNKQ  263
             +L F+LG + VV  EA   +++I+ L  ++S++  K     +L       P      K+
Sbjct  8    ILLGFLLGVVAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGGAQSDHPQQQLLKKE  67

Query  264  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  443
            G+VW+L+ +K+ +  V+K   ++K KKEVLEV+P++KY KI   SL L ++DG +T IQL
Sbjct  68   GVVWVLEPDKVSKFWVEKQSKEQKRKKEVLEVTPVRKYGKINGQSLVLTDTDGFHTTIQL  127

Query  444  RGCTIAAFLQQACP  485
            +GC + A    + P
Sbjct  128  KGCLVEAVSATSLP  141



>gb|KHN24469.1| Testis-expressed sequence 2 protein [Glycine soja]
Length=815

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T +L  C   +VSAT L S+KWAK++PIKVE+K+S IY  S+TFYIYLET+ DKE+WC
Sbjct  122  HTTIQLKGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHASKTFYIYLETACDKEAWC  181

Query  605  KALRLAS  625
            KALRLAS
Sbjct  182  KALRLAS  188


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 79/134 (59%), Gaps = 2/134 (1%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPS--YYNKQ  263
             +L F+LG + VV  EA   +++I+ L  ++S++  K     +L       P      K+
Sbjct  8    ILLGFLLGVVAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGGAQSDHPQQQLLKKE  67

Query  264  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  443
            G+VW+L+ +K+ +  V+K   ++K KKEVLEV+P++KY KI   SL L ++DG +T IQL
Sbjct  68   GVVWVLEPDKVSKFWVEKQSKEQKRKKEVLEVTPVRKYGKINGQSLVLTDTDGFHTTIQL  127

Query  444  RGCTIAAFLQQACP  485
            +GC + A    + P
Sbjct  128  KGCLVEAVSATSLP  141



>ref|XP_010239262.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Brachypodium distachyon]
Length=774

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +2

Query  440  TQRLYNCS---VSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  610
            T  L NCS   VSA+ L SRKWAKRYPIK+ESK S I KGS+  Y+Y++TSW+KESWCKA
Sbjct  104  TIELMNCSAVAVSASNLPSRKWAKRYPIKLESKGSEICKGSKVCYLYVDTSWEKESWCKA  163

Query  611  LRLAS  625
            LRLAS
Sbjct  164  LRLAS  168


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 42/89 (47%), Gaps = 5/89 (6%)
 Frame = +3

Query  234  GLDPSYYNKQGIVWILDLEKIPRAPVDKALGQ-----KKSKKEVLEVSPIQKYAKIKDHS  398
            G  P    KQG +W+L+ +K+P       L        K KK ++EV PI+  AKI  HS
Sbjct  33   GDRPLTTEKQGFLWMLEPQKMPNVSSSNQLPNGVQKDTKDKKNIVEVFPIRMLAKIDGHS  92

Query  399  LFLLESDGSNTEIQLRGCTIAAFLQQACP  485
            L L   DGS   I+L  C+  A      P
Sbjct  93   LILSGPDGSRITIELMNCSAVAVSASNLP  121



>ref|XP_010239258.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Brachypodium distachyon]
Length=793

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +2

Query  440  TQRLYNCS---VSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  610
            T  L NCS   VSA+ L SRKWAKRYPIK+ESK S I KGS+  Y+Y++TSW+KESWCKA
Sbjct  123  TIELMNCSAVAVSASNLPSRKWAKRYPIKLESKGSEICKGSKVCYLYVDTSWEKESWCKA  182

Query  611  LRLAS  625
            LRLAS
Sbjct  183  LRLAS  187


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 59/123 (48%), Gaps = 8/123 (7%)
 Frame = +3

Query  132  VEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPRAPV  311
             E AA V+ +R L RR  R  + A  + +LS   G  P    KQG +W+L+ +K+P    
Sbjct  21   AEGAALVWALRTLRRRGPRPPEAATAAVQLS---GDRPLTTEKQGFLWMLEPQKMPNVSS  77

Query  312  DKALGQ-----KKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCTIAAFLQQ  476
               L        K KK ++EV PI+  AKI  HSL L   DGS   I+L  C+  A    
Sbjct  78   SNQLPNGVQKDTKDKKNIVEVFPIRMLAKIDGHSLILSGPDGSRITIELMNCSAVAVSAS  137

Query  477  ACP  485
              P
Sbjct  138  NLP  140



>ref|XP_006599667.1| PREDICTED: uncharacterized protein LOC100812281 isoform X1 [Glycine 
max]
 ref|XP_006599668.1| PREDICTED: uncharacterized protein LOC100812281 isoform X2 [Glycine 
max]
Length=820

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T +L  C   +VSAT L S+KWAK++PIKVE+K+S IY  S+TFYIYLET+ DKE+WC
Sbjct  122  HTTIQLKGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHASKTFYIYLETACDKEAWC  181

Query  605  KALRLAS  625
            KALRLAS
Sbjct  182  KALRLAS  188


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 79/134 (59%), Gaps = 2/134 (1%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPS--YYNKQ  263
             +L F+LG + VV  EA   +++I+ L  ++S++  K     +L       P      K+
Sbjct  8    ILLGFLLGVVAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGGAQSDHPQQQLLKKE  67

Query  264  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  443
            G+VW+L+ +K+ +  V+K   ++K KKEVLEV+P++KY KI   SL L ++DG +T IQL
Sbjct  68   GVVWVLEPDKVSKFWVEKQSKEQKRKKEVLEVTPVRKYGKINGQSLVLTDTDGFHTTIQL  127

Query  444  RGCTIAAFLQQACP  485
            +GC + A    + P
Sbjct  128  KGCLVEAVSATSLP  141



>ref|XP_009127977.1| PREDICTED: uncharacterized protein LOC103852830 [Brassica rapa]
Length=739

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 47/74 (64%), Positives = 56/74 (76%), Gaps = 6/74 (8%)
 Frame = +2

Query  422  FQH*NSTQR---LYNCSVSATG---LSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETS  583
            F + + TQ+   L  CSV A     L +RKWAKRYPIKVESK+S + KGSR FYI+LETS
Sbjct  113  FSNGDGTQKIVSLKGCSVEAVSGSELPTRKWAKRYPIKVESKTSDLNKGSRVFYIFLETS  172

Query  584  WDKESWCKALRLAS  625
            W+KESWCKALRLA+
Sbjct  173  WEKESWCKALRLAA  186


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 78/135 (58%), Gaps = 7/135 (5%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
            F+  F+LG LT+V  E AA ++L++    RL+R+ +  + +   S PP       NKQG+
Sbjct  9    FITGFLLGILTIVAAEVAAFLYLLK----RLNRKRNLHESNKTSSDPPNSIDFSLNKQGV  64

Query  270  VWILDLEKIPRAPVDKALGQKKSKK---EVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  440
            +W+L+ ++  +  + + L ++++KK   ++LEV P++K A IKDH L     DG+   + 
Sbjct  65   IWVLESDESLKDWMKEKLPKEQNKKKKKDILEVHPVRKSAHIKDHKLIFSNGDGTQKIVS  124

Query  441  LRGCTIAAFLQQACP  485
            L+GC++ A      P
Sbjct  125  LKGCSVEAVSGSELP  139



>ref|XP_004512701.1| PREDICTED: uncharacterized protein LOC101503148 isoform X1 [Cicer 
arietinum]
Length=825

