BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045E17

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG16990.1|  Transmembrane 9 superfamily member 3                    209   8e-63   Gossypium arboreum [tree cotton]
ref|XP_009796637.1|  PREDICTED: transmembrane 9 superfamily membe...    213   9e-62   Nicotiana sylvestris
gb|KCW57093.1|  hypothetical protein EUGRSUZ_I02743                     210   2e-61   Eucalyptus grandis [rose gum]
ref|XP_006339920.1|  PREDICTED: transmembrane 9 superfamily membe...    212   3e-61   Solanum tuberosum [potatoes]
gb|KJB79238.1|  hypothetical protein B456_013G038900                    211   7e-61   Gossypium raimondii
ref|XP_010030126.1|  PREDICTED: transmembrane 9 superfamily member 3    211   7e-61   Eucalyptus grandis [rose gum]
gb|KJB12212.1|  hypothetical protein B456_002G006200                    210   1e-60   Gossypium raimondii
gb|KJB77693.1|  hypothetical protein B456_012G151500                    210   1e-60   Gossypium raimondii
gb|KJB77692.1|  hypothetical protein B456_012G151500                    209   2e-60   Gossypium raimondii
ref|XP_010930775.1|  PREDICTED: transmembrane 9 superfamily member 1    209   5e-60   Elaeis guineensis
ref|XP_009776073.1|  PREDICTED: transmembrane 9 superfamily membe...    208   1e-59   Nicotiana sylvestris
gb|KJB47460.1|  hypothetical protein B456_008G027700                    206   3e-59   Gossypium raimondii
ref|XP_008218557.1|  PREDICTED: transmembrane 9 superfamily member 3    206   3e-59   Prunus mume [ume]
gb|KJB47458.1|  hypothetical protein B456_008G027700                    206   4e-59   Gossypium raimondii
ref|XP_007221993.1|  hypothetical protein PRUPE_ppa003254mg             206   5e-59   Prunus persica
gb|KJB47461.1|  hypothetical protein B456_008G027700                    206   5e-59   Gossypium raimondii
ref|XP_009600607.1|  PREDICTED: transmembrane 9 superfamily membe...    206   6e-59   Nicotiana tomentosiformis
ref|XP_004230474.1|  PREDICTED: transmembrane 9 superfamily membe...    206   6e-59   Solanum lycopersicum
ref|XP_006349354.1|  PREDICTED: transmembrane 9 superfamily membe...    206   7e-59   Solanum tuberosum [potatoes]
gb|KDO50082.1|  hypothetical protein CISIN_1g012251mg                   202   1e-58   Citrus sinensis [apfelsine]
ref|XP_010912524.1|  PREDICTED: transmembrane 9 superfamily membe...    203   2e-58   
ref|XP_008456054.1|  PREDICTED: transmembrane 9 superfamily member 3    205   2e-58   Cucumis melo [Oriental melon]
ref|XP_008339497.1|  PREDICTED: transmembrane 9 superfamily membe...    204   3e-58   
ref|XP_009348753.1|  PREDICTED: transmembrane 9 superfamily membe...    204   3e-58   Pyrus x bretschneideri [bai li]
ref|XP_009602812.1|  PREDICTED: transmembrane 9 superfamily membe...    204   3e-58   Nicotiana tomentosiformis
gb|KHG20578.1|  Tm9sf3                                                  205   3e-58   Gossypium arboreum [tree cotton]
ref|XP_011464826.1|  PREDICTED: transmembrane 9 superfamily member 1    204   3e-58   Fragaria vesca subsp. vesca
gb|KJB79240.1|  hypothetical protein B456_013G038900                    204   4e-58   Gossypium raimondii
gb|KGN57596.1|  hypothetical protein Csa_3G222780                       205   4e-58   Cucumis sativus [cucumbers]
ref|XP_010912522.1|  PREDICTED: transmembrane 9 superfamily membe...    204   4e-58   Elaeis guineensis
ref|XP_009355251.1|  PREDICTED: transmembrane 9 superfamily membe...    203   4e-58   Pyrus x bretschneideri [bai li]
gb|KDP38816.1|  hypothetical protein JCGZ_04973                         204   4e-58   Jatropha curcas
ref|XP_004248848.1|  PREDICTED: transmembrane 9 superfamily membe...    203   5e-58   Solanum lycopersicum
ref|XP_008378878.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    203   6e-58   Malus domestica [apple tree]
ref|XP_002269498.1|  PREDICTED: transmembrane 9 superfamily member 1    203   7e-58   Vitis vinifera
ref|XP_011092338.1|  PREDICTED: transmembrane 9 superfamily membe...    203   7e-58   Sesamum indicum [beniseed]
ref|XP_006431823.1|  hypothetical protein CICLE_v10000670mg             203   8e-58   Citrus clementina [clementine]
ref|XP_010272575.1|  PREDICTED: transmembrane 9 superfamily membe...    200   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_006471014.1|  PREDICTED: transmembrane 9 superfamily membe...    202   2e-57   Citrus sinensis [apfelsine]
ref|XP_008783371.1|  PREDICTED: transmembrane 9 superfamily membe...    202   2e-57   Phoenix dactylifera
ref|XP_002530674.1|  endomembrane protein emp70, putative               201   3e-57   Ricinus communis
ref|XP_002452255.1|  hypothetical protein SORBIDRAFT_04g022500          201   6e-57   Sorghum bicolor [broomcorn]
ref|XP_008781558.1|  PREDICTED: transmembrane 9 superfamily membe...    200   6e-57   Phoenix dactylifera
ref|XP_010246919.1|  PREDICTED: transmembrane 9 superfamily member 3    200   8e-57   Nelumbo nucifera [Indian lotus]
ref|XP_008681382.1|  PREDICTED: uncharacterized protein LOC100272...    199   2e-56   Zea mays [maize]
ref|XP_008681381.1|  PREDICTED: uncharacterized protein LOC100272...    199   2e-56   Zea mays [maize]
ref|XP_010910845.1|  PREDICTED: transmembrane 9 superfamily membe...    199   2e-56   Elaeis guineensis
gb|AGE46034.1|  putative transmembrane 9 superfamily member 3 pro...    199   2e-56   Elaeis guineensis
emb|CDY34667.1|  BnaC08g42260D                                          199   3e-56   Brassica napus [oilseed rape]
ref|XP_009104187.1|  PREDICTED: transmembrane 9 superfamily membe...    199   3e-56   Brassica rapa
ref|XP_008807671.1|  PREDICTED: transmembrane 9 superfamily membe...    198   4e-56   Phoenix dactylifera
emb|CDY03772.1|  BnaC01g28890D                                          198   4e-56   
ref|XP_006392092.1|  hypothetical protein EUTSA_v10023368mg             198   5e-56   Eutrema salsugineum [saltwater cress]
ref|XP_004146261.1|  PREDICTED: transmembrane 9 superfamily membe...    197   6e-56   
ref|XP_004952828.1|  PREDICTED: transmembrane 9 superfamily membe...    197   7e-56   Setaria italica
ref|XP_006417401.1|  hypothetical protein EUTSA_v10007167mg             197   1e-55   Eutrema salsugineum [saltwater cress]
ref|XP_011028284.1|  PREDICTED: transmembrane 9 superfamily member 1    197   1e-55   Populus euphratica
emb|CDY46193.1|  BnaA01g23150D                                          197   1e-55   Brassica napus [oilseed rape]
ref|XP_004978867.1|  PREDICTED: transmembrane 9 superfamily membe...    197   1e-55   Setaria italica
tpg|DAA55531.1|  TPA: hypothetical protein ZEAMMB73_446969              197   2e-55   
ref|XP_002442907.1|  hypothetical protein SORBIDRAFT_08g004730          197   2e-55   Sorghum bicolor [broomcorn]
ref|XP_009404975.1|  PREDICTED: transmembrane 9 superfamily membe...    197   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010492170.1|  PREDICTED: transmembrane 9 superfamily membe...    195   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010238659.1|  PREDICTED: transmembrane 9 superfamily membe...    196   3e-55   Brachypodium distachyon [annual false brome]
ref|XP_003592976.1|  Transmembrane 9 superfamily protein member         196   3e-55   Medicago truncatula
gb|KHG20579.1|  Tm9sf3                                                  196   3e-55   Gossypium arboreum [tree cotton]
ref|XP_008662281.1|  PREDICTED: uncharacterized protein LOC100501...    196   4e-55   
emb|CDY20974.1|  BnaA08g25510D                                          196   4e-55   Brassica napus [oilseed rape]
ref|XP_010458475.1|  PREDICTED: transmembrane 9 superfamily membe...    194   9e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010492178.1|  PREDICTED: transmembrane 9 superfamily membe...    194   9e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002449107.1|  hypothetical protein SORBIDRAFT_05g005240          194   9e-55   Sorghum bicolor [broomcorn]
emb|CDO97576.1|  unnamed protein product                                194   1e-54   Coffea canephora [robusta coffee]
ref|XP_009390763.1|  PREDICTED: transmembrane 9 superfamily membe...    194   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002889842.1|  hypothetical protein ARALYDRAFT_471233             194   1e-54   Arabidopsis lyrata subsp. lyrata
ref|XP_010235535.1|  PREDICTED: transmembrane 9 superfamily membe...    194   1e-54   Brachypodium distachyon [annual false brome]
ref|XP_009144405.1|  PREDICTED: transmembrane 9 superfamily membe...    194   1e-54   Brassica rapa
ref|NP_001131352.1|  uncharacterized protein LOC100192672 precursor     191   1e-54   
ref|XP_009379854.1|  PREDICTED: transmembrane 9 superfamily membe...    194   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK43390.1|  hypothetical protein AALP_AA1G119800                    194   1e-54   Arabis alpina [alpine rockcress]
gb|KFK40744.1|  hypothetical protein AALP_AA2G035500                    194   2e-54   Arabis alpina [alpine rockcress]
emb|CDY20592.1|  BnaC08g14660D                                          194   2e-54   Brassica napus [oilseed rape]
ref|XP_006304923.1|  hypothetical protein CARUB_v10011995mg             194   2e-54   Capsella rubella
emb|CDY14555.1|  BnaC03g49040D                                          194   2e-54   Brassica napus [oilseed rape]
ref|XP_010547447.1|  PREDICTED: transmembrane 9 superfamily membe...    194   2e-54   Tarenaya hassleriana [spider flower]
emb|CDX94774.1|  BnaC07g17830D                                          194   2e-54   
ref|XP_006585219.1|  PREDICTED: transmembrane 9 superfamily membe...    193   2e-54   Glycine max [soybeans]
ref|XP_003531298.1|  PREDICTED: transmembrane 9 superfamily membe...    193   2e-54   Glycine max [soybeans]
ref|XP_004977232.1|  PREDICTED: transmembrane 9 superfamily membe...    193   3e-54   Setaria italica
emb|CDY54580.1|  BnaCnng27350D                                          193   3e-54   Brassica napus [oilseed rape]
gb|KHG27380.1|  Tm9sf3                                                  193   3e-54   Gossypium arboreum [tree cotton]
ref|NP_563881.1|  transmembrane nine 1                                  193   4e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001066292.1|  Os12g0175700                                       193   4e-54   
ref|XP_009390071.1|  PREDICTED: transmembrane 9 superfamily membe...    192   5e-54   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY34861.1|  BnaA09g47870D                                          192   6e-54   Brassica napus [oilseed rape]
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...    192   7e-54   Cicer arietinum [garbanzo]
ref|XP_010533958.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    192   7e-54   Tarenaya hassleriana [spider flower]
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...    192   7e-54   Cicer arietinum [garbanzo]
ref|XP_011009384.1|  PREDICTED: transmembrane 9 superfamily membe...    192   7e-54   Populus euphratica
gb|KHG21692.1|  Transmembrane 9 superfamily member 3                    192   8e-54   Gossypium arboreum [tree cotton]
ref|XP_010553598.1|  PREDICTED: transmembrane 9 superfamily membe...    192   9e-54   Tarenaya hassleriana [spider flower]
dbj|BAJ87519.1|  predicted protein                                      191   1e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008667101.1|  PREDICTED: uncharacterized protein LOC100192...    191   1e-53   
gb|ACG29787.1|  transmembrane 9 superfamily protein member 3 prec...    191   1e-53   Zea mays [maize]
ref|XP_010475983.1|  PREDICTED: transmembrane 9 superfamily membe...    191   2e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009148436.1|  PREDICTED: transmembrane 9 superfamily membe...    191   2e-53   Brassica rapa
emb|CDY19333.1|  BnaC05g08420D                                          191   2e-53   Brassica napus [oilseed rape]
ref|XP_007159578.1|  hypothetical protein PHAVU_002G249200g             191   3e-53   Phaseolus vulgaris [French bean]
ref|XP_003540158.1|  PREDICTED: transmembrane 9 superfamily membe...    191   3e-53   Glycine max [soybeans]
emb|CDX97924.1|  BnaA06g06750D                                          191   3e-53   
ref|XP_006662781.1|  PREDICTED: transmembrane 9 superfamily membe...    190   4e-53   
ref|XP_009404976.1|  PREDICTED: transmembrane 9 superfamily membe...    190   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009124655.1|  PREDICTED: transmembrane 9 superfamily membe...    191   4e-53   
ref|XP_003532994.1|  PREDICTED: transmembrane 9 superfamily membe...    190   5e-53   Glycine max [soybeans]
ref|XP_006580221.1|  PREDICTED: transmembrane 9 superfamily membe...    190   5e-53   Glycine max [soybeans]
gb|KHN45466.1|  Transmembrane 9 superfamily member 3                    190   5e-53   Glycine soja [wild soybean]
ref|XP_003524235.1|  PREDICTED: transmembrane 9 superfamily membe...    190   5e-53   Glycine max [soybeans]
dbj|BAJ96423.1|  predicted protein                                      190   6e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ86318.1|  predicted protein                                      189   6e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE57172.1|  hypothetical protein OsJ_07106                          189   8e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047104.1|  Os02g0552000                                       189   1e-52   
ref|NP_001065897.1|  Os11g0181100                                       189   1e-52   
gb|KHN11244.1|  Transmembrane 9 superfamily member 3                    188   2e-52   Glycine soja [wild soybean]
ref|XP_003577775.1|  PREDICTED: transmembrane 9 superfamily member 3    187   3e-52   Brachypodium distachyon [annual false brome]
ref|XP_007148532.1|  hypothetical protein PHAVU_006G216500g             188   3e-52   Phaseolus vulgaris [French bean]
gb|EYU28222.1|  hypothetical protein MIMGU_mgv1a003468mg                187   5e-52   Erythranthe guttata [common monkey flower]
ref|XP_007042269.1|  Transmembrane nine 1                               187   5e-52   
ref|XP_006859169.1|  hypothetical protein AMTR_s00070p00145350          187   6e-52   Amborella trichopoda
ref|XP_010101151.1|  Transmembrane 9 superfamily member 3               187   8e-52   
ref|XP_010682931.1|  PREDICTED: transmembrane 9 superfamily member 1    186   1e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004504187.1|  PREDICTED: transmembrane 9 superfamily membe...    186   1e-51   Cicer arietinum [garbanzo]
ref|XP_009113237.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    184   4e-51   
ref|XP_006664390.1|  PREDICTED: transmembrane 9 superfamily membe...    184   6e-51   Oryza brachyantha
ref|XP_009593535.1|  PREDICTED: transmembrane 9 superfamily membe...    178   7e-51   Nicotiana tomentosiformis
ref|XP_010912523.1|  PREDICTED: transmembrane 9 superfamily membe...    183   1e-50   
ref|XP_003629959.1|  Transmembrane 9 superfamily protein member         182   3e-50   Medicago truncatula
ref|XP_011074960.1|  PREDICTED: transmembrane 9 superfamily membe...    182   4e-50   Sesamum indicum [beniseed]
ref|XP_004250432.1|  PREDICTED: transmembrane 9 superfamily member 3    181   1e-49   Solanum lycopersicum
gb|AFW71773.1|  hypothetical protein ZEAMMB73_948581                    178   2e-49   
gb|EPS65883.1|  hypothetical protein M569_08888                         179   4e-49   Genlisea aurea
ref|XP_006367366.1|  PREDICTED: transmembrane 9 superfamily membe...    179   5e-49   Solanum tuberosum [potatoes]
ref|XP_009763454.1|  PREDICTED: transmembrane 9 superfamily membe...    178   8e-49   Nicotiana sylvestris
ref|XP_010665394.1|  PREDICTED: transmembrane 9 superfamily member 1    179   8e-49   
gb|EYU22789.1|  hypothetical protein MIMGU_mgv1a003460mg                178   1e-48   Erythranthe guttata [common monkey flower]
ref|XP_010682854.1|  PREDICTED: transmembrane 9 superfamily membe...    178   1e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006648727.1|  PREDICTED: transmembrane 9 superfamily membe...    177   2e-48   
gb|EPS62158.1|  hypothetical protein M569_12635                         175   7e-48   Genlisea aurea
ref|XP_011096274.1|  PREDICTED: transmembrane 9 superfamily membe...    175   9e-48   Sesamum indicum [beniseed]
gb|AAB65482.1|  endomembrane protein EMP70 precusor isolog; 68664...    174   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009631162.1|  PREDICTED: transmembrane 9 superfamily membe...    173   5e-47   Nicotiana tomentosiformis
ref|XP_006384984.1|  endomembrane protein 70                            172   1e-46   
gb|EMT15069.1|  Transmembrane 9 superfamily member 3                    171   5e-46   
ref|XP_001785045.1|  predicted protein                                  169   2e-45   
gb|AAX96186.1|  Endomembrane protein 70                                 169   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002304054.2|  hypothetical protein POPTR_0003s011001g            167   4e-45   
ref|XP_006356503.1|  PREDICTED: transmembrane 9 superfamily membe...    166   2e-44   Solanum tuberosum [potatoes]
ref|XP_002984084.1|  hypothetical protein SELMODRAFT_156331             166   2e-44   
ref|XP_002960054.1|  hypothetical protein SELMODRAFT_163520             164   8e-44   Selaginella moellendorffii
ref|XP_009788011.1|  PREDICTED: transmembrane 9 superfamily membe...    164   1e-43   Nicotiana sylvestris
gb|EMS58779.1|  Transmembrane 9 superfamily member 3                    162   4e-43   Triticum urartu
ref|XP_004241844.1|  PREDICTED: transmembrane 9 superfamily membe...    162   6e-43   Solanum lycopersicum
gb|EMT08384.1|  Transmembrane 9 superfamily member 3                    162   7e-43   
emb|CDY44835.1|  BnaCnng11910D                                          149   2e-41   Brassica napus [oilseed rape]
emb|CAN77106.1|  hypothetical protein VITISV_037096                     152   3e-39   Vitis vinifera
ref|XP_008781557.1|  PREDICTED: transmembrane 9 superfamily membe...    150   7e-39   
ref|XP_001698971.1|  EMP/nonaspanin domain family protein               141   2e-35   Chlamydomonas reinhardtii
ref|XP_011395771.1|  Transmembrane 9 superfamily member 3               140   4e-35   Auxenochlorella protothecoides
gb|KIZ05019.1|  Transmembrane 9 superfamily member 3                    132   3e-34   Monoraphidium neglectum
ref|XP_002945998.1|  hypothetical protein VOLCADRAFT_72231              137   6e-34   Volvox carteri f. nagariensis
ref|XP_005845268.1|  hypothetical protein CHLNCDRAFT_36511              135   1e-33   Chlorella variabilis
ref|XP_007509634.1|  predicted protein                                  133   1e-32   Bathycoccus prasinos
emb|CDY33319.1|  BnaAnng04300D                                          126   3e-30   Brassica napus [oilseed rape]
ref|XP_005645983.1|  hypothetical protein COCSUDRAFT_53991              127   3e-30   Coccomyxa subellipsoidea C-169
emb|CDY44834.1|  BnaCnng11900D                                          126   3e-30   Brassica napus [oilseed rape]
emb|CDY12876.1|  BnaA09g13980D                                          126   3e-30   Brassica napus [oilseed rape]
ref|NP_001003550.1|  transmembrane 9 superfamily member 1               125   8e-30   Danio rerio [leopard danio]
ref|XP_006809561.1|  PREDICTED: transmembrane 9 superfamily membe...    125   1e-29   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004575210.1|  PREDICTED: transmembrane 9 superfamily membe...    125   1e-29   Maylandia zebra
ref|XP_005754693.1|  PREDICTED: transmembrane 9 superfamily membe...    125   1e-29   Pundamilia nyererei
ref|XP_002509072.1|  predicted protein                                  123   5e-29   Micromonas commoda
ref|XP_010739917.1|  PREDICTED: transmembrane 9 superfamily membe...    123   6e-29   
ref|XP_007255923.1|  PREDICTED: transmembrane 9 superfamily member 1    123   6e-29   
ref|XP_010884102.1|  PREDICTED: transmembrane 9 superfamily member 1    123   8e-29   Esox lucius
emb|CDQ70386.1|  unnamed protein product                                122   1e-28   Oncorhynchus mykiss
ref|XP_003457937.2|  PREDICTED: transmembrane 9 superfamily membe...    122   1e-28   Oreochromis niloticus
ref|XP_009064505.1|  hypothetical protein LOTGIDRAFT_196341             121   2e-28   Lottia gigantea
emb|CBN81815.1|  Transmembrane 9 superfamily member 1                   121   4e-28   Dicentrarchus labrax [European sea bass]
ref|XP_008436895.1|  PREDICTED: transmembrane 9 superfamily member 1    120   4e-28   Poecilia reticulata
ref|XP_007548006.1|  PREDICTED: transmembrane 9 superfamily member 1    120   4e-28   Poecilia formosa
ref|XP_008305730.1|  PREDICTED: transmembrane 9 superfamily member 1    120   7e-28   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005803703.1|  PREDICTED: transmembrane 9 superfamily membe...    120   7e-28   
ref|XP_001689987.1|  EMP/nonaspanin domain family protein               120   8e-28   Chlamydomonas reinhardtii
ref|XP_008276179.1|  PREDICTED: transmembrane 9 superfamily member 1    120   9e-28   Stegastes partitus
gb|EWM22128.1|  transmembrane 9 superfamily member 3                    119   2e-27   Nannochloropsis gaditana
ref|XP_002939067.1|  PREDICTED: transmembrane 9 superfamily membe...    119   2e-27   Xenopus tropicalis [western clawed frog]
ref|XP_004081008.1|  PREDICTED: transmembrane 9 superfamily member 1    118   4e-27   Oryzias latipes [Japanese rice fish]
gb|AEE63341.1|  unknown                                                 117   5e-27   Dendroctonus ponderosae
gb|ENN73181.1|  hypothetical protein YQE_10235                          117   6e-27   Dendroctonus ponderosae
ref|XP_002956625.1|  hypothetical protein VOLCADRAFT_110022             117   6e-27   Volvox carteri f. nagariensis
gb|EEZ99577.1|  hypothetical protein TcasGA2_TC001563                   117   7e-27   
ref|XP_967117.1|  PREDICTED: transmembrane 9 superfamily member 3       117   7e-27   Tribolium castaneum [rust-red flour beetle]
gb|ERG85277.1|  transmembrane 9 superfamily member 3                    116   1e-26   
gb|EGT53827.1|  hypothetical protein CAEBREN_03110                      116   1e-26   Caenorhabditis brenneri
gb|KHN75714.1|  Transmembrane 9 superfamily member 3                    116   1e-26   Toxocara canis
ref|XP_006519680.1|  PREDICTED: transmembrane 9 superfamily membe...    115   1e-26   Mus musculus [mouse]
ref|XP_003967994.1|  PREDICTED: transmembrane 9 superfamily membe...    116   1e-26   Takifugu rubripes [tiger puffer]
ref|XP_006519679.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   Mus musculus [mouse]
ref|XP_001950058.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Acyrthosiphon pisum
ref|XP_011243511.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   Mus musculus [mouse]
ref|XP_005836386.1|  hypothetical protein GUITHDRAFT_67884              115   2e-26   Guillardia theta CCMP2712
ref|XP_004225719.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    115   2e-26   Ciona intestinalis [sea vase]
ref|XP_006835458.1|  PREDICTED: charged multivesicular body prote...    117   3e-26   Chrysochloris asiatica
ref|XP_008487150.1|  PREDICTED: transmembrane 9 superfamily membe...    115   4e-26   
gb|EEE68090.1|  hypothetical protein OsJ_26137                          116   5e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002963357.1|  hypothetical protein SELMODRAFT_166118             114   7e-26   
ref|XP_002974646.1|  hypothetical protein SELMODRAFT_101645             114   7e-26   
gb|EMS60954.1|  Putative phagocytic receptor 1b                         114   7e-26   Triticum urartu
ref|XP_004972768.1|  PREDICTED: putative phagocytic receptor 1b-l...    115   8e-26   
ref|XP_002062013.1|  GK16877                                            114   8e-26   Drosophila willistoni
ref|NP_001012155.1|  transmembrane 9 superfamily member 1 precursor     114   8e-26   Rattus norvegicus [brown rat]
ref|XP_006854108.1|  hypothetical protein AMTR_s00048p00146310          114   8e-26   
ref|XP_002634585.1|  Hypothetical protein CBG08396                      114   8e-26   Caenorhabditis briggsae
ref|XP_006252052.1|  PREDICTED: transmembrane 9 superfamily membe...    114   9e-26   
ref|NP_500130.1|  Protein Y41D4A.4                                      114   9e-26   Caenorhabditis elegans [roundworm]
gb|AAF98161.1|AF269152_1  transmembrane protein TM9SF1                  114   9e-26   Mus musculus [mouse]
ref|XP_005770609.1|  hypothetical protein EMIHUDRAFT_196296             108   9e-26   Emiliania huxleyi CCMP1516
gb|ERE89416.1|  transmembrane 9 superfamily member 1 isoform 2          114   9e-26   Cricetulus griseus [Chinese hamsters]