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            N+T +L  C   +VSAT L ++KWAK++PIKVE+K+S IY GS+T Y+YLETS +KE+WC
Sbjct  141  NTTIQLKGCLVEAVSATSLPTKKWAKKFPIKVENKTSVIYHGSKTLYVYLETSSEKEAWC  200

Query  605  KALRLAS  625
            KALRLAS
Sbjct  201  KALRLAS  207


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 80/151 (53%), Gaps = 25/151 (17%)
 Frame = +3

Query  102  FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSA-----ELSSPPGLDPSYYNK--  260
            F+LG + VV  E    +++++ L R+   + DKAK+S+     + S+    D  +  K  
Sbjct  12   FLLGVIVVVAAEFLGFLWILKRLRRKF--DSDKAKISSITQQLDRSASSQFDSHHSFKKE  69

Query  261  ----------------QGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKD  392
                            QG+VW+++ EK+ +  V+++  + K KKE+ EVSP++KY K+  
Sbjct  70   IVHVIDFGFGFGFGFLQGVVWVVEPEKVSKYWVERSSKEVKRKKELFEVSPVRKYGKLNG  129

Query  393  HSLFLLESDGSNTEIQLRGCTIAAFLQQACP  485
             SL L E DG NT IQL+GC + A    + P
Sbjct  130  QSLVLTEPDGLNTTIQLKGCLVEAVSATSLP  160



>ref|XP_004512702.1| PREDICTED: uncharacterized protein LOC101503148 isoform X2 [Cicer 
arietinum]
Length=808

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            N+T +L  C   +VSAT L ++KWAK++PIKVE+K+S IY GS+T Y+YLETS +KE+WC
Sbjct  124  NTTIQLKGCLVEAVSATSLPTKKWAKKFPIKVENKTSVIYHGSKTLYVYLETSSEKEAWC  183

Query  605  KALRLAS  625
            KALRLAS
Sbjct  184  KALRLAS  190


 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 81/134 (60%), Gaps = 8/134 (6%)
 Frame = +3

Query  102  FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSA-----ELSSPPGLDPSY-YNKQ  263
            F+LG + VV  E    +++++ L R+   + DKAK+S+     + S+    D  + + K+
Sbjct  12   FLLGVIVVVAAEFLGFLWILKRLRRKF--DSDKAKISSITQQLDRSASSQFDSHHSFKKE  69

Query  264  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  443
            G+VW+++ EK+ +  V+++  + K KKE+ EVSP++KY K+   SL L E DG NT IQL
Sbjct  70   GVVWVVEPEKVSKYWVERSSKEVKRKKELFEVSPVRKYGKLNGQSLVLTEPDGLNTTIQL  129

Query  444  RGCTIAAFLQQACP  485
            +GC + A    + P
Sbjct  130  KGCLVEAVSATSLP  143



>ref|XP_008802615.1| PREDICTED: uncharacterized protein LOC103716408 [Phoenix dactylifera]
Length=804

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/66 (67%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T  L +C+V   SA+ LSSRKWAKRYPIK+ESK S IY GS+  Y+Y +TSW+KESWCK
Sbjct  122  ATIELLDCTVVAVSASNLSSRKWAKRYPIKLESKDSVIYSGSKMCYLYADTSWEKESWCK  181

Query  608  ALRLAS  625
            ALRLAS
Sbjct  182  ALRLAS  187


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 16/135 (12%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLS------REVDKAKVSAELSSPPGLDPSY  251
            F+L F LG   +V VE    +++I  L R+ +      REV +   S  L + P      
Sbjct  5    FLLGFFLGVAALVVVEGLTVLWVIDRLRRKGAVVEPPEREVGRDVESERLPTYP------  58

Query  252  YNKQGIVWILDLEKIPRAPVD----KALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESD  419
             NKQG++W+L+ EK+P+   D    +   ++K KK ++EV P +K AKIKDH L L + D
Sbjct  59   CNKQGVLWVLEQEKVPKVNTDGSPTRGSKEQKYKKNIVEVFPAKKIAKIKDHVLILSDQD  118

Query  420  GSNTEIQLRGCTIAA  464
            GS   I+L  CT+ A
Sbjct  119  GSQATIELLDCTVVA  133



>ref|XP_002892968.1| hypothetical protein ARALYDRAFT_889192 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69227.1| hypothetical protein ARALYDRAFT_889192 [Arabidopsis lyrata subsp. 
lyrata]
Length=797

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = +2

Query  437  STQRLYNCS---VSATGLSSRKWAKRYPIKVESK-SSAIYKGSRTFYIYLETSWDKESWC  604
            +T  L  CS   VS + L +RKWAKR+PIKVE K S A+YKG++ FYIYLETSW+KESWC
Sbjct  128  TTVSLKGCSIEAVSGSDLPTRKWAKRFPIKVEGKISPALYKGNQVFYIYLETSWEKESWC  187

Query  605  KALRLAS  625
            KALRLA+
Sbjct  188  KALRLAA  194


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 77/140 (55%), Gaps = 25/140 (18%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY------  251
            F+  F LG L V+  EAA  ++L++  +R+  R          + S P  DPS       
Sbjct  10   FLSGFFLGILAVLAAEAAGLMYLLKRFNRKRDR----------IESKPVSDPSTKDFDPR  59

Query  252  ------YNKQGIVWILDL-EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLL  410
                   NKQG+VWIL+L E I     +K   ++K K+ +LE+ P++K+A+IKDH L L 
Sbjct  60   ESIDFCINKQGVVWILELDEGIKNWMKEKLPKEQKRKRHLLEIHPLRKFARIKDHKLILS  119

Query  411  ESDG--SNTEIQLRGCTIAA  464
            ++DG  S T + L+GC+I A
Sbjct  120  DADGTQSQTTVSLKGCSIEA  139



>ref|XP_004234314.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Solanum lycopersicum]
Length=689

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  488  RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            RKWAKRYPIKVES +SA+YKGSR FY+YLETSW+KE+WCKALRLAS
Sbjct  13   RKWAKRYPIKVESGASAVYKGSRIFYLYLETSWEKEAWCKALRLAS  58



>ref|XP_007161563.1| hypothetical protein PHAVU_001G080200g [Phaseolus vulgaris]
 gb|ESW33557.1| hypothetical protein PHAVU_001G080200g [Phaseolus vulgaris]
Length=787

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/67 (66%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T  L  CSV   SA+ LSSRKWAK++PIKVESK S IY G++T YIYL+TSW+KE+WC
Sbjct  118  HTTIELKGCSVQAVSASILSSRKWAKKFPIKVESKISVIYNGNKTIYIYLDTSWEKEAWC  177

Query  605  KALRLAS  625
            KAL LAS
Sbjct  178  KALYLAS  184


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 75/131 (57%), Gaps = 13/131 (10%)
 Frame = +3

Query  90   FVLV-FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY-----  251
             VLV F LG L VV  EA   +++++ L  R     D+A  S++  +   LDP       
Sbjct  7    LVLVGFGLGVLAVVAAEALGLLWIMKRL--RHKSNNDEAYFSSKTLTTELLDPQQSLDFA  64

Query  252  YNKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNT  431
            + KQG+VW+L+  KI      K   ++K K ++LEVSP++ Y +IK  SL L + DG +T
Sbjct  65   FRKQGVVWVLESGKIT-----KQSREQKKKSDLLEVSPVKMYGQIKGQSLILRKPDGLHT  119

Query  432  EIQLRGCTIAA  464
             I+L+GC++ A
Sbjct  120  TIELKGCSVQA  130