ref|XP_009009848.1|  hypothetical protein HELRODRAFT_184872             114   1e-25   Helobdella robusta
ref|XP_004698552.1|  PREDICTED: transmembrane 9 superfamily member 1    115   1e-25   
ref|NP_083056.2|  transmembrane 9 superfamily member 1 precursor        114   1e-25   Mus musculus [mouse]
emb|CDH93343.1|  Y41D4A.4, isoform e                                    114   1e-25   Caenorhabditis elegans [roundworm]
ref|XP_005370493.1|  PREDICTED: transmembrane 9 superfamily membe...    114   1e-25   
ref|XP_010598840.1|  PREDICTED: transmembrane 9 superfamily membe...    115   1e-25   Loxodonta africana [African bush elephant]
ref|XP_003502106.1|  PREDICTED: transmembrane 9 superfamily member 1    114   1e-25   Cricetulus griseus [Chinese hamsters]
ref|XP_011056752.1|  PREDICTED: transmembrane 9 superfamily member 3    114   1e-25   Acromyrmex echinatior
ref|XP_003755940.1|  PREDICTED: transmembrane 9 superfamily member 1    114   1e-25   
ref|XP_001699211.1|  EMP/nonaspanin domain family protein               114   1e-25   Chlamydomonas reinhardtii
ref|XP_011259429.1|  PREDICTED: transmembrane 9 superfamily member 3    114   1e-25   Camponotus floridanus
ref|XP_001380199.1|  PREDICTED: transmembrane 9 superfamily membe...    114   1e-25   Monodelphis domestica
ref|XP_006835459.1|  PREDICTED: charged multivesicular body prote...    114   1e-25   Chrysochloris asiatica
gb|EMT19161.1|  Putative phagocytic receptor 1b                         114   1e-25   
ref|XP_005780441.1|  hypothetical protein EMIHUDRAFT_60194              109   2e-25   Emiliania huxleyi CCMP1516
dbj|BAD90204.1|  mKIAA4036 protein                                      114   2e-25   Mus musculus [mouse]
ref|XP_006036573.1|  PREDICTED: transmembrane 9 superfamily membe...    113   2e-25   Alligator sinensis
ref|XP_011163701.1|  PREDICTED: transmembrane 9 superfamily member 3    113   2e-25   Solenopsis invicta [imported red fire ant]
ref|XP_005085662.1|  PREDICTED: transmembrane 9 superfamily member 1    113   2e-25   
ref|XP_007130112.1|  PREDICTED: transmembrane 9 superfamily membe...    114   2e-25   Physeter catodon
ref|XP_003143038.1|  endomembrane protein emp70                         113   2e-25   Loa loa
ref|XP_001957525.1|  GF10453                                            113   2e-25   
ref|XP_007536361.1|  PREDICTED: transmembrane 9 superfamily membe...    114   2e-25   Erinaceus europaeus [common hedgehog]
ref|XP_004463432.1|  PREDICTED: transmembrane 9 superfamily membe...    114   2e-25   
ref|XP_006259786.1|  PREDICTED: transmembrane 9 superfamily member 1    113   2e-25   Alligator mississippiensis
ref|XP_004463434.1|  PREDICTED: transmembrane 9 superfamily membe...    112   2e-25   
gb|KFO27482.1|  Importin-4                                              115   2e-25   Fukomys damarensis [Damara mole rat]
ref|XP_007180675.1|  PREDICTED: transmembrane 9 superfamily membe...    113   3e-25   
ref|XP_008267651.1|  PREDICTED: transmembrane 9 superfamily membe...    114   3e-25   Oryctolagus cuniculus [domestic rabbit]
gb|ESA22785.1|  hypothetical protein GLOINDRAFT_73725                   112   3e-25   
gb|EPY89936.1|  importin-4                                              114   3e-25   Camelus ferus
ref|XP_007447941.1|  PREDICTED: transmembrane 9 superfamily membe...    113   3e-25   Lipotes vexillifer [baiji]
ref|XP_003802004.1|  PREDICTED: transmembrane 9 superfamily member 1    114   3e-25   
ref|XP_004584775.1|  PREDICTED: transmembrane 9 superfamily member 1    114   3e-25   
ref|XP_008838041.1|  PREDICTED: transmembrane 9 superfamily member 1    113   3e-25   Nannospalax galili
ref|XP_010994078.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    114   3e-25   Camelus dromedarius [camel]
ref|XP_004463433.1|  PREDICTED: transmembrane 9 superfamily membe...    112   3e-25   
ref|XP_006217338.1|  PREDICTED: charged multivesicular body prote...    114   4e-25   Vicugna pacos
ref|XP_003421009.1|  PREDICTED: transmembrane 9 superfamily membe...    112   4e-25   Loxodonta africana [African bush elephant]
gb|EJW85205.1|  endomembrane protein emp70                              112   4e-25   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_001984443.1|  GH15015                                            112   4e-25   Drosophila grimshawi
dbj|BAH13215.1|  unnamed protein product                                113   4e-25   Homo sapiens [man]
ref|XP_006883243.1|  PREDICTED: transmembrane 9 superfamily membe...    113   4e-25   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003441118.1|  PREDICTED: transmembrane 9 superfamily member 3    112   4e-25   Oreochromis niloticus
ref|XP_006988599.1|  PREDICTED: transmembrane 9 superfamily membe...    112   4e-25   
ref|XP_011352435.1|  PREDICTED: transmembrane 9 superfamily member 3    112   4e-25   Ooceraea biroi
ref|XP_004694659.1|  PREDICTED: transmembrane 9 superfamily member 1    113   4e-25   Condylura cristata
ref|XP_006630785.1|  PREDICTED: transmembrane 9 superfamily membe...    112   4e-25   Lepisosteus oculatus
ref|XP_006172880.1|  PREDICTED: charged multivesicular body prote...    113   4e-25   Camelus ferus
ref|XP_004390569.1|  PREDICTED: transmembrane 9 superfamily member 1    112   4e-25   Trichechus manatus latirostris
ref|XP_010779259.1|  PREDICTED: transmembrane 9 superfamily member 1    112   5e-25   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005735123.1|  PREDICTED: transmembrane 9 superfamily membe...    112   5e-25   Pundamilia nyererei
ref|XP_004010358.1|  PREDICTED: transmembrane 9 superfamily member 1    111   6e-25   
ref|XP_001899401.1|  Transmembrane 9 superfamily protein member 3...    112   6e-25   
ref|XP_006799085.1|  PREDICTED: transmembrane 9 superfamily membe...    112   6e-25   
ref|XP_006102307.1|  PREDICTED: transmembrane 9 superfamily membe...    112   6e-25   
ref|NP_001014842.1|  transmembrane 9 superfamily member 1 isoform...    110   6e-25   
ref|XP_005859645.1|  PREDICTED: transmembrane 9 superfamily membe...    112   6e-25   
ref|XP_008156681.1|  PREDICTED: transmembrane 9 superfamily membe...    112   6e-25   
ref|XP_005005680.1|  PREDICTED: transmembrane 9 superfamily membe...    112   6e-25   
ref|XP_003061693.1|  predicted protein                                  112   6e-25   
ref|XP_004559661.1|  PREDICTED: transmembrane 9 superfamily membe...    112   6e-25   
ref|XP_001490063.1|  PREDICTED: transmembrane 9 superfamily member 1    112   6e-25   
gb|KFH64844.1|  hypothetical protein MVEG_09573                         112   7e-25   
emb|CDQ61092.1|  unnamed protein product                                112   7e-25   
dbj|BAC35975.1|  unnamed protein product                                110   7e-25   
ref|XP_002007870.1|  GI13177                                            111   8e-25   
emb|CDQ00788.1|  Protein Bm6514, isoform c                              111   8e-25   
ref|XP_004885399.1|  PREDICTED: transmembrane 9 superfamily membe...    112   8e-25   
gb|ELW69279.1|  Importin-4                                              113   9e-25   
gb|KHJ41501.1|  endomembrane protein 70                                 111   9e-25   
ref|XP_004661882.1|  PREDICTED: transmembrane 9 superfamily member 1    111   9e-25   
ref|XP_008959494.1|  PREDICTED: transmembrane 9 superfamily membe...    111   9e-25   
ref|XP_010293842.1|  PREDICTED: transmembrane 9 superfamily membe...    105   1e-24   
ref|XP_004609499.1|  PREDICTED: transmembrane 9 superfamily membe...    112   1e-24   
ref|XP_002718144.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|XP_007130114.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|XP_002083749.1|  GD13184                                            111   1e-24   
ref|XP_006739631.1|  PREDICTED: transmembrane 9 superfamily membe...    110   1e-24   
ref|XP_006883244.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|XP_007902753.1|  PREDICTED: transmembrane 9 superfamily member 3    111   1e-24   
ref|XP_005338783.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|XP_001917123.3|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    111   1e-24   
ref|XP_003704134.1|  PREDICTED: transmembrane 9 superfamily member 3    111   1e-24   
ref|XP_010636002.1|  PREDICTED: transmembrane 9 superfamily member 1    111   1e-24   
ref|XP_005985428.1|  PREDICTED: transmembrane 9 superfamily member 1    111   1e-24   
ref|XP_007098088.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|XP_011281457.1|  PREDICTED: transmembrane 9 superfamily member 1    111   1e-24   
gb|ELK11218.1|  Importin-4                                              112   1e-24   
ref|XP_008707016.1|  PREDICTED: transmembrane 9 superfamily member 1    111   1e-24   
ref|XP_004755298.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|XP_006992484.1|  PREDICTED: transmembrane 9 superfamily member 3    111   1e-24   
ref|XP_004402104.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
gb|AAW26814.1|  SJCHGC06257 protein                                     109   1e-24   
ref|XP_008570550.1|  PREDICTED: transmembrane 9 superfamily member 1    111   1e-24   
ref|NP_006396.2|  transmembrane 9 superfamily member 1 isoform a ...    111   1e-24   
ref|XP_003260724.1|  PREDICTED: transmembrane 9 superfamily member 1    111   1e-24   
dbj|BAF84799.1|  unnamed protein product                                111   1e-24   
gb|KFD51698.1|  hypothetical protein M513_07394                         111   1e-24   
gb|AAC51782.1|  multispanning membrane protein                          111   1e-24   
ref|XP_009484532.1|  PREDICTED: transmembrane 9 superfamily membe...    105   1e-24   
ref|XP_009004051.1|  PREDICTED: transmembrane 9 superfamily member 1    111   1e-24   
ref|XP_004283185.1|  PREDICTED: transmembrane 9 superfamily member 1    111   1e-24   
ref|XP_007180676.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|XP_007947407.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|XP_004402105.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|XP_007447942.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|NP_001126136.1|  transmembrane 9 superfamily member 1 precursor     111   1e-24   
ref|NP_001253390.1|  transmembrane 9 superfamily member 1 precursor     111   1e-24   
tpg|DAA14867.1|  TPA: transmembrane 9 superfamily member 3 isoform 1    109   1e-24   
ref|XP_005685277.1|  PREDICTED: transmembrane 9 superfamily membe...    111   1e-24   
ref|NP_001267415.1|  transmembrane 9 superfamily member 1 precursor     111   1e-24   
ref|XP_005904977.1|  PREDICTED: transmembrane 9 superfamily member 1    111   2e-24   
ref|XP_005211436.1|  PREDICTED: transmembrane 9 superfamily membe...    111   2e-24   
ref|XP_006043348.1|  PREDICTED: transmembrane 9 superfamily member 1    111   2e-24   
ref|XP_007130113.1|  PREDICTED: transmembrane 9 superfamily membe...    111   2e-24   
ref|XP_007984497.1|  PREDICTED: transmembrane 9 superfamily membe...    111   2e-24   
ref|NP_001077212.1|  transmembrane 9 superfamily member 1 precursor     111   2e-24   
ref|XP_005997314.1|  PREDICTED: transmembrane 9 superfamily member 3    110   2e-24   
ref|XP_004421247.1|  PREDICTED: transmembrane 9 superfamily membe...    110   2e-24   
ref|XP_537385.2|  PREDICTED: transmembrane 9 superfamily member 1...    110   2e-24   
ref|XP_004055037.1|  PREDICTED: transmembrane 9 superfamily membe...    110   2e-24   
ref|XP_001630700.1|  predicted protein                                  110   2e-24   
gb|EYC27980.1|  hypothetical protein Y032_0008g273                      107   2e-24   
ref|XP_010953066.1|  PREDICTED: transmembrane 9 superfamily membe...    110   2e-24   
ref|XP_004077569.1|  PREDICTED: transmembrane 9 superfamily member 3    110   2e-24   
ref|XP_004647518.1|  PREDICTED: transmembrane 9 superfamily member 1    110   2e-24   
ref|XP_010953065.1|  PREDICTED: transmembrane 9 superfamily membe...    110   2e-24   
ref|XP_002093812.1|  GE20545                                            110   2e-24   
ref|XP_002921119.1|  PREDICTED: transmembrane 9 superfamily member 1    110   2e-24   
gb|ABR16201.1|  unknown                                                 110   2e-24   
ref|XP_002156433.1|  PREDICTED: transmembrane 9 superfamily membe...    110   2e-24   
ref|XP_001972005.1|  GG14121                                            110   2e-24   
ref|XP_005377087.1|  PREDICTED: transmembrane 9 superfamily member 1    110   2e-24   
ref|XP_008067922.1|  PREDICTED: transmembrane 9 superfamily member 1    110   2e-24   
ref|XP_006739629.1|  PREDICTED: transmembrane 9 superfamily membe...    110   3e-24   
gb|KHG04463.1|  Putative phagocytic receptor 1b                         110   3e-24   
gb|ETN69974.1|  endomembrane protein 70                                 109   3e-24   
ref|XP_002597092.1|  hypothetical protein BRAFLDRAFT_105034             110   3e-24   
ref|XP_008788644.1|  PREDICTED: putative phagocytic receptor 1b         110   3e-24   
gb|KFM73388.1|  Transmembrane 9 superfamily member 3                    110   3e-24   
ref|XP_006144613.1|  PREDICTED: transmembrane 9 superfamily membe...    110   3e-24   
gb|ERE79680.1|  transmembrane 9 superfamily member 3                    110   3e-24   
ref|XP_003474483.1|  PREDICTED: transmembrane 9 superfamily membe...    110   3e-24   
ref|XP_002193887.2|  PREDICTED: transmembrane 9 superfamily member 3    110   4e-24   
ref|XP_002025369.1|  GL11985                                            110   4e-24   
gb|EFX85753.1|  hypothetical protein DAPPUDRAFT_313523                  109   4e-24   
gb|ERE79681.1|  transmembrane 9 superfamily member 3                    109   4e-24   
ref|XP_006913615.1|  PREDICTED: transmembrane 9 superfamily member 1    110   4e-24   
ref|XP_010333315.1|  PREDICTED: transmembrane 9 superfamily member 1    110   4e-24   
ref|XP_004609500.1|  PREDICTED: transmembrane 9 superfamily membe...    109   4e-24   
emb|CDH93340.1|  Y41D4A.4, isoform b                                    109   4e-24   
ref|XP_003094144.1|  hypothetical protein CRE_13729                     109   4e-24   
ref|XP_002035457.1|  GM13907                                            109   5e-24   
ref|XP_008320400.1|  PREDICTED: transmembrane 9 superfamily member 3    109   5e-24   
gb|EMP30576.1|  Transmembrane 9 superfamily member 1                    109   5e-24   
ref|NP_579930.1|  transmembrane 9 superfamily member 3 precursor        109   5e-24   
ref|XP_006610901.1|  PREDICTED: transmembrane 9 superfamily membe...    109   5e-24   
ref|XP_001353740.2|  GA10420                                            109   5e-24   
ref|XP_005352330.1|  PREDICTED: transmembrane 9 superfamily member 3    109   5e-24   
ref|NP_647979.1|  CG10590                                               109   5e-24   
ref|XP_004335868.1|  endomembrane protein EMP70 precursor isolog,...    109   6e-24   
ref|XP_002047393.1|  GJ11952                                            109   6e-24   
ref|XP_003698368.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    109   6e-24   
ref|NP_001180146.1|  transmembrane 9 superfamily member 3 precursor     109   6e-24   
ref|XP_001770691.1|  predicted protein                                  109   7e-24   
dbj|GAA29282.2|  transmembrane 9 superfamily member 3                   108   7e-24   
ref|XP_006572161.1|  PREDICTED: transmembrane 9 superfamily member 3    108   7e-24   
ref|XP_001775546.1|  predicted protein                                  108   7e-24   
ref|XP_008282853.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    109   7e-24   
ref|XP_006831254.1|  PREDICTED: transmembrane 9 superfamily member 3    108   8e-24   
ref|XP_002115408.1|  hypothetical protein TRIADDRAFT_29152              108   9e-24   
ref|XP_005795250.1|  PREDICTED: transmembrane 9 superfamily membe...    108   9e-24   
ref|XP_008520069.1|  PREDICTED: transmembrane 9 superfamily member 3    108   1e-23   
gb|KFV13607.1|  Transmembrane 9 superfamily member 3                    105   1e-23   
emb|CBI28324.3|  unnamed protein product                                108   1e-23   
ref|XP_007566966.1|  PREDICTED: transmembrane 9 superfamily member 3    108   1e-23   
ref|XP_011407645.1|  PREDICTED: transmembrane 9 superfamily membe...    106   1e-23   
gb|KCW64445.1|  hypothetical protein EUGRSUZ_G02063                     108   1e-23   
gb|ELK32462.1|  Importin-4                                              109   1e-23   
gb|EEC82941.1|  hypothetical protein OsI_27915                          108   1e-23   
ref|NP_001135200.1|  Transmembrane 9 superfamily member 3 precursor     108   1e-23   
ref|XP_010066531.1|  PREDICTED: putative phagocytic receptor 1b i...    108   2e-23   
ref|XP_005312131.1|  PREDICTED: transmembrane 9 superfamily member 3    108   2e-23   
ref|XP_849773.1|  PREDICTED: transmembrane 9 superfamily member 3...    108   2e-23   
ref|XP_002412937.1|  endosomal membrane protein EMP70, putative         108   2e-23   
emb|CDQ58548.1|  unnamed protein product                                108   2e-23   
ref|XP_009173090.1|  hypothetical protein T265_08898                    107   2e-23   
ref|XP_010896390.1|  PREDICTED: transmembrane 9 superfamily member 3    107   2e-23   
ref|XP_001783681.1|  predicted protein                                  107   2e-23   
ref|XP_001604363.1|  PREDICTED: transmembrane 9 superfamily membe...    107   2e-23   
ref|XP_008428273.1|  PREDICTED: transmembrane 9 superfamily membe...    107   2e-23   
gb|AAF67014.1|AF160213_1  endomembrane protein emp70 precursor is...    107   2e-23   
gb|KFV40869.1|  Transmembrane 9 superfamily member 3                    105   2e-23   
ref|XP_003399780.1|  PREDICTED: transmembrane 9 superfamily membe...    107   2e-23   
ref|XP_004580070.1|  PREDICTED: transmembrane 9 superfamily member 3    107   2e-23   
emb|CDW55076.1|  Transmembrane 9 superfamily                            107   3e-23   
ref|XP_007119562.1|  PREDICTED: transmembrane 9 superfamily membe...    104   3e-23   
gb|ETE67718.1|  Transmembrane 9 superfamily member 3                    107   3e-23   
ref|XP_002521900.1|  transporter, putative                              107   3e-23   
ref|XP_011182989.1|  PREDICTED: transmembrane 9 superfamily member 3    107   3e-23   
gb|AAF21983.1|  SM-11044 binding protein                                107   3e-23   
ref|XP_004370030.1|  PREDICTED: transmembrane 9 superfamily member 3    107   3e-23   
ref|XP_011399711.1|  Putative phagocytic receptor 1b                    107   3e-23   
ref|XP_004972769.1|  PREDICTED: putative phagocytic receptor 1b-l...    107   3e-23   
ref|NP_998554.1|  transmembrane 9 superfamily member 3 precursor        107   3e-23   
ref|NP_064508.3|  transmembrane 9 superfamily member 3 precursor        107   3e-23   
ref|XP_002821075.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    107   3e-23   
ref|XP_010732838.1|  PREDICTED: transmembrane 9 superfamily member 3    107   3e-23   
ref|XP_004409540.1|  PREDICTED: transmembrane 9 superfamily member 3    107   3e-23   
gb|EEC66468.1|  hypothetical protein OsI_32547                          107   4e-23   
gb|AAF98159.1|AF269150_1  transmembrane protein TM9SF3                  107   4e-23   
ref|XP_003479606.1|  PREDICTED: transmembrane 9 superfamily member 3    107   4e-23   
ref|XP_010387883.1|  PREDICTED: transmembrane 9 superfamily member 3    107   4e-23   
ref|NP_001148367.1|  transmembrane 9 superfamily protein member 1...    107   4e-23   
ref|XP_006779604.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    106   4e-23   
ref|XP_004457032.1|  PREDICTED: transmembrane 9 superfamily member 3    107   4e-23   
ref|XP_314301.3|  AGAP004882-PA                                         107   4e-23   
ref|XP_007532693.1|  PREDICTED: transmembrane 9 superfamily member 3    107   4e-23   
ref|XP_008830212.1|  PREDICTED: transmembrane 9 superfamily member 3    107   4e-23   
ref|XP_004990450.1|  endomembrane protein emp70                         107   4e-23   
ref|XP_010779545.1|  PREDICTED: transmembrane 9 superfamily member 3    107   4e-23   
emb|CAN67239.1|  hypothetical protein VITISV_004804                     108   4e-23   
ref|XP_004838634.1|  PREDICTED: transmembrane 9 superfamily member 3    107   4e-23   
ref|XP_001101439.1|  PREDICTED: transmembrane 9 superfamily membe...    107   4e-23   
ref|XP_011431162.1|  PREDICTED: transmembrane 9 superfamily membe...    107   4e-23   
ref|XP_002181450.1|  predicted protein                                  107   4e-23   
ref|XP_006090050.1|  PREDICTED: transmembrane 9 superfamily member 3    107   4e-23   
ref|XP_004268440.1|  PREDICTED: transmembrane 9 superfamily member 3    107   4e-23   
gb|EKC28088.1|  Transmembrane 9 superfamily member 1                    106   4e-23   
ref|XP_007456252.1|  PREDICTED: transmembrane 9 superfamily member 3    106   5e-23   
ref|XP_003223180.1|  PREDICTED: transmembrane 9 superfamily member 3    106   5e-23   
emb|CCD80518.1|  putative transmembrane 9 superfamily protein member    107   5e-23   
ref|XP_005481354.1|  PREDICTED: transmembrane 9 superfamily member 3    106   5e-23   
ref|XP_004526831.1|  PREDICTED: transmembrane 9 superfamily membe...    106   5e-23   
ref|XP_001656277.1|  AAEL012833-PA                                      106   6e-23   
ref|XP_006659860.1|  PREDICTED: putative phagocytic receptor 1b-like    106   6e-23   
ref|XP_001662153.1|  AAEL012016-PA                                      106   6e-23   
ref|XP_003573450.1|  PREDICTED: putative phagocytic receptor 1b         106   6e-23   
ref|XP_011499824.1|  PREDICTED: transmembrane 9 superfamily member 3    106   6e-23   
gb|EDL41855.1|  mCG2375, isoform CRA_b                                  106   6e-23   
ref|XP_003226712.1|  PREDICTED: transmembrane 9 superfamily member 1    106   6e-23   
ref|XP_003737486.1|  PREDICTED: uncharacterized protein LOC100897570    107   7e-23   
ref|XP_011420426.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    106   7e-23   
ref|XP_005025240.1|  PREDICTED: transmembrane 9 superfamily membe...    106   7e-23   
ref|XP_005186343.1|  PREDICTED: transmembrane 9 superfamily member 3    106   7e-23   
ref|XP_011203691.1|  PREDICTED: transmembrane 9 superfamily member 3    106   7e-23   
ref|XP_002973969.1|  hypothetical protein SELMODRAFT_173941             106   8e-23   
gb|KFP68674.1|  Transmembrane 9 superfamily member 3                    105   8e-23   
gb|ABK25212.1|  unknown                                                 103   8e-23   
ref|XP_007637675.1|  PREDICTED: transmembrane 9 superfamily membe...    105   8e-23   
gb|KFP38896.1|  Transmembrane 9 superfamily member 3                    105   8e-23   
ref|XP_002596465.1|  hypothetical protein BRAFLDRAFT_286243             105   9e-23   
ref|XP_003755285.1|  PREDICTED: transmembrane 9 superfamily member 3    105   9e-23   
ref|XP_421629.4|  PREDICTED: transmembrane 9 superfamily member 3       105   9e-23   
ref|XP_006014905.1|  PREDICTED: transmembrane 9 superfamily member 3    105   9e-23   
ref|XP_002936010.2|  PREDICTED: transmembrane 9 superfamily member 3    105   1e-22   
gb|KGB41393.1|  Transmembrane 9 superfamily member 3                    104   1e-22   
ref|XP_005092501.1|  PREDICTED: transmembrane 9 superfamily membe...    105   1e-22   
ref|XP_010712722.1|  PREDICTED: transmembrane 9 superfamily membe...    105   1e-22   
gb|ELR54176.1|  Transmembrane 9 superfamily member 3                    105   1e-22   
ref|XP_005984512.1|  PREDICTED: transmembrane 9 superfamily member 3    105   1e-22   
ref|XP_007478767.1|  PREDICTED: transmembrane 9 superfamily membe...    105   1e-22   
emb|CDY52038.1|  BnaA08g31510D                                          104   1e-22   
ref|XP_009110529.1|  PREDICTED: putative phagocytic receptor 1b         105   1e-22   
ref|XP_008773120.1|  PREDICTED: transmembrane 9 superfamily membe...    105   1e-22   
ref|XP_007478768.1|  PREDICTED: transmembrane 9 superfamily membe...    105   1e-22   
ref|XP_010712721.1|  PREDICTED: transmembrane 9 superfamily membe...    105   1e-22   
gb|KFP08579.1|  Transmembrane 9 superfamily member 3                    105   1e-22   
gb|KFO94520.1|  Transmembrane 9 superfamily member 3                    105   1e-22   
gb|KIH62674.1|  endomembrane protein 70                                 104   1e-22   
gb|KFQ90694.1|  Transmembrane 9 superfamily member 3                    105   1e-22   
ref|XP_005048681.1|  PREDICTED: transmembrane 9 superfamily member 3    105   1e-22   
dbj|BAJ89513.1|  predicted protein                                      105   1e-22   