>ref|XP_010935611.1| PREDICTED: testis-expressed sequence 2 protein-like [Elaeis guineensis]
Length=804

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T  L +C   +VSA+ LSSRKWAKRYPI++ESK S +Y GS+  Y+Y++TSW+KESWCK
Sbjct  122  ATIELLDCMVVAVSASNLSSRKWAKRYPIRLESKDSVLYGGSKICYLYVDTSWEKESWCK  181

Query  608  ALRLAS  625
            ALRLAS
Sbjct  182  ALRLAS  187


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 73/130 (56%), Gaps = 6/130 (5%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSY-YNKQG  266
            F L F LG   +V VE  AA+++I  L RR    VD  +V           P+Y  NKQG
Sbjct  5    FFLGFFLGVAALVAVEVLAALWIIDRL-RRKGPAVDPREVEVGRDLEVERAPTYPCNKQG  63

Query  267  IVWILDLEKIPRAPVD----KALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  434
            +VW+++ EK+P+   D    +   ++K KK ++EV P +K+AKIKDH L L + DGS   
Sbjct  64   VVWVIEPEKVPKVNTDGSPTRGSKEQKHKKNIVEVFPAKKFAKIKDHVLILSDQDGSQAT  123

Query  435  IQLRGCTIAA  464
            I+L  C + A
Sbjct  124  IELLDCMVVA  133



>dbj|BAD23057.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE58095.1| hypothetical protein OsJ_08966 [Oryza sativa Japonica Group]
Length=819

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T +L NC+V   SA+ + SRKWAKRYPIK+ESK   IY GS+  Y+Y ETSW+KESWC
Sbjct  117  HTTIKLLNCTVFAVSASSMPSRKWAKRYPIKLESKEYQIYNGSKVCYLYAETSWEKESWC  176

Query  605  KALRLAS  625
            KALRLA+
Sbjct  177  KALRLAA  183


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = +3

Query  231  PGLDPSYYNKQGIVWILDLEKIPRAPVDK-ALG---QKKSKKEVLEVSPIQKYAKIKDHS  398
            PG  P  Y KQG +WIL+ EK P+A  ++ ++G   + K KK ++EV P ++ AKIK  S
Sbjct  48   PGERPFPYEKQGFLWILEPEKTPKASNERSSIGGPKETKEKKNIVEVFPAKRSAKIKGRS  107

Query  399  LFLLESDGSNTEIQLRGCTIAAFLQQACP  485
            L L   DG +T I+L  CT+ A    + P
Sbjct  108  LILSGPDGFHTTIKLLNCTVFAVSASSMP  136



>ref|XP_002453085.1| hypothetical protein SORBIDRAFT_04g038050 [Sorghum bicolor]
 gb|EES06061.1| hypothetical protein SORBIDRAFT_04g038050 [Sorghum bicolor]
Length=782

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T  L NC+V   SA+ + SRKWAKRYPIK+ESK S IY GS+  Y+Y +TSW+KESWCK
Sbjct  120  ATIELLNCTVLAVSASSMPSRKWAKRYPIKLESKDSEIYNGSKVCYLYTDTSWEKESWCK  179

Query  608  ALRLAS  625
            ALR+A+
Sbjct  180  ALRIAA  185


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 4/89 (4%)
 Frame = +3

Query  231  PGLDPSYYNKQGIVWILDLEKIPRAPVDK-ALG---QKKSKKEVLEVSPIQKYAKIKDHS  398
            PG  P  Y KQG +WIL+ EK+P+   ++ ++G   + K KK ++EV P +K AKI  HS
Sbjct  50   PGERPFPYEKQGSLWILEPEKMPKVSNERLSVGGPKETKDKKNIVEVFPAKKMAKINGHS  109

Query  399  LFLLESDGSNTEIQLRGCTIAAFLQQACP  485
            L L   DGS   I+L  CT+ A    + P
Sbjct  110  LCLSAPDGSQATIELLNCTVLAVSASSMP  138



>gb|EEC74285.1| hypothetical protein OsI_09535 [Oryza sativa Indica Group]
Length=819

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T +L NC+V   SA+ + SRKWAKRYPIK+ESK   IY GS+  Y+Y ETSW+KESWC
Sbjct  117  HTTIKLLNCTVFAVSASSMPSRKWAKRYPIKLESKEYQIYNGSKACYLYAETSWEKESWC  176

Query  605  KALRLAS  625
            KALRLA+
Sbjct  177  KALRLAA  183


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 53/89 (60%), Gaps = 4/89 (4%)
 Frame = +3

Query  231  PGLDPSYYNKQGIVWILDLEKIPRAPVDK-ALG---QKKSKKEVLEVSPIQKYAKIKDHS  398
            PG  P  Y KQG +WIL+ EK P+A  ++ ++G   + K KK ++EV P ++ AKIK  S
Sbjct  48   PGERPFPYEKQGFLWILEPEKTPKASNERSSIGGPKETKEKKNIVEVFPAKRSAKIKGRS  107

Query  399  LFLLESDGSNTEIQLRGCTIAAFLQQACP  485
            L L   DG +T I+L  CT+ A    + P
Sbjct  108  LILSGPDGFHTTIKLLNCTVFAVSASSMP  136



>ref|XP_004137541.1| PREDICTED: uncharacterized protein LOC101209104 [Cucumis sativus]
 gb|KGN64230.1| hypothetical protein Csa_1G043320 [Cucumis sativus]
Length=792

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 78/134 (58%), Gaps = 16/134 (12%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDP-----SYY  254
            F+  F+ G + +VG EA     ++  LS+R  +++ KA    + S    LDP        
Sbjct  9    FLFGFVFGVVAIVGAEAFGIFIILNKLSKRSQKDLAKANAKLDQSE---LDPLQSLEFLS  65

Query  255  NKQGIVWILD---LEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG-  422
            NKQG VWIL+   LE I    ++K   ++K +K+ LEV+P++KYA+IKDH+L + E DG 
Sbjct  66   NKQGSVWILESNVLEDI----IEKGPKEQKKRKDFLEVTPVKKYARIKDHTLVITELDGK  121

Query  423  SNTEIQLRGCTIAA  464
              T IQL GCT+ A
Sbjct  122  KRTTIQLNGCTVEA  135


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T +L  C+V   SAT L SRKW KR+P+ +E+++S IY  S+  +I+LETSW+KESWCK
Sbjct  124  TTIQLNGCTVEAVSATDLPSRKWVKRFPLILENRTSVIYHESKRIFIFLETSWEKESWCK  183

Query  608  ALRLAS  625
            ALRLAS
Sbjct  184  ALRLAS  189



>ref|XP_004164497.1| PREDICTED: uncharacterized LOC101209104 [Cucumis sativus]
Length=792

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 78/134 (58%), Gaps = 16/134 (12%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDP-----SYY  254
            F+  F+ G + +VG EA     ++  LS+R  +++ KA    + S    LDP        
Sbjct  9    FLFGFVFGVVAIVGAEAFGIFIILNKLSKRSQKDLAKANAKLDQSE---LDPLQSLEFLS  65

Query  255  NKQGIVWILD---LEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG-  422
            NKQG VWIL+   LE I    ++K   ++K +K+ LEV+P++KYA+IKDH+L + E DG 
Sbjct  66   NKQGSVWILESNVLEDI----IEKGPKEQKKRKDFLEVTPVKKYARIKDHTLVITELDGK  121