>gb|KHG16990.1| Transmembrane 9 superfamily member 3 [Gossypium arboreum]
Length=328

 Score =   209 bits (533),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPGTNPAHKWGGLGEVLGGNELIDS  90

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVDK  ICQLELDE KVR+FKDAIENSYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  91   QIDIKFQKNVDKSTICQLELDEVKVRQFKDAIENSYWFEFFMDDLPLWGFVGELHPDKNS  150

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I +KYN DQII
Sbjct  151  DNGKHVLYTHKNIVIKYNKDQII  173



>ref|XP_009796637.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   213 bits (543),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFC AS  + H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS-GSTHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVDKG IC+LELDETKV+ FKDAIEN+YWFEFF+DDLPLWGFVG+L  DRNS
Sbjct  88   QIDIKFQKNVDKGGICELELDETKVKLFKDAIENNYWFEFFIDDLPLWGFVGELHTDRNS  147

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            DNK V++TH +I +KYN DQII
Sbjct  148  DNKHVLYTHKNINIKYNKDQII  169



>gb|KCW57093.1| hypothetical protein EUGRSUZ_I02743 [Eucalyptus grandis]
Length=483

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PD+ VTLWVNKVGPY NPQETYNYYSLPFCRA  N  H+WGGLGEVLGGNELIDS
Sbjct  25   DHKYQPDEAVTLWVNKVGPYNNPQETYNYYSLPFCRAPGNPAHKWGGLGEVLGGNELIDS  84