Query  423  SNTEIQLRGCTIAA  464
              T IQL GCT+ A
Sbjct  122  KRTTIQLNGCTVEA  135


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T +L  C+V   SAT L SRKW KR+P+ +E+++S IY  S+  +I+LETSW+KESWCK
Sbjct  124  TTIQLNGCTVEAVSATDLPSRKWVKRFPLILENRTSVIYHESKRIFIFLETSWEKESWCK  183

Query  608  ALRLAS  625
            ALRLAS
Sbjct  184  ALRLAS  189



>ref|XP_006649193.1| PREDICTED: testis-expressed sequence 2 protein-like [Oryza brachyantha]
Length=815

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T +L NC+V   SA+ + SRKWAKRYPIK+ESK   IY GS+  Y+Y ETSW+KESWCK
Sbjct  118  TTIKLLNCTVFAVSASSMQSRKWAKRYPIKLESKEYQIYNGSKACYLYAETSWEKESWCK  177

Query  608  ALRLAS  625
            ALRLA+
Sbjct  178  ALRLAA  183


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = +3

Query  231  PGLDPSYYNKQGIVWILDLEKIPRAPVDK-ALG---QKKSKKEVLEVSPIQKYAKIKDHS  398
            PG  P  Y KQG +WIL+ EK P+A  ++ ++G   + K KK ++EV P +K AKIK HS
Sbjct  48   PGERPFPYEKQGFLWILEPEKTPKANTERSSIGGPKEAKDKKNIVEVFPSKKSAKIKGHS  107

Query  399  LFLLESDGSNTEIQLRGCTIAA  464
            L L   DG  T I+L  CT+ A
Sbjct  108  LILSGPDGFQTTIKLLNCTVFA  129



>ref|XP_004495486.1| PREDICTED: testis-expressed sequence 2 protein-like [Cicer arietinum]
Length=787

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 52/65 (80%), Gaps = 3/65 (5%)
 Frame = +2

Query  440  TQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  610
            T  L  C+V   SA+ LSS+KW K++PIKVESK+S IY GS+T Y+YLETSW+KE+WCKA
Sbjct  120  TVELKGCTVQAVSASILSSKKWEKKFPIKVESKTSVIYNGSKTLYVYLETSWEKEAWCKA  179

Query  611  LRLAS  625
            L LAS
Sbjct  180  LFLAS  184


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 73/130 (56%), Gaps = 14/130 (11%)
 Frame = +3

Query  93   VLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAEL-SSPPGLDPSY-----Y  254
            +L F +G + V  +EA   +++++ L  +L  E        +L +S   LD        +
Sbjct  9    LLGFGVGVVAVFAIEAVGVLWIMKRLRHKLHTEQSNLSSQTQLDTSSKHLDHQQSLYFSF  68

Query  255  NKQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTE  434
            NKQG+VW+L+  +I + P        K K+E+LEVSPI+ Y +IK  SL L ESDG +  
Sbjct  69   NKQGVVWVLESGQISKEP--------KRKEELLEVSPIKMYGQIKGQSLILRESDGLHKT  120

Query  435  IQLRGCTIAA  464
            ++L+GCT+ A
Sbjct  121  VELKGCTVQA  130



>ref|XP_006587408.1| PREDICTED: uncharacterized protein LOC100787320 isoform X2 [Glycine 
max]
Length=800

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T +L  C   +VSAT L S+KWAK++PIKVE+K+S IY GS+TF IYLET+ +KE+WC
Sbjct  123  HTTIQLKGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHGSKTFCIYLETACEKEAWC  182

Query  605  KALRLAS  625
            KALRLAS
Sbjct  183  KALRLAS  189


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 82/142 (58%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   FVLVF---ILGALTVVGVEAAAAVFLIRWLSRRLSREV--DKAKVSA--ELSSPPGLDPS  248
             VLVF   +LG L  V    AA      W+ +RL  ++  D+AK+++  +L S     P 
Sbjct  1    MVLVFALILLGFLLGVAAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGSAQSDRPQ  60

Query  249  --YYNKQGIVWILDLEKIPRAPVDKALGQK-KSKKEVLEVSPIQKYAKIKDHSLFLLESD  419
                 K+G+VW+L+ +K+ +  V+K   ++ K KKEVLEV+P++KY KI   SL L ++D
Sbjct  61   QQLLKKEGVVWVLEPDKVSKFWVEKQSSKELKRKKEVLEVTPVRKYGKINGQSLVLTDAD  120

Query  420  GSNTEIQLRGCTIAAFLQQACP  485
            G +T IQL+GC + A    + P
Sbjct  121  GFHTTIQLKGCLVEAVSATSLP  142



>gb|KHM99770.1| Testis-expressed sequence 2 protein [Glycine soja]
Length=800

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T +L  C   +VSAT L S+KWAK++PIKVE+K+S IY GS+TF IYLET+ +KE+WC
Sbjct  123  HTTIQLKGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHGSKTFCIYLETACEKEAWC  182

Query  605  KALRLAS  625
            KALRLAS
Sbjct  183  KALRLAS  189


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 82/142 (58%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   FVLVF---ILGALTVVGVEAAAAVFLIRWLSRRLSREV--DKAKVSA--ELSSPPGLDPS  248
             VLVF   +LG L  V    AA      W+ +RL  ++  D+AK+++  +L S     P 
Sbjct  1    MVLVFALILLGFLLGVAAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGSAQSDHPQ  60

Query  249  --YYNKQGIVWILDLEKIPRAPVDKALGQK-KSKKEVLEVSPIQKYAKIKDHSLFLLESD  419
                 K+G+VW+L+ +K+ +  V+K   ++ K KKEVLEV+P++KY KI   SL L ++D
Sbjct  61   QQLLKKEGVVWVLEPDKVSKFWVEKQSSKELKRKKEVLEVTPVRKYGKINGQSLVLTDAD  120

Query  420  GSNTEIQLRGCTIAAFLQQACP  485
            G +T IQL+GC + A    + P
Sbjct  121  GFHTTIQLKGCLVEAVSATSLP  142



>ref|XP_004954472.1| PREDICTED: uncharacterized protein LOC101777078 [Setaria italica]
Length=890

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T  L NC+V   SA+ + SRKWAKRYPIK+ESK S IY GS+  Y+Y +TSW+KESWCK
Sbjct  199  ATIELLNCTVLAVSASSMPSRKWAKRYPIKLESKDSEIYNGSKVCYLYTDTSWEKESWCK  258

Query  608  ALRLAS  625
            ALR+A+
Sbjct  259  ALRVAA  264


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 5/90 (6%)
 Frame = +3

Query  231  PGLDP-SYYNKQGIVWILDLEKIPRAPVDK-ALG---QKKSKKEVLEVSPIQKYAKIKDH  395
            PG  P  YY K+G +WIL+ EKIP+   ++ ++G   + K KK + EV P +K AKIK H
Sbjct  128  PGERPFPYYEKKGSLWILEPEKIPKVSNERLSVGGPKETKDKKNIAEVFPAKKMAKIKGH  187

Query  396  SLFLLESDGSNTEIQLRGCTIAAFLQQACP  485
            SL L   DGS   I+L  CT+ A    + P
Sbjct  188  SLCLSGPDGSQATIELLNCTVLAVSASSMP  217



>ref|XP_003573002.1| PREDICTED: testis-expressed sequence 2 protein-like [Brachypodium 
distachyon]
Length=799

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T  L NC+V   SA+ ++SRKW KRYPIK+ES+ S IY GS+  Y+Y ETSW+KESWCK
Sbjct  120  TTIELLNCTVVAVSASSMASRKWTKRYPIKLESQESEIYNGSKVCYLYAETSWEKESWCK  179

Query  608  ALRLAS  625
            ALRLA+
Sbjct  180  ALRLAA  185


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 4/82 (5%)
 Frame = +3

Query  231  PGLDPSYYNKQGIVWILDLEKIPRAPVDK--ALGQKKS--KKEVLEVSPIQKYAKIKDHS  398
            PG  P  Y K+G +WIL+ EK+P+   D+  + G K++  KK V+EV P +K AKIK H+
Sbjct  50   PGERPFPYEKKGSLWILEPEKLPKVSNDRLSSGGPKEANDKKNVVEVFPAKKMAKIKGHT  109

Query  399  LFLLESDGSNTEIQLRGCTIAA  464
            L L   DG+ T I+L  CT+ A
Sbjct  110  LSLSGPDGAGTTIELLNCTVVA  131



>ref|XP_006587407.1| PREDICTED: uncharacterized protein LOC100787320 isoform X1 [Glycine 
max]
Length=805

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 55/67 (82%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T +L  C   +VSAT L S+KWAK++PIKVE+K+S IY GS+TF IYLET+ +KE+WC
Sbjct  123  HTTIQLKGCLVEAVSATSLPSKKWAKKFPIKVEAKTSVIYHGSKTFCIYLETACEKEAWC  182

Query  605  KALRLAS  625
            KALRLAS
Sbjct  183  KALRLAS  189


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 82/142 (58%), Gaps = 10/142 (7%)
 Frame = +3

Query  90   FVLVF---ILGALTVVGVEAAAAVFLIRWLSRRLSREV--DKAKVSA--ELSSPPGLDPS  248
             VLVF   +LG L  V    AA      W+ +RL  ++  D+AK+++  +L S     P 
Sbjct  1    MVLVFALILLGFLLGVAAVVAAEALGFLWVIKRLQSKISKDQAKIASKTQLGSAQSDRPQ  60

Query  249  --YYNKQGIVWILDLEKIPRAPVDKALGQK-KSKKEVLEVSPIQKYAKIKDHSLFLLESD  419
                 K+G+VW+L+ +K+ +  V+K   ++ K KKEVLEV+P++KY KI   SL L ++D
Sbjct  61   QQLLKKEGVVWVLEPDKVSKFWVEKQSSKELKRKKEVLEVTPVRKYGKINGQSLVLTDAD  120

Query  420  GSNTEIQLRGCTIAAFLQQACP  485
            G +T IQL+GC + A    + P
Sbjct  121  GFHTTIQLKGCLVEAVSATSLP  142



>gb|KEH42874.1| integral membrane protein, putative [Medicago truncatula]
Length=798

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            +ST  L  C+V   SA+ LSS+KWAK++PIKVESK+S IYK S+  Y+YLETSW+KE+WC
Sbjct  118  HSTIELKGCTVQAVSASILSSKKWAKKFPIKVESKTSVIYKRSKILYVYLETSWEKEAWC  177

Query  605  KALRLAS  625
            KAL LAS
Sbjct  178  KALYLAS  184


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 71/131 (54%), Gaps = 17/131 (13%)
 Frame = +3

Query  93   VLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYY-----N  257
            +L F  G + VV V+A A +++I+ L R         +V A  SS   LD          
Sbjct  10   LLGFTFGVVAVVTVQAIAFLWIIKRL-RHSHNHSSHTQVLA-TSSTDQLDHQQSLHFASQ  67

Query  258  KQGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDG--SNT  431
            KQG+VW+L+  KI + P        K K E+LEVSPI+ Y KIKD SL L ESD    ++
Sbjct  68   KQGVVWVLESGKISKEP--------KRKDELLEVSPIKMYGKIKDQSLILRESDNLQLHS  119

Query  432  EIQLRGCTIAA  464
             I+L+GCT+ A
Sbjct  120  TIELKGCTVQA  130



>ref|XP_008645131.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Zea mays]
Length=691

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 3/65 (5%)
 Frame = +2

Query  440  TQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  610
            T  L  C+V   SA+ L SRKWAKRYPIK+ESK S I +GS+  Y+Y +TSW+KESWCKA
Sbjct  52   TIDLLGCTVAAVSASNLPSRKWAKRYPIKLESKESGICRGSKVCYVYADTSWEKESWCKA  111

Query  611  LRLAS  625
            LRLAS
Sbjct  112  LRLAS  116



>ref|XP_008645130.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X1 
[Zea mays]
 gb|AFW69648.1| hypothetical protein ZEAMMB73_139782 [Zea mays]
Length=762

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 50/65 (77%), Gaps = 3/65 (5%)
 Frame = +2

Query  440  TQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  610
            T  L  C+V   SA+ L SRKWAKRYPIK+ESK S I +GS+  Y+Y +TSW+KESWCKA
Sbjct  123  TIDLLGCTVAAVSASNLPSRKWAKRYPIKLESKESGICRGSKVCYVYADTSWEKESWCKA  182

Query  611  LRLAS  625
            LRLAS
Sbjct  183  LRLAS  187



>gb|KJB67990.1| hypothetical protein B456_010G220600 [Gossypium raimondii]
Length=759

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +VSAT L +RKWAKRYPIKVESK+  IY  S+  Y+YL+T+W+KESWCK LRLAS
Sbjct  124  AVSATSLPTRKWAKRYPIKVESKTKVIYNASKIIYLYLDTAWEKESWCKGLRLAS  178


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 46/140 (33%), Positives = 75/140 (54%), Gaps = 9/140 (6%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAE--LSSPPGLDPSYYNKQ  263
            F++ F+ G   ++  E    +F++  L+R++ + + K   +A+  + +P     S  N Q
Sbjct  5    FLVGFVAGICAILSFEVLVVLFVLNLLNRKIKQRIKKETHAADAAVRNPQDSFDSICNLQ  64

Query  264  GIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQL  443
            GIVW+L+  KIP         ++K K+E +EVSP +++AKI+D  L L  SD S T I L
Sbjct  65   GIVWVLEPGKIPTK-------EQKRKRETVEVSPARRHAKIQDGYLTLSNSDSSCTIIPL  117

Query  444  RGCTIAAFLQQACPQENGQK  503
            +GC I A    + P     K
Sbjct  118  KGCIIQAVSATSLPTRKWAK  137



>ref|XP_003535400.1| PREDICTED: uncharacterized protein LOC100816218 isoform X1 [Glycine 
max]
 gb|KHN14743.1| Testis-expressed sequence 2 protein [Glycine soja]
Length=789

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 75/128 (59%), Gaps = 16/128 (13%)
 Frame = +3

Query  102  FILGALTVVGVEAAAAVFLIRWLSRRLSREV--DKAKVSAELSSPPGLDPSY-----YNK  260
            F LG LTVV VEA      + W+ +RL  ++  D+A  S++  +   LDP       Y K
Sbjct  12   FGLGVLTVVAVEALG----LLWIMKRLRHKINNDEAYFSSKTPTTALLDPQQSLDFAYRK  67

Query  261  QGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  440
            QG+VW+L+  KI      K   ++K KKE LEVSP++ Y +IK  SL L E+DG +T I+
Sbjct  68   QGVVWVLESGKI-----SKPSREQKRKKETLEVSPVKTYGQIKGQSLILREADGLHTTIE  122