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKFQK V+KG ICQLELDE KV++FKDAIENSYWFEFF+DDLPLWGFVG+L  D+NS
Sbjct  85   QIEIKFQKKVEKGVICQLELDEAKVKQFKDAIENSYWFEFFIDDLPLWGFVGELHADKNS  144

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            D K V++TH SI++KYN +QII
Sbjct  145  DTKHVLYTHKSISIKYNKNQII  166



>ref|XP_006339920.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 129/142 (91%), Gaps = 3/142 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQADDPVTLWVNKVGPYNNPQETYNYYSLPFCHASGNT-HKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+++FQKNVDKG IC+LELDETKV++FKDAIEN+YWFEFF+DDLPLWGFVG+L  DRNS
Sbjct  88   QIDLRFQKNVDKGSICELELDETKVKQFKDAIENNYWFEFFIDDLPLWGFVGELHTDRNS  147

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            DNK V++TH +I +KYN DQII
Sbjct  148  DNKHVLYTHKNINIKYNKDQII  169



>gb|KJB79238.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=593

 Score =   211 bits (537),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPGTNPAHKWGGLGEVLGGNELIDS  91

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNV+K  ICQLELDE KVR+FKDAIENSYWFEFFMDDLPLWGFVG+L  DRNS
Sbjct  92   QIDIKFQKNVEKSTICQLELDEAKVREFKDAIENSYWFEFFMDDLPLWGFVGELHPDRNS  151

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I +K+N DQII
Sbjct  152  DNSKHVLYTHKNIIIKFNKDQII  174



>ref|XP_010030126.1| PREDICTED: transmembrane 9 superfamily member 3 [Eucalyptus grandis]
 gb|KCW57092.1| hypothetical protein EUGRSUZ_I02743 [Eucalyptus grandis]
Length=585

 Score =   211 bits (536),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PD+ VTLWVNKVGPY NPQETYNYYSLPFCRA  N  H+WGGLGEVLGGNELIDS
Sbjct  25   DHKYQPDEAVTLWVNKVGPYNNPQETYNYYSLPFCRAPGNPAHKWGGLGEVLGGNELIDS  84

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKFQK V+KG ICQLELDE KV++FKDAIENSYWFEFF+DDLPLWGFVG+L  D+NS
Sbjct  85   QIEIKFQKKVEKGVICQLELDEAKVKQFKDAIENSYWFEFFIDDLPLWGFVGELHADKNS  144

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            D K V++TH SI++KYN +QII
Sbjct  145  DTKHVLYTHKSISIKYNKNQII  166



>gb|KJB12212.1| hypothetical protein B456_002G006200 [Gossypium raimondii]
Length=592

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 128/143 (90%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDP+TLWVNKVGPY NPQETYNYYSLPFC+   N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQPDDPITLWVNKVGPYNNPQETYNYYSLPFCQPGTNPAHKWGGLGEVLGGNELIDS  90

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI++KFQKNVD+G ICQLELDE KVR+FKDAIE+SYWFEFF+DDLPLWGFVG+L  DRNS
Sbjct  91   QIDMKFQKNVDRGTICQLELDEAKVRQFKDAIESSYWFEFFVDDLPLWGFVGELHPDRNS  150

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I +KYN DQII
Sbjct  151  ENGKHVLYTHKNIVIKYNKDQII  173



>gb|KJB77693.1| hypothetical protein B456_012G151500 [Gossypium raimondii]
Length=569

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPGTNPSHKWGGLGEVLGGNELIDS  90

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVDK  ICQLELDE KVR+FKDAIENSYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  91   QIDIKFQKNVDKSTICQLELDEAKVRQFKDAIENSYWFEFFMDDLPLWGFVGELHPDKNS  150

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I +KYN DQII
Sbjct  151  DNGKHVLYTHKNIVIKYNKDQII  173



>gb|KJB77692.1| hypothetical protein B456_012G151500 [Gossypium raimondii]
Length=592

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPGTNPSHKWGGLGEVLGGNELIDS  90

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVDK  ICQLELDE KVR+FKDAIENSYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  91   QIDIKFQKNVDKSTICQLELDEAKVRQFKDAIENSYWFEFFMDDLPLWGFVGELHPDKNS  150

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I +KYN DQII
Sbjct  151  DNGKHVLYTHKNIVIKYNKDQII  173



>ref|XP_010930775.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
 ref|XP_010930776.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
Length=586

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK DDPVTLWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYKADDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI IKFQKNVDKG IC LELD  KV++F DAI NSYWFEFF+DDLPLWGFVG+ D+N++N
Sbjct  88   QIEIKFQKNVDKGSICTLELDAAKVKQFTDAIVNSYWFEFFIDDLPLWGFVGETDKNNEN  147

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I V+YN +QII
Sbjct  148  KHFLFTHKNIVVRYNNNQII  167



>ref|XP_009776073.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 4/142 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFC AS    H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS--GSHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+I+FQKNVDKG IC+LELDE KV++FKDAIEN+YWFEFF+DDLPLWGFVG+   DRNS
Sbjct  88   QIDIRFQKNVDKGSICELELDEAKVKQFKDAIENNYWFEFFIDDLPLWGFVGEQHPDRNS  147

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            DNK V++TH +I ++YN DQII
Sbjct  148  DNKHVLYTHKNIHIRYNKDQII  169



>gb|KJB47460.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=571

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDP+TLWVNKVGPY NPQETYNYY LPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPITLWVNKVGPYNNPQETYNYYILPFCHPGVNPAHKWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF+KNVDKG ICQLELDE KV++FKDAIENSYWFEFF+DDLPLWGFVG+L  D+NS
Sbjct  89   QIDIKFRKNVDKGTICQLELDEAKVKQFKDAIENSYWFEFFVDDLPLWGFVGELHPDKNS  148

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH ++ +KYN DQII
Sbjct  149  DNGKHVLYTHKNVVIKYNKDQII  171



>ref|XP_008218557.1| PREDICTED: transmembrane 9 superfamily member 3 [Prunus mume]
Length=589

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 127/143 (89%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++PVTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQTEEPVTLWVNKVGPYNNPQETYNYYSLPFCHPSENAAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVD+  ICQLELD+ KV++FKDAIENSYWFEFFMDDLPLW FVG+L  D+NS
Sbjct  88   QIDIKFQKNVDRATICQLELDDQKVKQFKDAIENSYWFEFFMDDLPLWSFVGELHQDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V+FTH +I VKYN DQII
Sbjct  148  ENGKHVLFTHKNIIVKYNKDQII  170



>gb|KJB47458.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=590

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDP+TLWVNKVGPY NPQETYNYY LPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPITLWVNKVGPYNNPQETYNYYILPFCHPGVNPAHKWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF+KNVDKG ICQLELDE KV++FKDAIENSYWFEFF+DDLPLWGFVG+L  D+NS
Sbjct  89   QIDIKFRKNVDKGTICQLELDEAKVKQFKDAIENSYWFEFFVDDLPLWGFVGELHPDKNS  148

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH ++ +KYN DQII
Sbjct  149  DNGKHVLYTHKNVVIKYNKDQII  171



>ref|XP_007221993.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
 gb|EMJ23192.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
Length=589

 Score =   206 bits (524),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++PVTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQTEEPVTLWVNKVGPYNNPQETYNYYSLPFCHPSENAAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVD+  ICQLELD+ KV++FKDAIENSYWFEFFMDDLPLW FVG+L  D+NS
Sbjct  88   QIDIKFQKNVDRATICQLELDDQKVKQFKDAIENSYWFEFFMDDLPLWSFVGELHQDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V+FTH  I VKYN DQII
Sbjct  148  ENGKHVLFTHKLIIVKYNKDQII  170



>gb|KJB47461.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=576

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDP+TLWVNKVGPY NPQETYNYY LPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPITLWVNKVGPYNNPQETYNYYILPFCHPGVNPAHKWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF+KNVDKG ICQLELDE KV++FKDAIENSYWFEFF+DDLPLWGFVG+L  D+NS
Sbjct  89   QIDIKFRKNVDKGTICQLELDEAKVKQFKDAIENSYWFEFFVDDLPLWGFVGELHPDKNS  148

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH ++ +KYN DQII
Sbjct  149  DNGKHVLYTHKNVVIKYNKDQII  171



>ref|XP_009600607.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 3/142 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFC AS  + H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS-GSTHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF KNVDK  IC+LELD+TKV+ FKDAIEN+YWFEFF+DDLPLWGFVG+L  DRNS
Sbjct  88   QIDIKFHKNVDKSGICELELDDTKVKLFKDAIENNYWFEFFIDDLPLWGFVGELRTDRNS  147

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            D+K V++TH +I +KYN DQII
Sbjct  148  DSKHVLYTHKNINIKYNKDQII  169



>ref|XP_004230474.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 4/142 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC AS    H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS--GSHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVDKG IC+LELDE KV++FKDAIEN+YWFEFF+DDLP+WGFVG+   DRNS
Sbjct  88   QIDIKFQKNVDKGSICELELDEAKVKQFKDAIENNYWFEFFIDDLPMWGFVGEQHPDRNS  147

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            DNK V++TH +I +KYN DQII
Sbjct  148  DNKHVLYTHKNIHIKYNKDQII  169



>ref|XP_006349354.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   206 bits (523),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 126/142 (89%), Gaps = 4/142 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC AS    H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS--GSHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVDKG IC+LELDE KV++FKDAIEN+YWFEFF+DDLP+WGFVG+   DRNS
Sbjct  88   QIDIKFQKNVDKGSICELELDEAKVKQFKDAIENNYWFEFFIDDLPMWGFVGEQHPDRNS  147

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            DNK V++TH +I +KYN DQII
Sbjct  148  DNKHVLYTHKNIHIKYNKDQII  169



>gb|KDO50082.1| hypothetical protein CISIN_1g012251mg [Citrus sinensis]
 gb|KDO50083.1| hypothetical protein CISIN_1g012251mg [Citrus sinensis]
Length=467

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQQDEPVTLWVNKVGPYNNPQETYNYYSLPFCHASGNPAHKWGGLGEVLGGNELIDS  85

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQ+NVDK  IC L+LDE KV++FKDAIEN+YWFEFF+DDLPLWGFVGDL  D+NS
Sbjct  86   QIDIKFQRNVDKASICSLDLDEAKVKQFKDAIENNYWFEFFLDDLPLWGFVGDLHPDKNS  145

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH  I  KYN DQII
Sbjct  146  DNGKHVLYTHKIINFKYNKDQII  168



>ref|XP_010912524.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X3 [Elaeis 
guineensis]
Length=512

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK DDPVTLWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYKADDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI +KFQ+NV+KG IC LELD  KV+ F DAI NSYW EFF+DDLPLWGFVG+ D+N++N
Sbjct  89   QIEMKFQRNVEKGSICALELDAAKVKHFTDAIVNSYWLEFFIDDLPLWGFVGETDKNNEN  148

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH SI ++YN  QII
Sbjct  149  KHFLFTHKSIVIRYNNSQII  168



>ref|XP_008456054.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis melo]
Length=632

 Score =   205 bits (521),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFC  S ++ H+WGGLGEVLGGNELIDS
Sbjct  71   DHKYQQDELVTLWVNKVGPYNNPQETYNYYSLPFCHPSGHSAHKWGGLGEVLGGNELIDS  130

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKFQKNV++  ICQLELDE+KV++FKDAIEN YWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  131  QIEIKFQKNVERTTICQLELDESKVKQFKDAIENGYWFEFFMDDLPLWGFVGELHPDKNS  190

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I +KYN DQII
Sbjct  191  NNVKHVLYTHKNIIIKYNKDQII  213



>ref|XP_008339497.1| PREDICTED: transmembrane 9 superfamily member 3-like [Malus domestica]
Length=589

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++ VTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYKTEESVTLWVNKVGPYNNPQETYNYYSLPFCHQSENAAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKFQKNVD+  ICQLELD+ KV+ FKDAIEN+YWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  88   QIEIKFQKNVDRAXICQLELDDQKVKHFKDAIENNYWFEFFMDDLPLWGFVGELHXDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYNXDQII
Sbjct  148  ENGKHVLYTHKNIIVKYNXDQII  170



>ref|XP_009348753.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++ VTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYKAEESVTLWVNKVGPYNNPQETYNYYSLPFCHRSENAAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKFQKNVD+  ICQLELD+ KV+ FKDAIEN+YWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  88   QIEIKFQKNVDRATICQLELDDQKVKHFKDAIENNYWFEFFMDDLPLWGFVGELHQDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  148  ENGKHVLYTHKNIIVKYNNDQII  170



>ref|XP_009602812.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 4/142 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC AS    H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQSDDPVTLWVNKVGPYNNPQETYNYYSLPFCHAS--GSHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+I+FQKNVDKG IC+LELDE KV++FKDAIEN+YWFEFF+DDLPLWGFVG+   D+NS
Sbjct  88   QIDIRFQKNVDKGSICELELDEAKVKQFKDAIENNYWFEFFIDDLPLWGFVGEQHPDKNS  147

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            DNK V++TH +I ++YN DQII
Sbjct  148  DNKHVLYTHKNIHIRYNKDQII  169



>gb|KHG20578.1| Tm9sf3 [Gossypium arboreum]
Length=639

 Score =   205 bits (521),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 112/166 (67%), Positives = 127/166 (77%), Gaps = 27/166 (16%)
 Frame = +1

Query  211  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQ  390
            HKY+PDDP+TLWVNKVGPY NPQETYNYYSLPFC+   N  H+WGGLGEVLGGNELIDSQ
Sbjct  32   HKYQPDDPITLWVNKVGPYNNPQETYNYYSLPFCQPGTNPAHKWGGLGEVLGGNELIDSQ  91

Query  391  INIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFM-------------------  513
            I++KFQKNVD+G ICQLELDE KVR+FKDAIENSYWFEFF+                   
Sbjct  92   IDMKFQKNVDRGTICQLELDEAKVRQFKDAIENSYWFEFFVALTLYCPCLFVDAMPHALR  151

Query  514  -----DDLPLWGFVGDL--DRNSDN-KPVIFTHXSITVKYNXDQII  627
                 DDLPLWGFVG+L  DRNS+N K V++TH +I +KYN DQII
Sbjct  152  NAESSDDLPLWGFVGELHPDRNSENGKHVLYTHKNIVIKYNKDQII  197



>ref|XP_011464826.1| PREDICTED: transmembrane 9 superfamily member 1 [Fragaria vesca 
subsp. vesca]
Length=598

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++ VTLWVNKVGPY NPQETYNYYSLPFCR S+NA H+WGGLGEVLGGNELIDS
Sbjct  37   DHKYQAEEAVTLWVNKVGPYNNPQETYNYYSLPFCRPSDNAAHKWGGLGEVLGGNELIDS  96

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF KNVD+  ICQLELD+ KV++FKDAIENSYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  97   QIDIKFGKNVDRATICQLELDDHKVKQFKDAIENSYWFEFFMDDLPLWGFVGELHQDKNS  156

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V+FTH +I +KYN DQII
Sbjct  157  ENGKHVLFTHKNIIIKYNKDQII  179



>gb|KJB79240.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=591

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 124/141 (88%), Gaps = 3/141 (2%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            +Y+PDDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDSQI
Sbjct  32   QYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHPGTNPAHKWGGLGEVLGGNELIDSQI  91

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
            +IKFQKNV+K  ICQLELDE KVR+FKDAIENSYWFEFFMDDLPLWGFVG+L  DRNSDN
Sbjct  92   DIKFQKNVEKSTICQLELDEAKVREFKDAIENSYWFEFFMDDLPLWGFVGELHPDRNSDN  151

Query  568  -KPVIFTHXSITVKYNXDQII  627
             K V++TH +I +K+N DQII
Sbjct  152  SKHVLYTHKNIIIKFNKDQII  172



>gb|KGN57596.1| hypothetical protein Csa_3G222780 [Cucumis sativus]
Length=664

 Score =   205 bits (521),  Expect = 4e-58, Method: Composition-based stats.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY  D+ VTLWVNKVGPY NPQETYNYYSLPFC  S ++ H+WGGLGEVLGGNELIDS
Sbjct  103  DHKYLQDESVTLWVNKVGPYNNPQETYNYYSLPFCHPSGHSAHKWGGLGEVLGGNELIDS  162

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKFQKNV++  ICQLELDE+KV++FKDAIEN YWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  163  QIEIKFQKNVERTTICQLELDESKVKQFKDAIENGYWFEFFMDDLPLWGFVGELHPDKNS  222

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I +KYN DQII
Sbjct  223  NNVKHVLYTHKNIIIKYNKDQII  245



>ref|XP_010912522.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Elaeis 
guineensis]
Length=587

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK DDPVTLWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYKADDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI +KFQ+NV+KG IC LELD  KV+ F DAI NSYW EFF+DDLPLWGFVG+ D+N++N
Sbjct  89   QIEMKFQRNVEKGSICALELDAAKVKHFTDAIVNSYWLEFFIDDLPLWGFVGETDKNNEN  148

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH SI ++YN  QII
Sbjct  149  KHFLFTHKSIVIRYNNSQII  168



>ref|XP_009355251.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ +D VTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQAEDSVTLWVNKVGPYNNPQETYNYYSLPFCHQSENAAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
             I IKFQKNVD+  ICQLELD+ KV++FKDAIEN+YWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  88   LIEIKFQKNVDRTTICQLELDDQKVKQFKDAIENNYWFEFFMDDLPLWGFVGELHQDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH SI VKYN DQII
Sbjct  148  ENGKHVLYTHKSIIVKYNKDQII  170



>gb|KDP38816.1| hypothetical protein JCGZ_04973 [Jatropha curcas]
Length=596

 Score =   204 bits (518),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 146/173 (84%), Gaps = 3/173 (2%)
 Frame = +1

Query  118  STATVMLHAVGIlsflaavlvvspvlasesDHKYKPDDPVTLWVNKVGPYYNPQETYNYY  297
            STAT +   V  L    +++ +SP LASESDHKY+PD+PVTLWVNKVGPY NPQETYNYY
Sbjct  5    STATTVRSTVVFLFAFVSLISLSPALASESDHKYQPDEPVTLWVNKVGPYNNPQETYNYY  64

Query  298  SLPFCRASENAPHRWgglgevlggnelIDSQINIKFQKNVDKGHICQLELDETKVRKFKD  477
            SLPFC  S +A H+WGGLGEVLGGNELIDS+I+IKF +NV++  IC L+LDE+KV++FKD
Sbjct  65   SLPFCHPSGSAAHKWGGLGEVLGGNELIDSKIDIKFLRNVERSTICSLDLDESKVKQFKD  124

Query  478  AIENSYWFEFFMDDLPLWGFVGDL--DRNSDN-KPVIFTHXSITVKYNXDQII  627
            AIEN+YWFEFFMDDLPLWGFVG+L  D+NSDN K V++TH SITV+YN DQII
Sbjct  125  AIENNYWFEFFMDDLPLWGFVGELHPDKNSDNGKHVLYTHKSITVRYNKDQII  177



>ref|XP_004248848.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   203 bits (517),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 3/142 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQADDPVTLWVNKVGPYNNPQETYNYYSLPFCHASGNT-HKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+++FQKNVDKG IC+LELDE KV++FKDAIEN+YW EFF+DDLPLWGFVG+L  DR S
Sbjct  88   QIDLRFQKNVDKGSICELELDEMKVKQFKDAIENNYWSEFFIDDLPLWGFVGELHTDRIS  147

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            DNK V++TH +I +KYN DQII
Sbjct  148  DNKHVLYTHKNINIKYNKDQII  169



>ref|XP_008378878.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Malus domestica]
Length=589

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++ VTLWVNKVGPY NPQETYNYYSLPFC  SENA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQTEESVTLWVNKVGPYNNPQETYNYYSLPFCHQSENAAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKFQKNVD+  ICQLELD+ KV++FKDAIEN+YWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  88   QIEIKFQKNVDRATICQLELDDQKVKQFKDAIENNYWFEFFMDDLPLWGFVGELQQDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
             N K V++TH +I VKYN DQII
Sbjct  148  GNGKHVLYTHKNIIVKYNNDQII  170



>ref|XP_002269498.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI29766.3| unnamed protein product [Vitis vinifera]
Length=592

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++PVTLWVNKVGPY NPQETYNYYSLPFCR    A H+W GLGE+LGGNELI+S
Sbjct  32   DHKYQQNEPVTLWVNKVGPYNNPQETYNYYSLPFCRPPGKAVHKWIGLGELLGGNELIES  91

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVDKG ICQLELDE KV++FKDAIEN+YW EFF+DDLPLWGFVG+L  D+NS
Sbjct  92   QIDIKFQKNVDKGVICQLELDEAKVKQFKDAIENNYWLEFFVDDLPLWGFVGELHPDKNS  151

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            DNK V+FTH +I + YN +QII
Sbjct  152  DNKHVLFTHKNINITYNKNQII  173



>ref|XP_011092338.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Sesamum 
indicum]
Length=588

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PD+PVTLWVNKVGPY+NPQETYNYYSLPFC  S NA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQPDEPVTLWVNKVGPYHNPQETYNYYSLPFCHPSGNAAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
             I+IKF+K V+K  IC+LELDE KV++FKDAIEN+YWFEFFMDDLPLWGFVG+L  +RN 
Sbjct  88   LIDIKFKKPVEKTTICELELDEEKVKQFKDAIENNYWFEFFMDDLPLWGFVGELHSERNG  147

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            DNK V++TH  I V YN DQII
Sbjct  148  DNKHVLYTHKIINVLYNKDQII  169



>ref|XP_006431823.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
 gb|ESR45063.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
Length=587

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQQDEPVTLWVNKVGPYNNPQETYNYYSLPFCHASGNPAHKWGGLGEVLGGNELIDS  85

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQ+NVDK  IC L+LDE KV++FKDAIEN+YWFEFF+DDLPLWGFVGDL  D+NS
Sbjct  86   QIDIKFQRNVDKATICSLDLDEAKVKQFKDAIENNYWFEFFLDDLPLWGFVGDLHPDKNS  145

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH  I+ KYN DQII
Sbjct  146  DNGKHVLYTHKIISFKYNKDQII  168



>ref|XP_010272575.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nelumbo 
nucifera]
Length=466

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DD VTLWVNKVGPY NPQETYNYYSLPFC+   NA H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQQDDLVTLWVNKVGPYNNPQETYNYYSLPFCQPPGNAAHKWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVD+  IC+LEL+  KV++FKDAIEN+YWFEFFMDDLPLWGFVGDL  D+NS
Sbjct  89   QIDIKFQKNVDRATICELELNAAKVKQFKDAIENTYWFEFFMDDLPLWGFVGDLHPDKNS  148

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            ++ K V+FTH +I VKYN DQII
Sbjct  149  ESGKHVLFTHKNIVVKYNRDQII  171



>ref|XP_006471014.1| PREDICTED: transmembrane 9 superfamily member 3-like [Citrus 
sinensis]
Length=587

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQQDEPVTLWVNKVGPYNNPQETYNYYSLPFCHASGNPAHKWGGLGEVLGGNELIDS  85

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQ+NVDK  IC L+LDE KV++FKDAIEN+YWFEFF+DDLPLWGFVGDL  D+NS
Sbjct  86   QIDIKFQRNVDKATICSLDLDEAKVKQFKDAIENNYWFEFFLDDLPLWGFVGDLHPDKNS  145

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH  I  KYN DQII
Sbjct  146  DNGKHVLYTHKIINFKYNKDQII  168



>ref|XP_008783371.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=586

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC+ S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQADDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSGNPAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKFQ+NVDKG IC+LELD    ++FKDAIE+SYWFEFFMDDLPLWGFVG+ D+ ++N
Sbjct  88   QIDIKFQRNVDKGSICRLELDAANAKQFKDAIESSYWFEFFMDDLPLWGFVGETDKKNEN  147

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I V+YN ++II
Sbjct  148  KLYLFTHKNIIVQYNGERII  167



>ref|XP_002530674.1| endomembrane protein emp70, putative [Ricinus communis]
 gb|EEF31705.1| endomembrane protein emp70, putative [Ricinus communis]
Length=602

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 126/143 (88%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNK+GPY NPQETYNYYSLPFC  S +A H+WGGLGEVLGGNELIDS
Sbjct  41   DHKYQQDESVTLWVNKIGPYNNPQETYNYYSLPFCHPSGSAGHKWGGLGEVLGGNELIDS  100

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I+IKFQKNV++G IC LELDE +V+ FKDAIEN+YWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  101  KIDIKFQKNVERGTICSLELDEARVKIFKDAIENNYWFEFFMDDLPLWGFVGELRPDKNS  160

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH SITV+YN DQII
Sbjct  161  DNGKHVLYTHKSITVRYNKDQII  183



>ref|XP_002452255.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
 gb|EES05231.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
Length=585

 Score =   201 bits (510),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++PVTLWVNKVGPY NPQETYNYYSLPFC ASEN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQAEEPVTLWVNKVGPYNNPQETYNYYSLPFCHASENHVHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF+KNVDK  IC L+LD  K ++  DAIENSYWFEFF+DDLPLWGFVG+ DRN+DN
Sbjct  87   QIDIKFRKNVDKATICSLDLDLVKAKQLSDAIENSYWFEFFIDDLPLWGFVGEADRNNDN  146

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I ++YN +QII
Sbjct  147  KYFLFTHKNIVIRYNGNQII  166



>ref|XP_008781558.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Phoenix 
dactylifera]
Length=558

 Score =   200 bits (508),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            +YK DDPV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDSQI
Sbjct  2    QYKADDPVALWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDSQI  61

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDNKP  573
            +IKFQKNVDKG IC LELD  KV+ F DAI NSYWFEFF+DDLPLWGFVG+ D+N++NK 
Sbjct  62   DIKFQKNVDKGSICMLELDAAKVKHFTDAIVNSYWFEFFIDDLPLWGFVGETDKNNENKH  121

Query  574  VIFTHXSITVKYNXDQII  627
             +FTH +I V+YN +QII
Sbjct  122  FLFTHKNIVVRYNNNQII  139



>ref|XP_010246919.1| PREDICTED: transmembrane 9 superfamily member 3 [Nelumbo nucifera]
Length=591

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DD VTLWVNKVGPY NPQETYNYYSLPFC+   N+ H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQQDDLVTLWVNKVGPYNNPQETYNYYSLPFCQPPGNSAHKWGGLGEVLGGNELIDS  89

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNVD+  IC+L LD  KV++FKDAIEN+YWFEFFMDDLPLWGFVGDL  D+NS
Sbjct  90   QIDIKFQKNVDRATICELALDAAKVKQFKDAIENTYWFEFFMDDLPLWGFVGDLHPDKNS  149

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            D+ K V+FTH +I VKYN DQII
Sbjct  150  DSGKHVLFTHKNIVVKYNRDQII  172



>ref|XP_008681382.1| PREDICTED: uncharacterized protein LOC100272502 isoform X2 [Zea 
mays]
Length=585

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+  +PVTLWVNKVGPY NPQETYNYYSLPFC ASEN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQAAEPVTLWVNKVGPYNNPQETYNYYSLPFCHASENHVHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF KNVDK  IC L+LD  K ++  DAIENSYWFEFF+DDLPLWGFVG+ DRN+DN
Sbjct  87   QIDIKFGKNVDKATICSLDLDLVKAKQLSDAIENSYWFEFFIDDLPLWGFVGEADRNNDN  146

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I ++YN +QII
Sbjct  147  KYFLFTHKNIVIRYNGNQII  166



>ref|XP_008681381.1| PREDICTED: uncharacterized protein LOC100272502 isoform X1 [Zea 
mays]
Length=588

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+  +PVTLWVNKVGPY NPQETYNYYSLPFC ASEN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQAAEPVTLWVNKVGPYNNPQETYNYYSLPFCHASENHVHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF KNVDK  IC L+LD  K ++  DAIENSYWFEFF+DDLPLWGFVG+ DRN+DN
Sbjct  87   QIDIKFGKNVDKATICSLDLDLVKAKQLSDAIENSYWFEFFIDDLPLWGFVGEADRNNDN  146

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I ++YN +QII
Sbjct  147  KYFLFTHKNIVIRYNGNQII  166



>ref|XP_010910845.1| PREDICTED: transmembrane 9 superfamily member 1-like [Elaeis 
guineensis]
Length=586

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC+ S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQVDDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSGNPAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI IKFQ+NVDK  IC+LELD  KV++FKDAI++SYWFEFFMDDLPLWG+VG++D+ ++N
Sbjct  88   QIEIKFQRNVDKHFICRLELDAAKVKQFKDAIQSSYWFEFFMDDLPLWGYVGEIDKKNEN  147

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I V+YN ++II
Sbjct  148  KLYLFTHSNILVQYNGERII  167



>gb|AGE46034.1| putative transmembrane 9 superfamily member 3 protein [Elaeis 
guineensis]
Length=586

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFC+ S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQVDDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSGNPAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI IKFQ+NVDK  IC+LELD  KV++FKDAI++SYWFEFFMDDLPLWG+VG++D+ ++N
Sbjct  88   QIEIKFQRNVDKRFICRLELDAAKVKQFKDAIQSSYWFEFFMDDLPLWGYVGEIDKKNEN  147

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I V+YN ++II
Sbjct  148  KLYLFTHSNILVQYNGERII  167



>emb|CDY34667.1| BnaC08g42260D [Brassica napus]
Length=665

 Score =   199 bits (507),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  104  DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSHNDVHKWGGLGEVLGGNELIDS  163

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC+LELDE KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+N 
Sbjct  164  EIPIKFLKNVDRNVICKLELDEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHSDKNG  223

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  224  ENAKHVLYTHKNIVVKYNKDQII  246



>ref|XP_009104187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=594

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDS
Sbjct  33   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRKTENSIHKWGGLGEVLGGNELIDS  92

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF KNVD+  ICQLELDE KV+ FKDAIENSYWFE FMDDLPLWGFVG++   +NS
Sbjct  93   QIDIKFLKNVDRSVICQLELDEAKVKHFKDAIENSYWFELFMDDLPLWGFVGEMPPGKNS  152

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K  ++TH SI VKYN DQII
Sbjct  153  ENGKHALYTHKSINVKYNKDQII  175



>ref|XP_008807671.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=591

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK DDPVTLW NKVGPY NPQETYNY+SLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  33   DHKYKVDDPVTLWANKVGPYNNPQETYNYHSLPFCQPSENPAHKWGGLGEVLGGNELIDS  92

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI IKFQ+NVDK  IC LELD  +V++F DAI NSYWFEFF+DDLPLWGFVG+ D+N++N
Sbjct  93   QIEIKFQRNVDKVSICTLELDAARVKQFTDAIVNSYWFEFFIDDLPLWGFVGETDKNNEN  152

Query  568  KPVIFTHXSITVKYNXDQII  627
               +FTH SI ++YN +QII
Sbjct  153  NHFLFTHKSIVIRYNNNQII  172



>emb|CDY03772.1| BnaC01g28890D [Brassica napus]
Length=594

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +EN  H+WGGLGEVLGGNELIDS
Sbjct  33   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRKTENTIHKWGGLGEVLGGNELIDS  92

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF KNVD+  ICQLELDE KV+ FKDAIENSYWFE FMDDLPLWGFVG++   +NS
Sbjct  93   QIDIKFLKNVDRSVICQLELDEAKVKHFKDAIENSYWFELFMDDLPLWGFVGEMPPGKNS  152

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K  ++TH SI VKYN DQII
Sbjct  153  ENGKHALYTHKSINVKYNKDQII  175



>ref|XP_006392092.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29378.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=591

 Score =   198 bits (503),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRKTENSVHKWGGLGEVLGGNELIDS  89

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF KNVD+  ICQLELDE KV+ FKDAIENSYWFE FMDDLPLWGFVG+L   +NS
Sbjct  90   QIDIKFLKNVDRSVICQLELDEPKVKHFKDAIENSYWFELFMDDLPLWGFVGELPPGKNS  149

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I +KYN DQII
Sbjct  150  ENGKHVLYTHKNIIIKYNKDQII  172



>ref|XP_004146261.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
 ref|XP_004159874.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
Length=593

 Score =   197 bits (502),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY  D+ VTLWVNKVGPY NPQETYNYYSLPFC  S ++ H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYLQDESVTLWVNKVGPYNNPQETYNYYSLPFCHPSGHSAHKWGGLGEVLGGNELIDS  91

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKFQKNV++  ICQLELDE+KV++FKDAIEN YWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  92   QIEIKFQKNVERTTICQLELDESKVKQFKDAIENGYWFEFFMDDLPLWGFVGELHPDKNS  151

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I +KYN DQII
Sbjct  152  NNVKHVLYTHKNIIIKYNKDQII  174



>ref|XP_004952828.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=585

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC A+EN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQADEPVTLWVNKVGPYNNPQETYNYYSLPFCHATENHVHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF+KNVDK  IC L+LD  K ++  DAIEN YWFEFF+DDLPLWGFVG+ DRN+DN
Sbjct  87   QIDIKFRKNVDKATICSLDLDLDKAKQLSDAIENLYWFEFFIDDLPLWGFVGEADRNNDN  146

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I ++YN +QII
Sbjct  147  KYFLFTHKNIVIRYNGNQII  166



>ref|XP_006417401.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
 gb|ESQ35754.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
Length=586

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  25   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSKNDVHKWGGLGEVLGGNELIDS  84

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  ICQLELDE KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  85   EIAIKFLKNVDRNVICQLELDEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  144

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  145  ENGKHVLYTHKNIIVKYNKDQII  167



>ref|XP_011028284.1| PREDICTED: transmembrane 9 superfamily member 1 [Populus euphratica]
Length=590

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 123/144 (85%), Gaps = 4/144 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN-APHRWgglgevlggnelID  384
            DH++  D+ V LWVNKVGPY NPQETYNYYSLPFC  S N   H+WGGLGEVLGGNELID
Sbjct  27   DHRFGQDEAVKLWVNKVGPYNNPQETYNYYSLPFCHPSGNDGTHKWGGLGEVLGGNELID  86

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRN  558
            SQI++KF KNVDK  ICQLELDE KV++FKDAIENSYWFEFF+DDLPLWGFVG+L  D+N
Sbjct  87   SQIDLKFAKNVDKAVICQLELDEAKVKQFKDAIENSYWFEFFIDDLPLWGFVGELRPDKN  146

Query  559  SDN-KPVIFTHXSITVKYNXDQII  627
            SDN K V+FTH SIT+KYN DQII
Sbjct  147  SDNGKHVLFTHKSITIKYNKDQII  170



>emb|CDY46193.1| BnaA01g23150D [Brassica napus]
Length=575

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +E + H+WGGLGEVLGGNELIDS
Sbjct  33   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRKTETSIHKWGGLGEVLGGNELIDS  92

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF KNVD+  ICQLELDE KV+ FKDAIENSYWFE FMDDLPLWGFVG++   +NS
Sbjct  93   QIDIKFLKNVDRSVICQLELDEAKVKHFKDAIENSYWFELFMDDLPLWGFVGEMPPGKNS  152

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K  ++TH SI VKYN DQII
Sbjct  153  ENGKHALYTHKSINVKYNKDQII  175



>ref|XP_004978867.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=586

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYKAEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPTHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF KNVDKG IC +ELD  KVR+F DAIE+SYWFE F+DDLPLWGFVG+ D+N++N
Sbjct  88   QIDIKFLKNVDKGLICTIELDAQKVRQFSDAIESSYWFELFIDDLPLWGFVGETDKNNEN  147

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  148  KHYLYTHKNIVVKYNGNRII  167



>tpg|DAA55531.1| TPA: hypothetical protein ZEAMMB73_446969 [Zea mays]
Length=592

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  34   DHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPTHKWGGLGEVLGGNELIDS  93