Query  441  LRGCTIAA  464
            L+GC + A
Sbjct  123  LKGCAVQA  130


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 53/67 (79%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T  L  C+V   SA+ LSSRKWAK +PIKVE+ +S IY G++T YIYL+TSW+KE+WC
Sbjct  118  HTTIELKGCAVQAVSASILSSRKWAKMFPIKVENTNSVIYNGNKTIYIYLDTSWEKEAWC  177

Query  605  KALRLAS  625
            KAL LAS
Sbjct  178  KALYLAS  184



>gb|AFW63912.1| hypothetical protein ZEAMMB73_732140 [Zea mays]
Length=796

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T  L NC+V   SA+ + SRKWAKR+P+K+ESK + IY GS+  Y+Y +TSW+KESWCK
Sbjct  120  ATIELLNCTVLAVSASSMPSRKWAKRFPVKLESKDNEIYNGSKVCYLYTDTSWEKESWCK  179

Query  608  ALRLAS  625
            ALR+A+
Sbjct  180  ALRIAA  185


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 4/89 (4%)
 Frame = +3

Query  231  PGLDPSYYNKQGIVWILDLEKIPRAPVDK--ALG--QKKSKKEVLEVSPIQKYAKIKDHS  398
            PG  P  Y KQG +WIL+ EK+P+   D+  A G  + K KK ++EV P +K AKIK +S
Sbjct  50   PGERPFPYEKQGFLWILEPEKMPKLSNDRLSAGGPRETKDKKNIVEVFPAKKMAKIKGNS  109

Query  399  LFLLESDGSNTEIQLRGCTIAAFLQQACP  485
            L L   DGS   I+L  CT+ A    + P
Sbjct  110  LCLSGPDGSQATIELLNCTVLAVSASSMP  138



>gb|KEH26662.1| integral membrane protein, putative [Medicago truncatula]
Length=754

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 54/67 (81%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T +L  C   +VSAT   ++KWAK+YPIKVE+++S IY GS+T Y+YLETS +KE+WC
Sbjct  75   HTTIQLKGCIVEAVSATSAPTKKWAKKYPIKVENRTSVIYHGSKTLYVYLETSSEKEAWC  134

Query  605  KALRLAS  625
            KALRLAS
Sbjct  135  KALRLAS  141


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  267  IVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLR  446
             +W+L+ EK+ +  V+++  + K KKE+ EVSP++KY  IK  SL L E DGS+T IQL+
Sbjct  22   FIWVLEPEKVSKYFVERSSKEVKRKKELFEVSPVRKYGNIKCQSLVLTEPDGSHTTIQLK  81

Query  447  GCTIAAFLQQACP  485
            GC + A    + P
Sbjct  82   GCIVEAVSATSAP  94



>ref|XP_009385248.1| PREDICTED: uncharacterized protein LOC103972625 [Musa acuminata 
subsp. malaccensis]
Length=795

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T  L +C+V   SA+   +RKWA RYPIK+ES ++ IY+GSRT Y+YL+TSW+KESWCK
Sbjct  126  ATIELLDCAVFAVSASDRETRKWANRYPIKLESMNADIYQGSRTCYVYLDTSWEKESWCK  185

Query  608  ALRLAS  625
            ALR AS
Sbjct  186  ALRFAS  191


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 10/133 (8%)
 Frame = +3

Query  96   LVF--ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAK--VSAELSSPPGLDPSYYNKQ  263
            LVF   +GA+ ++GVE   ++ L  W+S R  R     +       S      P+  NKQ
Sbjct  5    LVFGVFIGAIALLGVELLFSLLLYYWISGRRGRAPASPRRYNCCHDSDDERSLPAECNKQ  64

Query  264  GIVWILDLEKIPRAPVD---KALGQKKSKK--EVLEVSPIQKYAKIKDHSLFLLESDGSN  428
            GIVW+L+  K      D   +A G K+     E++EV P+ K+AKIK+H L L + D S 
Sbjct  65   GIVWVLEAAKAAEVGGDGGSQATGTKEEAGVVEIVEVYPVLKHAKIKNHKLILTDPDDSR  124

Query  429  T-EIQLRGCTIAA  464
            T  I+L  C + A
Sbjct  125  TATIELLDCAVFA  137



>ref|XP_002439079.1| hypothetical protein SORBIDRAFT_10g031200 [Sorghum bicolor]
 gb|EER90446.1| hypothetical protein SORBIDRAFT_10g031200 [Sorghum bicolor]
Length=777

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 51/65 (78%), Gaps = 3/65 (5%)
 Frame = +2

Query  440  TQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKA  610
            T  L +C+V   SA+ L SRKWAKRYPIK+ESK S I +GS+  Y+Y +TSW+KESWCKA
Sbjct  134  TIDLLSCTVVAVSASNLPSRKWAKRYPIKLESKESDICRGSKVCYVYADTSWEKESWCKA  193

Query  611  LRLAS  625
            LRLAS
Sbjct  194  LRLAS  198



>ref|XP_007152502.1| hypothetical protein PHAVU_004G135600g [Phaseolus vulgaris]
 gb|ESW24496.1| hypothetical protein PHAVU_004G135600g [Phaseolus vulgaris]
Length=808

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 3/63 (5%)
 Frame = +2

Query  446  RLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  616
            +L  CSV   SAT L S+KWAK+YPIKVE+K+S IY  S+T YIYLET+ +KE+WCKALR
Sbjct  125  QLKGCSVEAVSATSLPSKKWAKKYPIKVEAKTSVIYHRSKTLYIYLETACEKEAWCKALR  184

Query  617  LAS  625
            LAS
Sbjct  185  LAS  187


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 86/135 (64%), Gaps = 5/135 (4%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAEL---SSPPGLDPSYYNK  260
             +L FILG + VV  EA   +++++ L RR+SR  D+AK++++     S    +     K
Sbjct  8    ILLGFILGVVVVVAAEALGLLWVVKRLDRRISR--DQAKIASKTQLDGSQSDSNQQLLKK  65

Query  261  QGIVWILDLEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQ  440
            +G+VW+L+ +K+ +  V+K   ++K KK+V+EV+P++KY KI   SL + ++DG +T IQ
Sbjct  66   EGVVWVLEPDKVSKFWVEKQSKEQKKKKDVMEVTPVRKYGKINGQSLVITDADGFHTAIQ  125

Query  441  LRGCTIAAFLQQACP  485
            L+GC++ A    + P
Sbjct  126  LKGCSVEAVSATSLP  140



>gb|EMT17801.1| hypothetical protein F775_17825 [Aegilops tauschii]
Length=720

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 3/62 (5%)
 Frame = +2

Query  449  LYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  619
            L +C+V   SA+ L SRKW+KRYPIK+ESK S I K S+  Y+Y++TSW+KESWCKALRL
Sbjct  68   LLDCTVLAVSASNLPSRKWSKRYPIKLESKESEICKRSKVCYLYVDTSWEKESWCKALRL  127

Query  620  AS  625
            AS
Sbjct  128  AS  129


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 42/86 (49%), Gaps = 6/86 (7%)
 Frame = +3

Query  264  GIVWILDLEKIP------RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGS  425
            G +W+L+  K+P      R P        K KK ++EVSPI+  AKI+ HSL L  SDGS
Sbjct  3    GFLWMLEPGKVPKVRNGNRLPPTGVQKGVKDKKNIVEVSPIRMRAKIQGHSLVLTGSDGS  62

Query  426  NTEIQLRGCTIAAFLQQACPQENGQK  503
               I L  CT+ A      P     K
Sbjct  63   QITIGLLDCTVLAVSASNLPSRKWSK  88



>gb|EMS63454.1| hypothetical protein TRIUR3_21249 [Triticum urartu]
Length=637

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 3/62 (5%)
 Frame = +2

Query  449  LYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRL  619
            L +C+V   SA+ L SRKW+KRYPIK+ESK S I K S+  Y+Y++TSW+KESWCKALRL
Sbjct  127  LLDCTVLAVSASNLPSRKWSKRYPIKLESKGSEICKRSKVCYLYVDTSWEKESWCKALRL  186

Query  620  AS  625
            AS
Sbjct  187  AS  188


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 46/96 (48%), Gaps = 6/96 (6%)
 Frame = +3

Query  234  GLDPSYYNKQGIVWILDLEKIP------RAPVDKALGQKKSKKEVLEVSPIQKYAKIKDH  395
            G  P    KQG +W+L+  K+P      R P        K KK ++EVSPI+  AKI+ H
Sbjct  52   GDRPFPAEKQGFLWMLEPGKVPKVRNGNRLPPTGVQKGVKDKKNIVEVSPIRMRAKIQGH  111

Query  396  SLFLLESDGSNTEIQLRGCTIAAFLQQACPQENGQK  503
            SL L  SDGS   I L  CT+ A      P     K
Sbjct  112  SLVLTGSDGSQITIGLLDCTVLAVSASNLPSRKWSK  147



>ref|XP_008437259.1| PREDICTED: uncharacterized protein LOC103482740 [Cucumis melo]
Length=792

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            +T +L  C+V   SAT L SRKW KR+P+ +E+++S IY  S+  +I+LETSW+KESWCK
Sbjct  124  TTIQLNGCTVEAVSATDLPSRKWVKRFPLILENRTSVIYNESKRIFIFLETSWEKESWCK  183

Query  608  ALRLAS  625
            ALRLAS
Sbjct  184  ALRLAS  189


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 73/123 (59%), Gaps = 16/123 (13%)
 Frame = +3

Query  123  VVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDP-----SYYNKQGIVWILD-  284
            +V VEA     ++  LS+R  +++ KA    E S    LDP        NKQG VWIL+ 
Sbjct  20   IVAVEAFGIFIILNKLSKRSQKDLAKANAKLEQSE---LDPLQSLEFLSNKQGSVWILES  76

Query  285  --LEKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSN-TEIQLRGCT  455
              LE I    ++K   ++K +++ LEV+P++KYA+IKDH+L + E DG+  T IQL GCT
Sbjct  77   NVLEDI----IEKGPKEQKKRRDFLEVTPVKKYARIKDHTLMITELDGNKRTTIQLNGCT  132

Query  456  IAA  464
            + A
Sbjct  133  VEA  135



>ref|XP_010317541.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X3 
[Solanum lycopersicum]
Length=689

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  476  GLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            G   +  AKRYPIKVES +SA+YKGSR FY+YLETSW+KE+WCKALRLAS
Sbjct  9    GYKRQHEAKRYPIKVESGASAVYKGSRIFYLYLETSWEKEAWCKALRLAS  58



>dbj|BAK04177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=813

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 52/67 (78%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNCSVSATGLSS---RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T +L NC+V A   SS   RKWAKRYPIK+ES+ S IY GS+  ++Y ETSW+KESWC
Sbjct  118  DTTIKLLNCTVVAVSASSMSSRKWAKRYPIKLESQESEIYNGSKVCFLYAETSWEKESWC  177

Query  605  KALRLAS  625
            KALRLA+
Sbjct  178  KALRLAA  184


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 58/101 (57%), Gaps = 4/101 (4%)
 Frame = +3

Query  165  WLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWILDLEKIPRAPVDK----ALGQK  332
            W++RRL R  + A  + +    PG  P  Y K+G +WIL+ EK+P+   ++       + 
Sbjct  27   WVARRLRRRGEGAAAAPDAQELPGEQPFPYEKKGCLWILEPEKLPKVSNERLSSGGPKET  86

Query  333  KSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCT  455
            K KK ++EV P +K A+IK HSL L   DG +T I+L  CT
Sbjct  87   KEKKSIVEVFPAKKSAQIKGHSLCLSGPDGPDTTIKLLNCT  127



>gb|EMT07633.1| hypothetical protein F775_06998 [Aegilops tauschii]
Length=742

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNCSVSATGLSS---RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T  L NC+V A   SS   RKW KRYPIKVES+ S IY GS+  ++Y ETSW+KESWC
Sbjct  120  DTTIELLNCTVVAVSASSMSSRKWTKRYPIKVESQESEIYNGSKVCFLYAETSWEKESWC  179

Query  605  KALRLAS  625
            KALRLA+
Sbjct  180  KALRLAA  186


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = +3

Query  165  WLSRRLSREVDKAKVSAELSSP--PGLDPSYYNKQGIVWILDLEKIPRAPVDK----ALG  326
            W++RRL R  + A  +A+      PG  P    K+G +WIL+ EK+P+   ++       
Sbjct  27   WVARRLLRRQEAAAAAAQPGDQELPGEQPFPCEKKGSLWILEPEKLPKVSNERLSSGGPK  86

Query  327  QKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEIQLRGCT  455
            + K KK ++EV P +K AKIK HSL L   DG +T I+L  CT
Sbjct  87   ETKEKKSIVEVFPAKKSAKIKGHSLSLSGPDGPDTTIELLNCT  129



>gb|EMS68899.1| Testis-expressed sequence 2 protein [Triticum urartu]
Length=721

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 50/67 (75%), Gaps = 3/67 (4%)
 Frame = +2

Query  434  NSTQRLYNCSVSATGLSS---RKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWC  604
            ++T  L NC+V A   SS   RKW KRYPIKVES+ S IY GS+  ++Y ETSW+KESWC
Sbjct  81   DTTIELLNCTVVAVSASSMSSRKWTKRYPIKVESQESEIYNGSKVCFLYAETSWEKESWC  140

Query  605  KALRLAS  625
            KALRLA+
Sbjct  141  KALRLAA  147


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 4/68 (6%)
 Frame = +3

Query  264  GIVWILDLEKIPRAPVDK----ALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNT  431
            G +WIL+ EK+P+   ++       + K KK ++EV P +K AKIK HSL L   DG +T
Sbjct  23   GSLWILEPEKLPKVSNERLSSGGPKETKEKKSIVEVFPAKKSAKIKGHSLSLSGPDGPDT  82

Query  432  EIQLRGCT  455
             I+L  CT
Sbjct  83   TIELLNCT  90



>ref|XP_010419176.1| PREDICTED: uncharacterized protein LOC104704851 [Camelina sativa]
Length=518

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 75/137 (55%), Gaps = 28/137 (20%)
 Frame = +3

Query  105  ILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPP--GLDPSY-----YNKQ  263
            +LG L +V  E    +F+++    RL+R+ +K   S   S P     DP        +KQ
Sbjct  14   LLGILAIVAAEVIGFLFVLK----RLNRKSNKRHESNSGSDPTLKNFDPRRSIDFSLSKQ  69

Query  264  GIVWILDLE----------KIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLE  413
            G++WI++++          K+P+        QKK + +++EV PI+++A+IKDH L L +
Sbjct  70   GVIWIMEMDENVKDWMKKDKLPKE-------QKKKRVDLMEVHPIRRFARIKDHKLILSD  122