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            Q+ IKF KNV+KG IC LELD  KV++F DAIE+SYWFEFF+DDLPLWGFVG+ D+NS+N
Sbjct  94   QLEIKFLKNVEKGFICTLELDAKKVQQFADAIESSYWFEFFIDDLPLWGFVGETDKNSEN  153

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  154  KHYLYTHKNILVKYNDNRII  173



>ref|XP_002442907.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
 gb|EES16745.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
Length=594

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  36   DHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPTHKWGGLGEVLGGNELIDS  95

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            Q+ IKF KNV+KG IC LELD  KV++F DAIE+SYWFEFF+DDLPLWGFVG+ D+NS+N
Sbjct  96   QLEIKFLKNVEKGSICTLELDAKKVQQFADAIESSYWFEFFIDDLPLWGFVGETDKNSEN  155

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  156  KHYLYTHKNILVKYNDNRII  175



>ref|XP_009404975.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=635

 Score =   197 bits (501),  Expect = 2e-55, Method: Composition-based stats.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH Y+ DD VTLWVNKVGPY NPQETYNYY LPFC+   NA H+WGGLGEVLGGN+L+DS
Sbjct  30   DHTYQNDDHVTLWVNKVGPYNNPQETYNYYILPFCQLPGNAAHKWGGLGEVLGGNQLVDS  89

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI IKF+KNVDK  IC + LD  KV++FKDA+E+SYWFEFF+DDLPLWGF+G+ D+ ++N
Sbjct  90   QIEIKFRKNVDKASICAINLDAAKVKQFKDAVESSYWFEFFIDDLPLWGFIGETDKTNEN  149

Query  568  KPVIFTHXSITVKYNXDQII  627
            +  +FTH  I VKYN DQII
Sbjct  150  RHYLFTHKDIVVKYNGDQII  169



>ref|XP_010492170.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Camelina sativa]
Length=512

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSANNVHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC LELDE KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  88   EIAIKFLKNVDRNVICPLELDEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  148  ENGKHVLYTHKNIVVKYNKDQII  170



>ref|XP_010238659.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=594

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK  DPV LWVNKVGPY NPQETYNY+SLPFC+ SEN PH+WGGLGEVLGGNELIDS
Sbjct  36   DHKYKTGDPVKLWVNKVGPYNNPQETYNYHSLPFCQLSENPPHKWGGLGEVLGGNELIDS  95

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            Q++IKF  +V+KG IC LELD  K+++F DAIENSYWFEFF+DDLPLWGFVG+ D+NS+N
Sbjct  96   QLDIKFLSDVEKGSICTLELDSKKIQQFADAIENSYWFEFFIDDLPLWGFVGETDKNSEN  155

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  156  KHYLYTHKNILVKYNDNRII  175



>ref|XP_003592976.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES63227.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=583

 Score =   196 bits (497),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFCR   N  H+WGGLGEVLGGNELIDS
Sbjct  22   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCRPPGNTAHKWGGLGEVLGGNELIDS  81

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKF  NV++   C+L LDE KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+NS
Sbjct  82   QIEIKFLGNVERTTFCRLNLDEAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDKNS  141

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            D+ K V++TH +I VKYN DQII
Sbjct  142  DSGKHVLYTHKNIIVKYNTDQII  164



>gb|KHG20579.1| Tm9sf3 [Gossypium arboreum]
Length=626

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 127/166 (77%), Gaps = 27/166 (16%)
 Frame = +1

Query  211  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQ  390
            HKY+PDDP+TLWVNKVGPY NPQETYNYYSLPFC+   N  H+WGGLGEVLGGNELIDSQ
Sbjct  32   HKYQPDDPITLWVNKVGPYNNPQETYNYYSLPFCQPGTNPAHKWGGLGEVLGGNELIDSQ  91

Query  391  INIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFM-------------------  513
            I++KFQKNVD+G ICQLELDE KVR+FKDAIENSYWFEFF+                   
Sbjct  92   IDMKFQKNVDRGTICQLELDEAKVRQFKDAIENSYWFEFFVALTLYCPCLFVDAMPHALR  151

Query  514  -----DDLPLWGFVGDL--DRNSDN-KPVIFTHXSITVKYNXDQII  627
                 DDLPLWGFVG+L  DRNS+N K V++TH +I +KYN DQII
Sbjct  152  NAESSDDLPLWGFVGELHPDRNSENGKHVLYTHKNIVIKYNKDQII  197



>ref|XP_008662281.1| PREDICTED: uncharacterized protein LOC100501115 isoform X1 [Zea 
mays]
 gb|AFW56219.1| hypothetical protein ZEAMMB73_922033 [Zea mays]
Length=596

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  38   DHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPTHKWGGLGEVLGGNELIDS  97

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            Q+ IKF KNV+KG IC LELD  KV++F DAIE+SYWFEFF+DDLPLWGFVG+ D+NS+N
Sbjct  98   QLEIKFLKNVEKGFICTLELDAKKVQQFADAIESSYWFEFFIDDLPLWGFVGESDKNSEN  157

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  158  KHYLYTHKNILVKYNDNRII  177



>emb|CDY20974.1| BnaA08g25510D [Brassica napus]
Length=585

 Score =   196 bits (497),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  83

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGD--LDRNS  561
            +I IKF KNVD+  IC LELDE KV  FKDAIE+SYWFEFFMDDLPLWGFVG+  LD+NS
Sbjct  84   EIPIKFLKNVDRNVICHLELDEAKVNHFKDAIESSYWFEFFMDDLPLWGFVGELPLDKNS  143

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH SI VKYN DQII
Sbjct  144  ENGKHVLYTHKSIIVKYNKDQII  166



>ref|XP_010458475.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=589

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSANNVHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC LELDE KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  88   EIAIKFLKNVDRNVICPLELDEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  148  ENGKHVLYTHKNIVVKYNKDQII  170



>ref|XP_010492178.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Camelina sativa]
Length=589

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSANNVHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC LELDE KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  88   EIAIKFLKNVDRNVICPLELDEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  148  ENGKHVLYTHKNIVVKYNKDQII  170



>ref|XP_002449107.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
 gb|EES08095.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
Length=590

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPSHKWGGLGEVLGGNELIDS  91

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF KNVDKG IC +ELD  KV +F +AIENSYWFE F+DDLPLWGFVG+ D+N++N
Sbjct  92   QIDIKFIKNVDKGAICTIELDAQKVEQFANAIENSYWFELFIDDLPLWGFVGETDKNNEN  151

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  152  KHYLYTHKNIVVKYNGNRII  171



>emb|CDO97576.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH+Y+ +D VTLWVNKVGPY NPQETYNY+SLPFC       H+WGGLGEVLGGNELIDS
Sbjct  27   DHRYQDEDKVTLWVNKVGPYNNPQETYNYFSLPFCHPDGTVSHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
             I+IKF+KNV+K  IC+LELD+ KV++FKDAIENSYWFEFFMDDLPLWGFVG++  +RNS
Sbjct  87   LIDIKFKKNVEKSTICELELDDAKVKQFKDAIENSYWFEFFMDDLPLWGFVGEMRSERNS  146

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            D+K V+FTH SI V+YN DQII
Sbjct  147  DSKHVLFTHKSINVQYNKDQII  168



>ref|XP_009390763.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++PVTLWVNKVGPY NPQETYNY+SLPFC+ SEN  H+W GLGEVLGGNELIDS
Sbjct  29   DHKYQAEEPVTLWVNKVGPYNNPQETYNYHSLPFCQPSENPAHKWSGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            Q  IKFQ+NVD+G IC +ELD TKV++F DAIENSYWFEFF+DDLP+WGFVG+ D+N+ +
Sbjct  89   QFQIKFQRNVDRGSICTIELDATKVKQFADAIENSYWFEFFIDDLPMWGFVGETDKNNKD  148

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I +++N  QII
Sbjct  149  KRYLFTHKNIIIQHNEYQII  168



>ref|XP_002889842.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66101.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSGNNVHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC LELDE KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  87   EIAIKFLKNVDRNVICPLELDEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  146

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  147  ENGKHVLYTHKNIVVKYNKDQII  169



>ref|XP_010235535.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=588

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ +DPVTLWVNKVGPY NPQETYNYYSLPFC  S+N  H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQEEDPVTLWVNKVGPYNNPQETYNYYSLPFCHKSDNPVHKWGGLGEVLGGNELIDS  89

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF+KNVDK  IC +ELD  K ++  DAIENSYWFEFF+DDLPLWGFVG+ D+N+DN
Sbjct  90   QIDIKFRKNVDKDTICSMELDPDKAKQLSDAIENSYWFEFFIDDLPLWGFVGEADKNNDN  149

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I ++YN +QII
Sbjct  150  KYFLFTHKNILIRYNGNQII  169



>ref|XP_009144405.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=585

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  83

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGD--LDRNS  561
            +I IKF KNVD+  IC LELDE KV  FKDAIE+SYWFEFFMDDLPLWGFVG+  LD+NS
Sbjct  84   EIPIKFLKNVDRNVICHLELDEAKVNHFKDAIESSYWFEFFMDDLPLWGFVGELPLDKNS  143

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
             N K V++TH SI VKYN DQII
Sbjct  144  GNGKHVLYTHKSIIVKYNKDQII  166



>ref|NP_001131352.1| uncharacterized protein LOC100192672 precursor [Zea mays]
 gb|ACF79727.1| unknown [Zea mays]
Length=414

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            +HKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  28   EHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF KNVDKG IC +ELD  KV++F +AIENSYWFE F+DDLPLWGFVG+ D+N++ 
Sbjct  88   QIDIKFIKNVDKGAICTIELDVQKVQQFANAIENSYWFELFIDDLPLWGFVGETDKNNEK  147

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  148  KHYLYTHKNIVVKYNGNRII  167



>ref|XP_009379854.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ +DPVTLWVNKVGPY NPQETYNYYSLPFC  S+N  H+WGGLGEVLGGNELIDS
Sbjct  33   DHKYQAEDPVTLWVNKVGPYNNPQETYNYYSLPFCHPSKNLAHKWGGLGEVLGGNELIDS  92

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI IKFQ+NV+KG IC LELD+ KV +F  AIENSYWFEFF+DDLPLWGFVG+ D+N+ +
Sbjct  93   QIQIKFQRNVEKGSICALELDDAKVAQFTSAIENSYWFEFFIDDLPLWGFVGESDKNNKD  152

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I +++N +QII
Sbjct  153  KHYLYTHKNIVIQHNGNQII  172



>gb|KFK43390.1| hypothetical protein AALP_AA1G119800 [Arabis alpina]
Length=587

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSGNNVHKWGGLGEVLGGNELIDS  85

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC LEL+E KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  86   EIAIKFMKNVDRSVICPLELNEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  145

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K +++TH +I +KYN DQII
Sbjct  146  DNGKHILYTHKNIIIKYNKDQII  168



>gb|KFK40744.1| hypothetical protein AALP_AA2G035500 [Arabis alpina]
Length=595

 Score =   194 bits (493),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+P++ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDS
Sbjct  34   DHKYQPEEHVTLWVNKVGPYNNPQETYNYYSLPFCRKNENSVHKWGGLGEVLGGNELIDS  93

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF  NVD+  ICQLEL E KV+ FKDAIENSYWFE FMDDLPLWGFVG+L   +N 
Sbjct  94   QIDIKFMINVDRSVICQLELTEAKVKHFKDAIENSYWFELFMDDLPLWGFVGELPPGKNG  153

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  154  ENGKHVLYTHKNINVKYNKDQII  176



>emb|CDY20592.1| BnaC08g14660D [Brassica napus]
Length=585

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHKYQADEKVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  83

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC LELDE KV  FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  84   EIPIKFLKNVDRNVICHLELDEAKVNHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  143

Query  562  -DNKPVIFTHXSITVKYNXDQII  627
             D K V++TH +I VKYN DQII
Sbjct  144  EDGKQVLYTHKNIIVKYNKDQII  166



>ref|XP_006304923.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
 gb|EOA37821.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
Length=589

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSVNNVHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC LELDE KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  88   EIAIKFLKNVDRNVICPLELDEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  148  ENGKHVLYTHKNIIVKYNKDQII  170



>emb|CDY14555.1| BnaC03g49040D [Brassica napus]
Length=586

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  83

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC LELDE KV  FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  84   EIPIKFLKNVDRNVICHLELDEAKVNHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  143

Query  562  -DNKPVIFTHXSITVKYNXDQII  627
             D K V++TH +I VKYN DQII
Sbjct  144  EDGKQVLYTHKNIIVKYNKDQII  166



>ref|XP_010547447.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=591

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 123/143 (86%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S++  H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQVDEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQDGVHKWGGLGEVLGGNELIDS  89

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I+IKF KNVD+  ICQLEL +  VR+FKDAIEN YWFEFFMDDLPLWGFVG+L  D+N+
Sbjct  90   KIDIKFLKNVDRNVICQLELTKANVRQFKDAIENGYWFEFFMDDLPLWGFVGELHPDKNN  149

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I VKYN DQII
Sbjct  150  DNVKHVLYTHKNIVVKYNKDQII  172



>emb|CDX94774.1| BnaC07g17830D [Brassica napus]
Length=585

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  83

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC LELDE KV  FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  84   EIPIKFLKNVDRNVICHLELDEAKVNHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  143

Query  562  -DNKPVIFTHXSITVKYNXDQII  627
             D K V++TH +I VKYN DQII
Sbjct  144  EDGKQVLYTHKNIIVKYNKDQII  166



>ref|XP_006585219.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 5/145 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  381
            DHKY+ D+PV LWVNKVGPY NPQETYNYYSLPFC   +S +A H+WGGLGEVLGGNELI
Sbjct  27   DHKYQHDEPVNLWVNKVGPYNNPQETYNYYSLPFCHPSSSASAAHKWGGLGEVLGGNELI  86

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DR  555
            DSQI IKFQ+NVDK   CQ++LDE KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+
Sbjct  87   DSQIEIKFQRNVDKTVFCQIDLDEAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDK  146

Query  556  NSDN-KPVIFTHXSITVKYNXDQII  627
            NSDN K VI+TH +I VKYN DQII
Sbjct  147  NSDNGKHVIYTHKNIIVKYNNDQII  171



>ref|XP_003531298.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN48095.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 125/145 (86%), Gaps = 5/145 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  381
            DHKY+ D+PV LWVNKVGPY NPQETYNYYSLPFC   +S +A H+WGGLGEVLGGNELI
Sbjct  27   DHKYQHDEPVNLWVNKVGPYNNPQETYNYYSLPFCHPSSSASAAHKWGGLGEVLGGNELI  86

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DR  555
            DSQI IKFQ+NVDK   CQ++LDE KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+
Sbjct  87   DSQIEIKFQRNVDKTVFCQIDLDEAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDK  146

Query  556  NSDN-KPVIFTHXSITVKYNXDQII  627
            NSDN K VI+TH +I VKYN DQII
Sbjct  147  NSDNGKHVIYTHKNIIVKYNNDQII  171



>ref|XP_004977232.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=597

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  39   DHKYKAEEPVKLWVNKVGPYNNPQETYNYYSLPFCQLSENPIHKWGGLGEVLGGNELIDS  98

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            Q++IKF +N +KG IC LELD  KV++F DAIENSYWFE F+DDLPLWGFVG+ D+NS+N
Sbjct  99   QLDIKFLRNEEKGFICTLELDSKKVQQFADAIENSYWFELFIDDLPLWGFVGETDKNSEN  158

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  159  KHYLYTHKNILVKYNENRII  178



>emb|CDY54580.1| BnaCnng27350D [Brassica napus]
Length=589

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            Y+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDSQI+
Sbjct  31   YQGDEKVTLWVNKVGPYNNPQETYNYYSLPFCRKTENSIHKWGGLGEVLGGNELIDSQID  90

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL---DRNSDN  567
            IKF KNVD+G ICQLELDE KV+ FKDAIENSYWFE FMDDLPLWGFVG+L    ++ + 
Sbjct  91   IKFLKNVDRGVICQLELDEAKVKHFKDAIENSYWFELFMDDLPLWGFVGELPPGKKSENG  150

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH SI VKYN DQII
Sbjct  151  KHALYTHKSINVKYNKDQII  170



>gb|KHG27380.1| Tm9sf3 [Gossypium arboreum]
Length=614

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 126/167 (75%), Gaps = 27/167 (16%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDP+TLWVNKVGPY NPQETYNYY LPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQPDDPITLWVNKVGPYNNPQETYNYYILPFCHPGVNPAHKWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFF-------------------  510
            QI+IKFQKNVDKG ICQLELDE KV++FKDAIEN+YWFEFF                   
Sbjct  89   QIDIKFQKNVDKGTICQLELDEAKVKQFKDAIENNYWFEFFVDPEISIHGGISSKLKRHS  148

Query  511  -----MDDLPLWGFVGDL--DRNSDN-KPVIFTHXSITVKYNXDQII  627
                 +DDLPLWGFVG+L  D+NSDN K V++TH +I +KYN DQII
Sbjct  149  RCWVSIDDLPLWGFVGELHPDKNSDNGKHVLYTHKNIVIKYNKDQII  195



>ref|NP_563881.1| transmembrane nine 1 [Arabidopsis thaliana]
 sp|Q940G0.1|TMN1_ARATH RecName: Full=Transmembrane 9 superfamily member 1; AltName: 
Full=Endomembrane protein 12; AltName: Full=Transmembrane nine 
protein 1; Short=AtTMN1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL48237.1|AF446365_1 At1g10950/T19D16_13 [Arabidopsis thaliana]
 gb|AAK96857.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAL36263.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
 gb|AAM10098.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAP40425.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 gb|AEE28668.1| transmembrane nine 1 [Arabidopsis thaliana]
Length=589

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQAEEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSGNNVHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNV++  IC LELDE KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  88   EIAIKFMKNVERSVICPLELDEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  148  ENGKHVLYTHKNIVVKYNKDQII  170



>ref|NP_001066292.1| Os12g0175700 [Oryza sativa Japonica Group]
 gb|ABA96600.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29311.1| Os12g0175700 [Oryza sativa Japonica Group]
 dbj|BAG91282.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68944.1| hypothetical protein OsI_37659 [Oryza sativa Indica Group]
 gb|EEE52854.1| hypothetical protein OsJ_35401 [Oryza sativa Japonica Group]
Length=598

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++PV LWVNKVGPY NPQETYNY+SLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  40   DHKYKVEEPVKLWVNKVGPYNNPQETYNYHSLPFCQPSENPAHKWGGLGEVLGGNELIDS  99

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF +N ++G IC LELD  KV++F DAI+NSYWFEFFMDDLPLWGFVG+ D+N++N
Sbjct  100  QIDIKFLRNEERGSICTLELDSKKVQQFSDAIDNSYWFEFFMDDLPLWGFVGETDKNNEN  159

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH SI VKYN ++II
Sbjct  160  KRYLYTHKSILVKYNDNRII  179



>ref|XP_009390071.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ +DPVTLWVNKVGPY NPQETYNYYSLPFC+ SEN  H+W GLGEVLGGNELIDS
Sbjct  30   DHKYQAEDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWSGLGEVLGGNELIDS  89

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
             I IKFQ+NVDKG IC +ELD TKV++F DAI+NSYWFEFF+DDLPLWGFVG+ D+N+ +
Sbjct  90   HIPIKFQRNVDKGSICTIELDATKVKQFIDAIDNSYWFEFFIDDLPLWGFVGETDKNNKD  149

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH  I +++   QII
Sbjct  150  KHYLFTHKDIVIQHKGYQII  169



>emb|CDY34861.1| BnaA09g47870D [Brassica napus]
Length=586

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 123/143 (86%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNY+SLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  25   DHKYQADEQVTLWVNKVGPYNNPQETYNYFSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  84

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC+LELDE KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+N 
Sbjct  85   EIPIKFLKNVDRNVICKLELDEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHSDKNG  144

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  145  ENAKHVLYTHKNIVVKYNKDQII  167



>ref|XP_004485475.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Cicer arietinum]
Length=583

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFCR   NA H+WGGLGEVLGGNELIDS
Sbjct  22   DHKYQQDDPVTLWVNKVGPYNNPQETYNYYSLPFCRLPGNAAHKWGGLGEVLGGNELIDS  81

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKF  NV++   C+L LD+ KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+NS
Sbjct  82   QIEIKFLGNVERTTFCRLPLDDAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDKNS  141

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            D+ K V++TH +I VKYN DQII
Sbjct  142  DSGKHVLYTHKNIIVKYNKDQII  164



>ref|XP_010533958.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Tarenaya hassleriana]
Length=598

 Score =   192 bits (489),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+  + V LWVNKVGPY NPQETYNYYSLPFC AS N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQASERVALWVNKVGPYNNPQETYNYYSLPFCHASGNGVHKWGGLGEVLGGNELIDS  90

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I+IKF +NVD+  ICQLEL +  V++FKDAIENSYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  91   EIDIKFLENVDRKVICQLELTQANVKQFKDAIENSYWFEFFMDDLPLWGFVGELHPDKNS  150

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I VKYN DQII
Sbjct  151  DNGKHVLYTHKNIVVKYNKDQII  173



>ref|XP_004485474.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Cicer arietinum]
Length=583

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ DDPVTLWVNKVGPY NPQETYNYYSLPFCR   NA H+WGGLGEVLGGNELIDS
Sbjct  22   DHKYQQDDPVTLWVNKVGPYNNPQETYNYYSLPFCRLPGNAAHKWGGLGEVLGGNELIDS  81

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKF  NV++   C+L LD+ KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+NS
Sbjct  82   QIEIKFLGNVERTTFCRLPLDDAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDKNS  141

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            D+ K V++TH +I VKYN DQII
Sbjct  142  DSGKHVLYTHKNIIVKYNKDQII  164



>ref|XP_011009384.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
 ref|XP_011009385.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
Length=593

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 4/144 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN-APHRWgglgevlggnelID  384
            DH+Y  ++PV LWVNKVGPY NPQETYNYYSLPFC  S + A H+WGGLGEVLGGNELID
Sbjct  30   DHRYGQEEPVKLWVNKVGPYNNPQETYNYYSLPFCHPSGDVATHKWGGLGEVLGGNELID  89

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRN  558
            SQI+IKF KNVDKG ICQLELDE KV++FKDAIEN+YWFEFF+DDLPLWGFVG+L  D+N
Sbjct  90   SQIDIKFGKNVDKGVICQLELDEAKVKQFKDAIENNYWFEFFVDDLPLWGFVGELRPDKN  149

Query  559  SDN-KPVIFTHXSITVKYNXDQII  627
             +N K  ++TH SIT++YN DQII
Sbjct  150  GENGKHFLYTHKSITIQYNKDQII  173



>gb|KHG21692.1| Transmembrane 9 superfamily member 3 [Gossypium arboreum]
Length=587

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 120/143 (84%), Gaps = 9/143 (6%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PDDPVTLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYQPDDPVTLWVNKVGPYNNPQETYNYYSLPFCHLGTNPAHKWGGLGEVLGGNELIDS  91

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKFQKNV+K  ICQLELDE KVR+FKDAIENSYWFEFFM      GFVG+L  DRNS
Sbjct  92   QIDIKFQKNVEKSTICQLELDEAKVREFKDAIENSYWFEFFM------GFVGELHPDRNS  145

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I +KYN DQII
Sbjct  146  DNGKHVLYTHKNIIIKYNKDQII  168



>ref|XP_010553598.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=592

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR+S N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQKDEKVTLWVNKVGPYNNPQETYNYYSLPFCRSSGNDVHKWGGLGEVLGGNELIDS  90

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I+IKF KNVD+  IC LEL+E  V++FKDAIENSYWFEFFMDDLPLWGFVG+L  D++S
Sbjct  91   EIDIKFLKNVDRNVICHLELNEANVKQFKDAIENSYWFEFFMDDLPLWGFVGELHPDKSS  150

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            D+ K V++TH +I VKYN +QII
Sbjct  151  DSGKHVLYTHKNIVVKYNKEQII  173



>dbj|BAJ87519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK  D V LWVNKVGPY NPQETYNY+SLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  37   DHKYKSGDSVKLWVNKVGPYNNPQETYNYHSLPFCQPSENPGHKWGGLGEVLGGNELIDS  96

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            Q++IKF KNV++G IC LELD  K+++F DAIE+SYWFEFF+DDLPLWGFVG+ D+NS+N
Sbjct  97   QLDIKFLKNVERGSICTLELDSKKIQQFADAIESSYWFEFFIDDLPLWGFVGETDKNSEN  156

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  157  KHYLYTHKNILVKYNDNRII  176



>ref|XP_008667101.1| PREDICTED: uncharacterized protein LOC100192672 isoform X1 [Zea 
mays]
 tpg|DAA38952.1| TPA: transmembrane 9 family protein member 3 [Zea mays]
Length=586

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            +HKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  28   EHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF KNVDKG IC +ELD  KV++F +AIENSYWFE F+DDLPLWGFVG+ D+N++ 
Sbjct  88   QIDIKFIKNVDKGAICTIELDVQKVQQFANAIENSYWFELFIDDLPLWGFVGETDKNNEK  147

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  148  KHYLYTHKNIVVKYNGNRII  167



>gb|ACG29787.1| transmembrane 9 superfamily protein member 3 precursor [Zea mays]
Length=586

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            +HKYK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  28   EHKYKTEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF KNVDKG IC +ELD  KV++F +AIENSYWFE F+DDLPLWGFVG+ D+N++ 
Sbjct  88   QIDIKFIKNVDKGAICTIELDVQKVQQFANAIENSYWFELFIDDLPLWGFVGETDKNNEK  147

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  148  KHYLYTHKNIVVKYNGNRII  167



>ref|XP_010475983.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=587

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+  + VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQDGEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSANNVHKWGGLGEVLGGNELIDS  85

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC LELDE KV+ FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+NS
Sbjct  86   EIAIKFLKNVDRNVICPLELDEAKVKHFKDAIESSYWFEFFMDDLPLWGFVGELHPDKNS  145

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  146  ENGKHVLYTHKNIVVKYNKDQII  168



>ref|XP_009148436.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=590

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSLNDVHKWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC+LELDE KV  FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+N 
Sbjct  89   EIPIKFLKNVDRNVICKLELDELKVEHFKDAIESSYWFEFFMDDLPLWGFVGELQSDKNG  148

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  149  ENGKHVLYTHKNIIVKYNKDQII  171



>emb|CDY19333.1| BnaC05g08420D [Brassica napus]
Length=587

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S+N  H+WGGLGEVLGGNELIDS
Sbjct  26   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSQNDVHKWGGLGEVLGGNELIDS  85

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC+LELD+ KV  FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+N 
Sbjct  86   EIPIKFLKNVDRNVICKLELDQPKVEHFKDAIESSYWFEFFMDDLPLWGFVGELQSDKNG  145

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  146  ENGKHVLYTHKNIIVKYNKDQII  168



>ref|XP_007159578.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
 gb|ESW31572.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
Length=589

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 121/144 (84%), Gaps = 4/144 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAP--HRWgglgevlggnelI  381
            DHKY  D+PVTLWVNK+GPY NPQETYNYYSLPFC    NA   H+WGGLGEVLGGNELI
Sbjct  27   DHKYHRDEPVTLWVNKLGPYNNPQETYNYYSLPFCHPLSNASAGHKWGGLGEVLGGNELI  86

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DR  555
            DSQI+IKFQKNVDK   C+++L E KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+
Sbjct  87   DSQIDIKFQKNVDKTVFCRIDLSEAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDK  146

Query  556  NSDNKPVIFTHXSITVKYNXDQII  627
            N D K V++TH +I VKYN DQII
Sbjct  147  NGDGKHVLYTHKNINVKYNNDQII  170



>ref|XP_003540158.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=584

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH+Y+ DDPVTLWVNKVGPY NPQETYNYYSLPFCR   N  H+WGGLGEVLGGNELIDS
Sbjct  23   DHRYQQDDPVTLWVNKVGPYNNPQETYNYYSLPFCRPPGNTAHKWGGLGEVLGGNELIDS  82

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            Q+ IKF  NV+K   C++ELDE KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+N 
Sbjct  83   QLEIKFLGNVEKTIFCRIELDEAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDKNG  142

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I V+YN DQII
Sbjct  143  DNGKHVLYTHKNINVQYNKDQII  165



>emb|CDX97924.1| BnaA06g06750D [Brassica napus]
Length=590

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSLNDVHKWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNVD+  IC+LELDE KV  FKDAIE+SYWFEFFMDDLPLWGFVG+L  D+N 
Sbjct  89   EIPIKFLKNVDRNVICKLELDEPKVEHFKDAIESSYWFEFFMDDLPLWGFVGELQSDKNG  148

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  149  ENGKHVLYTHKNIIVKYNKDQII  171



>ref|XP_006662781.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Oryza brachyantha]
Length=583

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++ V LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  25   DHKYKAEEAVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPVHKWGGLGEVLGGNELIDS  84

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF KNV+KG IC +ELD+ KV++F DAIE+SYWFE F+DDLPLWGFVG+ D+N++N
Sbjct  85   QIDIKFLKNVEKGPICTIELDDKKVQQFTDAIESSYWFELFIDDLPLWGFVGETDKNNEN  144

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  145  KHYLYTHKNIVVKYNGNRII  164



>ref|XP_009404976.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=588

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH Y+ DD VTLWVNKVGPY NPQETYNYY LPFC+   NA H+WGGLGEVLGGN+L+DS
Sbjct  30   DHTYQNDDHVTLWVNKVGPYNNPQETYNYYILPFCQLPGNAAHKWGGLGEVLGGNQLVDS  89

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI IKF+KNVDK  IC + LD  KV++FKDA+E+SYWFEFF+DDLPLWGF+G+ D+ ++N
Sbjct  90   QIEIKFRKNVDKASICAINLDAAKVKQFKDAVESSYWFEFFIDDLPLWGFIGETDKTNEN  149

Query  568  KPVIFTHXSITVKYNXDQII  627
            +  +FTH  I VKYN DQII
Sbjct  150  RHYLFTHKDIVVKYNGDQII  169



>ref|XP_009124655.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=627

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 118/140 (84%), Gaps = 3/140 (2%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            Y+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDSQI+
Sbjct  69   YQADEQVTLWVNKVGPYNNPQETYNYYSLPFCRKTENSIHKWGGLGEVLGGNELIDSQID  128

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL---DRNSDN  567
            IKF KNVD+  ICQLELDE KV+ FKDAIENSYWFE FMDDLPLWGFVG+L    ++ + 
Sbjct  129  IKFLKNVDRSVICQLELDEAKVKHFKDAIENSYWFELFMDDLPLWGFVGELPPGKKSENG  188

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH SI VKYN DQII
Sbjct  189  KHALYTHKSINVKYNKDQII  208



>ref|XP_003532994.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=585

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH+Y+ DDPV LWVNKVGPY NPQETYNYYSLPFCR+  N  H+WGGLGEVLGGNELIDS
Sbjct  24   DHRYQQDDPVILWVNKVGPYNNPQETYNYYSLPFCRSPGNPAHKWGGLGEVLGGNELIDS  83

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            Q+ IKF  NV+K   C++ELDE KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+N 
Sbjct  84   QLEIKFLGNVEKTTFCRIELDEAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDKNG  143

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I V+YN DQII
Sbjct  144  DNGKHVLYTHKNINVQYNKDQII  166



>ref|XP_006580221.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 5/145 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  381
            DHKY+ D+ V LWVNKVGPY NPQETYNYYSLPFC   +S +A H+WGGLGEVLGGNELI
Sbjct  27   DHKYQHDEQVNLWVNKVGPYNNPQETYNYYSLPFCHPSSSASAAHKWGGLGEVLGGNELI  86

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DR  555
            DSQ+ IKFQ+NVDK   CQ++LDE KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+
Sbjct  87   DSQLEIKFQRNVDKTVFCQIDLDEAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDK  146

Query  556  NSDN-KPVIFTHXSITVKYNXDQII  627
            NSDN K VI+TH +I VKYN DQII
Sbjct  147  NSDNGKHVIYTHKNIIVKYNNDQII  171



>gb|KHN45466.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=584

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH+Y+ DDPVTLWVNKVGPY NPQETYNYYSLPFCR+  N  H+WGGLGEVLGGNELIDS
Sbjct  23   DHRYQQDDPVTLWVNKVGPYNNPQETYNYYSLPFCRSPGNTAHKWGGLGEVLGGNELIDS  82

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            Q+ IKF  NV+K   C++ELDE KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+N 
Sbjct  83   QLEIKFLGNVEKTIFCRIELDEAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDKNG  142

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I V++N DQII
Sbjct  143  DNGKHVLYTHKNINVQHNKDQII  165



>ref|XP_003524235.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN06492.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 124/145 (86%), Gaps = 5/145 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  381
            DHKY+ D+ V LWVNKVGPY NPQETYNYYSLPFC   +S +A H+WGGLGEVLGGNELI
Sbjct  27   DHKYQHDEQVNLWVNKVGPYNNPQETYNYYSLPFCHPSSSASAAHKWGGLGEVLGGNELI  86

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DR  555
            DSQ+ IKFQ+NVDK   CQ++LDE KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+
Sbjct  87   DSQLEIKFQRNVDKTVFCQIDLDEAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDK  146

Query  556  NSDN-KPVIFTHXSITVKYNXDQII  627
            NSDN K VI+TH +I VKYN DQII
Sbjct  147  NSDNGKHVIYTHKNIIVKYNNDQII  171



>dbj|BAJ96423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK  +PV LWVNKVGPY NPQETYNYYSLPFC+ +EN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYKISEPVKLWVNKVGPYNNPQETYNYYSLPFCQPAENPAHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+I+F KNVDKG +C +ELD  KV++F DAIE+SYWFE F+DDLPLWGFVG+ D+N++N
Sbjct  87   QIDIQFLKNVDKGPVCTIELDAKKVQQFTDAIESSYWFELFIDDLPLWGFVGETDKNNEN  146

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN +++I
Sbjct  147  KHYLYTHKNIVVKYNGNRVI  166



>dbj|BAJ86318.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   189 bits (481),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK  +PV LWVNKVGPY NPQETYNYYSLPFC+ +EN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYKISEPVKLWVNKVGPYNNPQETYNYYSLPFCQPAENPAHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+I+F KNVDKG +C +ELD  KV++F DAIE+SYWFE F+DDLPLWGFVG+ D+N++N
Sbjct  87   QIDIQFLKNVDKGPVCTIELDAKKVQQFTDAIESSYWFELFIDDLPLWGFVGETDKNNEN  146

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN +++I
Sbjct  147  KHYLYTHKNIVVKYNGNRVI  166



>gb|EEE57172.1| hypothetical protein OsJ_07106 [Oryza sativa Japonica Group]
Length=568

 Score =   189 bits (480),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++ V LWVNKVGPY NPQETYNYYSLPFC  S N  H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYQSEEKVMLWVNKVGPYNNPQETYNYYSLPFCHPSNNPVHKWGGLGEVLGGNELIDS  91

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF ++VDKG IC +ELD  K ++  DAIE+SYWFEFF+DDLPLWGFVG+ DRNSDN
Sbjct  92   QIDIKFGRDVDKGTICSIELDPDKAKQLSDAIESSYWFEFFIDDLPLWGFVGEADRNSDN  151

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I ++YN +QII
Sbjct  152  KYFLFTHKNIVIRYNGNQII  171



>ref|NP_001047104.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAD15485.1| putative transmembrane protein TM9SF3 (66.6 kD) [Oryza sativa 
Japonica Group]
 dbj|BAF09018.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAG90570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93963.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73381.1| hypothetical protein OsI_07622 [Oryza sativa Indica Group]
Length=590

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++ V LWVNKVGPY NPQETYNYYSLPFC  S N  H+WGGLGEVLGGNELIDS
Sbjct  32   DHKYQSEEKVMLWVNKVGPYNNPQETYNYYSLPFCHPSNNPVHKWGGLGEVLGGNELIDS  91