Query  414  SDGSNTEIQLRGCTIAA  464
            SDG+ T I L+GC + A
Sbjct  123  SDGTQTCITLKGCFVNA  139



>ref|XP_009408155.1| PREDICTED: testis-expressed sequence 2 protein-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=673

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  497  AKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            AKRYPIK+ESK S IYK S+T Y+Y +TSW+KESWCKALRLAS
Sbjct  19   AKRYPIKLESKESKIYKESKTCYLYFDTSWEKESWCKALRLAS  61



>gb|AFW63911.1| hypothetical protein ZEAMMB73_732140 [Zea mays]
Length=161

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 4/89 (4%)
 Frame = +3

Query  231  PGLDPSYYNKQGIVWILDLEKIPRAPVDK--ALG--QKKSKKEVLEVSPIQKYAKIKDHS  398
            PG  P  Y KQG +WIL+ EK+P+   D+  A G  + K KK ++EV P +K AKIK +S
Sbjct  50   PGERPFPYEKQGFLWILEPEKMPKLSNDRLSAGGPRETKDKKNIVEVFPAKKMAKIKGNS  109

Query  399  LFLLESDGSNTEIQLRGCTIAAFLQQACP  485
            L L   DGS   I+L  CT+ A    + P
Sbjct  110  LCLSGPDGSQATIELLNCTVLAVSASSMP  138



>ref|NP_001145602.1| uncharacterized protein LOC100279080 [Zea mays]
 gb|ACG48805.1| hypothetical protein [Zea mays]
Length=177

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 4/89 (4%)
 Frame = +3

Query  231  PGLDPSYYNKQGIVWILDLEKIPRAPVDK--ALG--QKKSKKEVLEVSPIQKYAKIKDHS  398
            PG  P  Y KQG +WIL+ EK+P+   D+  A G  + K KK ++EV P +K AKIK +S
Sbjct  50   PGERPFPYEKQGFLWILEPEKMPKLSNDRLSAGGPRETKDKKNIVEVFPAKKMAKIKGNS  109

Query  399  LFLLESDGSNTEIQLRGCTIAAFLQQACP  485
            L L   DGS   I+L  CT+ A    + P
Sbjct  110  LCLSGPDGSQATIELLNCTVLAVSASSMP  138



>ref|XP_006589245.1| PREDICTED: uncharacterized protein LOC100816218 isoform X2 [Glycine 
max]
Length=653

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  497  AKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            AK +PIKVE+ +S IY G++T YIYL+TSW+KE+WCKAL LAS
Sbjct  6    AKMFPIKVENTNSVIYNGNKTIYIYLDTSWEKEAWCKALYLAS  48



>dbj|BAJ97472.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=454

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  497  AKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALRLAS  625
            +KRYPIK+ESK S I K S+  Y+Y++TSW+KESWCKALRLAS
Sbjct  11   SKRYPIKLESKGSDICKRSKVCYLYVDTSWEKESWCKALRLAS  53



>ref|XP_001759215.1| predicted protein [Physcomitrella patens]
 gb|EDQ75899.1| predicted protein [Physcomitrella patens]
Length=909

 Score = 44.3 bits (103),  Expect(2) = 4e-08, Method: Composition-based stats.
 Identities = 18/52 (35%), Positives = 31/52 (60%), Gaps = 0/52 (0%)
 Frame = +2

Query  461  SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  616
            S+S    S+ KW+K +PIK+   +  +Y   +    Y E+ ++KE+WC+ LR
Sbjct  143  SISYDQTSNGKWSKMFPIKLHHPTHTLYGDCKDCLFYAESGYEKEAWCEVLR  194


 Score = 40.0 bits (92),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 60/129 (47%), Gaps = 9/129 (7%)
 Frame = +3

Query  102  FILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGIVWIL  281
            F  G L +  VE     FLIR L  R   + + +  S E  S  G   S ++ Q    IL
Sbjct  16   FFGGILLLALVECVCVFFLIRRLLERKPTQ-NPSPSSLEYRSEGGSYDSSFSLQVSKAIL  74

Query  282  DL--------EKIPRAPVDKALGQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNTEI  437
             +        ++  R    +   +  + K VL+++P++K+  +K+  L L E DG+  +I
Sbjct  75   QMPGKDKKREKEAERDGPKEGSNRAGTTKNVLKLAPVRKHVVLKEGILLLREVDGNEEQI  134

Query  438  QLRGCTIAA  464
             L GC +++
Sbjct  135  PLEGCEVSS  143



>ref|XP_002962707.1| hypothetical protein SELMODRAFT_438325 [Selaginella moellendorffii]
 gb|EFJ36170.1| hypothetical protein SELMODRAFT_438325 [Selaginella moellendorffii]
Length=752

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 4/66 (6%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            S+ +L  CSV   S+T   +RKWAK+YPIKVE  S  +  G+    +Y +T W+KE+WC+
Sbjct  155  SSIQLQGCSVLAVSSTAAETRKWAKKYPIKVEHSSRTLL-GTTVCLLYFKTGWEKETWCE  213

Query  608  ALRLAS  625
            ALR A+
Sbjct  214  ALRAAA  219


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 67/131 (51%), Gaps = 7/131 (5%)
 Frame = +3

Query  90   FVLVFILGALTVVGVEAAAAVFLIRWLSRRLSREVDKAKVSAELSSPPGLDPSYYNKQGI  269
            ++  F+LGAL +  VE A   +L     R   +       S  + + P   PS  + +G 
Sbjct  37   YIASFLLGALALGVVEIAVLWYLFVHKPRHRHKAAAAILPSFSMEADPN-SPSKISIEGE  95

Query  270  VWILDLE--KIPRAPVDKAL----GQKKSKKEVLEVSPIQKYAKIKDHSLFLLESDGSNT  431
            +W+  +   ++  A   K L     QKK+ ++  E+S   K+AK++D +L L  SDG+ +
Sbjct  96   IWVASVSPFQVENANSSKLLPKDRKQKKATEQKNEISVSLKFAKLQDRTLILTGSDGAVS  155

Query  432  EIQLRGCTIAA  464
             IQL+GC++ A
Sbjct  156  SIQLQGCSVLA  166



>ref|XP_002980385.1| hypothetical protein SELMODRAFT_112533 [Selaginella moellendorffii]
 gb|EFJ18645.1| hypothetical protein SELMODRAFT_112533 [Selaginella moellendorffii]
Length=669

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 44/66 (67%), Gaps = 4/66 (6%)
 Frame = +2

Query  437  STQRLYNCSV---SATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCK  607
            S+ +L  CSV   S+T   +RKWAK+YPIKVE  S  +  G+    +Y +T W+KE+WC+
Sbjct  73   SSIQLQGCSVLAVSSTAAETRKWAKKYPIKVEHSSRTLL-GTTVCLLYFKTGWEKETWCE  131

Query  608  ALRLAS  625
            ALR A+
Sbjct  132  ALRAAA  137



>ref|XP_001778334.1| predicted protein [Physcomitrella patens]
 gb|EDQ56882.1| predicted protein [Physcomitrella patens]
Length=921

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = +2

Query  449  LYNC---SVSATGLSSRKWAKRYPIKVESKSSAIYKGSRTFYIYLETSWDKESWCKALR  616
            L +C   +VS++   SRKW K++PIK+      +Y+G   F  + ET + KE+WC+A R
Sbjct  132  LEDCKVVAVSSSSEPSRKWGKKFPIKLHHPDRVLYRGCNQFLFFSETGYAKEAWCEAFR  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250