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF ++VDKG IC +ELD  K ++  DAIE+SYWFEFF+DDLPLWGFVG+ DRNSDN
Sbjct  92   QIDIKFGRDVDKGTICSIELDPDKAKQLSDAIESSYWFEFFIDDLPLWGFVGEADRNSDN  151

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I ++YN +QII
Sbjct  152  KYFLFTHKNIVIRYNGNQII  171



>ref|NP_001065897.1| Os11g0181100 [Oryza sativa Japonica Group]
 gb|ABA91795.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA91796.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27742.1| Os11g0181100 [Oryza sativa Japonica Group]
 dbj|BAG94676.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67792.1| hypothetical protein OsI_35351 [Oryza sativa Indica Group]
 gb|EEE51756.1| hypothetical protein OsJ_33190 [Oryza sativa Japonica Group]
Length=593

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++ V LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  35   DHKYKAEETVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  94

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            Q++IKF KNV+KG IC +ELD+ K+++F DAIE SYWFE F+DDLPLWGFVG+ D+N++N
Sbjct  95   QVDIKFLKNVEKGPICTIELDDNKIQQFTDAIERSYWFELFIDDLPLWGFVGETDKNNEN  154

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  155  KHYLYTHKNIVVKYNGNRII  174



>gb|KHN11244.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=583

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH+Y+ DDPV LWVNKVGPY NPQETYNYYSLPFCR+  N  H+WGGLGEVLGGNELIDS
Sbjct  22   DHRYQQDDPVILWVNKVGPYNNPQETYNYYSLPFCRSPGNPAHKWGGLGEVLGGNELIDS  81

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            Q+ I+F  NV+K   C++ELDE KV++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+N 
Sbjct  82   QLEIEFLGNVEKTTFCRIELDEAKVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDKNG  141

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++TH +I V+YN DQII
Sbjct  142  DNGKHVLYTHKNINVQYNKDQII  164



>ref|XP_003577775.1| PREDICTED: transmembrane 9 superfamily member 3 [Brachypodium 
distachyon]
Length=585

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK D+ V LWVNKVGPY NPQETYNYYSLPFC  SEN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYKVDESVKLWVNKVGPYNNPQETYNYYSLPFCLPSENPAHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF K+V+KG IC +ELD  KV++F DAIE+SYWFE F+DDLPLWGFVG+ D+N++N
Sbjct  87   QIDIKFLKHVEKGPICTIELDAKKVQQFTDAIESSYWFELFIDDLPLWGFVGETDKNNEN  146

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH ++ VKYN ++II
Sbjct  147  KHYLYTHKNVVVKYNGNRII  166



>ref|XP_007148532.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
 gb|ESW20526.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
Length=630

 Score =   188 bits (478),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 97/143 (68%), Positives = 119/143 (83%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH+Y+P++ V LWVNKVGPY NPQETYNYYSLPFCR   +  H+WGGLGEVLGGNELIDS
Sbjct  69   DHRYQPEEKVMLWVNKVGPYNNPQETYNYYSLPFCRPPGHPAHKWGGLGEVLGGNELIDS  128

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            Q+ IKF  NV+K   C+L+L+E  V++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+NS
Sbjct  129  QLEIKFLGNVEKTTFCRLQLNEANVKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDKNS  188

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V++ H +I ++YN DQII
Sbjct  189  DNGKHVLYAHKNINIQYNKDQII  211



>gb|EYU28222.1| hypothetical protein MIMGU_mgv1a003468mg [Erythranthe guttata]
Length=583

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 118/140 (84%), Gaps = 2/140 (1%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ D+ VTLWVNKVGPY NPQETYNYYSLPFC    NAPH+WGGLGEVLGGNELIDSQI
Sbjct  25   KYQDDEAVTLWVNKVGPYNNPQETYNYYSLPFCHLPGNAPHKWGGLGEVLGGNELIDSQI  84

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
            +IKF+++V+K  IC +ELD  K + FKDAI+NSYWFEFFMDDLPLWGF+G++  DRN D+
Sbjct  85   DIKFKRDVEKSSICDIELDAVKAKHFKDAIDNSYWFEFFMDDLPLWGFIGEVLPDRNRDH  144

Query  568  KPVIFTHXSITVKYNXDQII  627
            K V+FTH ++ + YN DQII
Sbjct  145  KHVLFTHKNLVINYNQDQII  164



>ref|XP_007042269.1| Transmembrane nine 1 [Theobroma cacao]
 gb|EOX98100.1| Transmembrane nine 1 [Theobroma cacao]
Length=640

 Score =   187 bits (476),  Expect = 5e-52, Method: Composition-based stats.
 Identities = 108/191 (57%), Positives = 126/191 (66%), Gaps = 51/191 (27%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+P++P+TLWVNKVGPY NPQETYNYYSLPFC    N  H+WGGLGEVLGGNELIDS
Sbjct  31   DHKYQPEEPITLWVNKVGPYNNPQETYNYYSLPFCHPGANPAHKWGGLGEVLGGNELIDS  90

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFM------------------  513
            QI+IKF+KNV+KG ICQL+LDE KVR+FKDAIEN+YWFEFF+                  
Sbjct  91   QIDIKFKKNVEKGSICQLDLDEAKVRQFKDAIENNYWFEFFVGMFSFSFFYIKVGLRDYF  150

Query  514  ------------------------------DDLPLWGFVGDL--DRNSDN-KPVIFTHXS  594
                                          DDLPLWGF+G+L  D+NSDN K V+ TH +
Sbjct  151  VYMVLLEHLLYLPCLFVDAMYCALHDAESSDDLPLWGFIGELHPDKNSDNGKQVLNTHKN  210

Query  595  ITVKYNXDQII  627
            I +KYN DQII
Sbjct  211  IVIKYNNDQII  221



>ref|XP_006859169.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
 gb|ERN20636.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
Length=590

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+PV LWVNKVGPY NPQETYNYYSLPFC+ + N  H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQEDEPVMLWVNKVGPYNNPQETYNYYSLPFCQPAGNPAHKWGGLGEVLGGNELIDS  89

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI IKF++NVDK  IC+LELD+ K + FKDAIEN+YWFEFFMDDL L G+VGD+  D+ +
Sbjct  90   QIEIKFKRNVDKRSICELELDDAKAKLFKDAIENAYWFEFFMDDLLLRGYVGDIRSDKVN  149

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            DNK V+FTH +I V+YN DQII
Sbjct  150  DNKHVLFTHKNIVVEYNGDQII  171



>ref|XP_010101151.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
 gb|EXB87369.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
Length=609

 Score =   187 bits (474),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 119/143 (83%), Gaps = 9/143 (6%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNYYSLPFCR S NA H+WGGLGEVLGGNELI+S
Sbjct  27   DHKYQKDEAVTLWVNKVGPYNNPQETYNYYSLPFCRPSGNAAHKWGGLGEVLGGNELIES  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QINIKFQ+NVDK  ICQLELD  KV++FKDAIENSYWFEFFM      GFVG+L  D+NS
Sbjct  87   QINIKFQQNVDKATICQLELDAAKVKQFKDAIENSYWFEFFM------GFVGELHPDKNS  140

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            DN K V+ TH +I VKYN DQII
Sbjct  141  DNGKHVLHTHKNIIVKYNKDQII  163



>ref|XP_010682931.1| PREDICTED: transmembrane 9 superfamily member 1 [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY   + VTLWVNKVGPY NPQETYNYYSLPFCR+S N+ HRWGGLGEVLGGNELIDS
Sbjct  29   DHKYTASEHVTLWVNKVGPYNNPQETYNYYSLPFCRSSANSGHRWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            QI+IKF KN +K  IC+LELD TK ++F+DAIENSYWFEFF+DDLPLWGFVG+L  D+N 
Sbjct  89   QIDIKFGKNTEKTTICELELDPTKAKQFRDAIENSYWFEFFIDDLPLWGFVGELHFDKNI  148

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++T+ +  +KYN +QII
Sbjct  149  ENAKHVLYTNKNFIIKYNDNQII  171



>ref|XP_004504187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cicer arietinum]
Length=591

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 121/145 (83%), Gaps = 5/145 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  381
            DHKY+ DD V LWVNKVGPY NPQETYNYYSLPFC   +S  A H+WGGLGEVLGGNELI
Sbjct  28   DHKYQRDDQVNLWVNKVGPYNNPQETYNYYSLPFCHPSSSATAAHKWGGLGEVLGGNELI  87

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DR  555
            DSQI IKF KNVDK   CQ++LD+ K ++FKDAIEN+YWFEFFMDDLPLWG+VG+L  D+
Sbjct  88   DSQIEIKFLKNVDKTVFCQIDLDDAKAKQFKDAIENNYWFEFFMDDLPLWGYVGELHPDK  147

Query  556  NSDN-KPVIFTHXSITVKYNXDQII  627
            NSDN K V++TH +I VKYN DQII
Sbjct  148  NSDNDKHVLYTHKNIIVKYNKDQII  172



>ref|XP_009113237.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3-like [Brassica rapa]
Length=570

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 118/140 (84%), Gaps = 3/140 (2%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            Y+ ++ VTL VNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDSQI+
Sbjct  12   YQANEQVTLLVNKVGPYNNPQETYNYYSLPFCRKNENSIHKWGGLGEVLGGNELIDSQID  71

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN-  567
            IKF KNVD+  IC LELDE KV+ FKDAIENSYWFE FMDDLPLWGFVG+L   +N +N 
Sbjct  72   IKFTKNVDRSVICHLELDEAKVKHFKDAIENSYWFELFMDDLPLWGFVGELAPGKNGENG  131

Query  568  KPVIFTHXSITVKYNXDQII  627
            K V++TH SI VKYN DQII
Sbjct  132  KHVLYTHKSINVKYNKDQII  151



>ref|XP_006664390.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=580

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK ++PV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDSQI+
Sbjct  25   YKVEEPVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDSQID  84

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDNKPV  576
            IKF +N +K  IC LELD  KV++F DAI++SYWFEFFMDDLPLWGFVG+ D+N++NK  
Sbjct  85   IKFLRNEEKVTICTLELDSNKVQQFSDAIDSSYWFEFFMDDLPLWGFVGETDKNNENKRY  144

Query  577  IFTHXSITVKYNXDQII  627
            I+TH SI VKYN ++II
Sbjct  145  IYTHKSILVKYNDNRII  161



>ref|XP_009593535.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=320

 Score =   178 bits (452),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 3/140 (2%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC   +   H+WGGLGEVLGGNELIDS+I
Sbjct  25   KYQADEPVTLWVNKVGPYNNPQETYNYYSLPFCHPGDGG-HKWGGLGEVLGGNELIDSRI  83

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
            +IKF+++V+K  IC L LD  KV +FKDAIENSYWFEFFMDDLPLWGFVG++  DR+ D 
Sbjct  84   DIKFKRDVEKSTICDLALDAAKVAQFKDAIENSYWFEFFMDDLPLWGFVGEVLPDRSRDT  143

Query  568  KPVIFTHXSITVKYNXDQII  627
            K V++TH +  ++YN DQII
Sbjct  144  KHVLYTHKNFLIQYNGDQII  163



>ref|XP_010912523.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Elaeis 
guineensis]
Length=581

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 113/140 (81%), Gaps = 6/140 (4%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK DDPVTLWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  29   DHKYKADDPVTLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI +KFQ+NV+KG IC LELD  KV+ F DAI NSYW EFF+      GFVG+ D+N++N
Sbjct  89   QIEMKFQRNVEKGSICALELDAAKVKHFTDAIVNSYWLEFFI------GFVGETDKNNEN  142

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH SI ++YN  QII
Sbjct  143  KHFLFTHKSIVIRYNNSQII  162



>ref|XP_003629959.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AET04435.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=589

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 5/145 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN--APHRWgglgevlggnelI  381
            DHKY+ DDPV LWVNKVGPY NPQETYNYYSLPFC  S    A H+WGGLGEVLGGNELI
Sbjct  26   DHKYQRDDPVNLWVNKVGPYNNPQETYNYYSLPFCHPSSTSAAAHKWGGLGEVLGGNELI  85

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DR  555
            DSQI IKF +NV+K   CQ+ LD+ KV++FK AIEN+YWFEFFMDDLPLWG+VG+L  D+
Sbjct  86   DSQIEIKFLRNVEKTVFCQMVLDDAKVKQFKHAIENNYWFEFFMDDLPLWGYVGELHPDK  145

Query  556  NSDN-KPVIFTHXSITVKYNXDQII  627
            +SDN K V++TH +I VKYN DQII
Sbjct  146  HSDNGKHVLYTHKNIIVKYNNDQII  170



>ref|XP_011074960.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=578

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ D+ VTLWVNKVGPY NPQETYNYYSLPFC    NA H+WGGLGEVLGGNELIDSQI
Sbjct  25   KYQADETVTLWVNKVGPYNNPQETYNYYSLPFCHPPGNAAHKWGGLGEVLGGNELIDSQI  84

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
             IKF+++V+K  IC++ELD  K ++F DAI+NSYWFEFFMDDLPLWGFVG++  DRN DN
Sbjct  85   EIKFKRDVEKTKICEIELDAAKAKQFNDAIDNSYWFEFFMDDLPLWGFVGEVLPDRNRDN  144

Query  568  KPVIFTHXSITVKYNXDQII  627
            K V++TH ++ + YN +QII
Sbjct  145  KHVLWTHKNLVINYNGNQII  164



>ref|XP_004250432.1| PREDICTED: transmembrane 9 superfamily member 3 [Solanum lycopersicum]
Length=582

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 118/140 (84%), Gaps = 3/140 (2%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC   +   H+WGGLGEVLGGNELIDS+I
Sbjct  25   KYQADEPVTLWVNKVGPYNNPQETYNYYSLPFCHPGDGG-HKWGGLGEVLGGNELIDSRI  83

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
            +IKF+++V+K  IC+L LD  KV +FKDAIE+SYWFEFFMDDLPLWGFVG++  DRN DN
Sbjct  84   DIKFKRDVEKSTICELVLDAAKVAQFKDAIESSYWFEFFMDDLPLWGFVGEVLPDRNRDN  143

Query  568  KPVIFTHXSITVKYNXDQII  627
            K V++TH +  ++YN DQII
Sbjct  144  KHVLYTHKNFLIQYNKDQII  163



>gb|AFW71773.1| hypothetical protein ZEAMMB73_948581, partial [Zea mays]
Length=469

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 113/140 (81%), Gaps = 6/140 (4%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+  +PVTLWVNKVGPY NPQETYNYYSLPFC ASEN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYQAAEPVTLWVNKVGPYNNPQETYNYYSLPFCHASENHVHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF KNVDK  IC L+LD  K ++  DAIENSYWFEFF+      GFVG+ DRN+DN
Sbjct  87   QIDIKFGKNVDKATICSLDLDLVKAKQLSDAIENSYWFEFFI------GFVGEADRNNDN  140

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  +FTH +I ++YN +QII
Sbjct  141  KYFLFTHKNIVIRYNGNQII  160



>gb|EPS65883.1| hypothetical protein M569_08888, partial [Genlisea aurea]
Length=558

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 2/139 (1%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            Y+ D+ VTLWVNKVGPY NPQETYNYY+LPFC  S NA HRW GLGEVLGGNELIDSQI+
Sbjct  1    YQDDEAVTLWVNKVGPYNNPQETYNYYTLPFCHPSGNAAHRWAGLGEVLGGNELIDSQID  60

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDNK  570
            IKF+K+V+K  +C++ELD  KV++FKDAI+NSYWFEFF+DDLPLWGFVG++  DR  D K
Sbjct  61   IKFKKDVEKKSLCEIELDAEKVKQFKDAIDNSYWFEFFIDDLPLWGFVGEVITDRGHDYK  120

Query  571  PVIFTHXSITVKYNXDQII  627
             VI+TH +  V YN +QII
Sbjct  121  HVIWTHKNFLVHYNGNQII  139



>ref|XP_006367366.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=582

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 117/140 (84%), Gaps = 3/140 (2%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC   +   H+WGGLGEVLGGNELIDS+I
Sbjct  25   KYQADEPVTLWVNKVGPYNNPQETYNYYSLPFCHPGDGG-HKWGGLGEVLGGNELIDSRI  83

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
            +IKF+++V+K  IC+L LD  KV +FKDAIE+SYWFEFFMDDLPLWGFVG++  DRN D 
Sbjct  84   DIKFKRDVEKSTICELVLDAAKVAQFKDAIESSYWFEFFMDDLPLWGFVGEVLPDRNRDT  143

Query  568  KPVIFTHXSITVKYNXDQII  627
            K V++TH +  ++YN DQII
Sbjct  144  KHVLYTHKNFLIQYNKDQII  163



>ref|XP_009763454.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=582

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 3/140 (2%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ D+PVTLWVNKVGPY NPQETYNYYSLPFC   +   H+WGGLGEVLGGNELIDS+I
Sbjct  25   KYQADEPVTLWVNKVGPYNNPQETYNYYSLPFCHPGDGG-HKWGGLGEVLGGNELIDSRI  83

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
            +IKF+++V+K  IC L LD  KV +FKDAIENSYWFEFFMDDLPLWGFVG++  DR+ D 
Sbjct  84   DIKFKRDVEKSTICDLALDAAKVAQFKDAIENSYWFEFFMDDLPLWGFVGEVLPDRSRDT  143

Query  568  KPVIFTHXSITVKYNXDQII  627
            K V++TH +  ++YN DQII
Sbjct  144  KHVLYTHKNFLIQYNGDQII  163



>ref|XP_010665394.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI39323.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   179 bits (455),  Expect = 8e-49, Method: Composition-based stats.
 Identities = 92/143 (64%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNY+SLPFC    NA H+WGGLGEVLGGNELIDS
Sbjct  188  DHKYQTDEQVTLWVNKVGPYNNPQETYNYFSLPFCHPPGNAGHKWGGLGEVLGGNELIDS  247

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI++KF+KNV++  IC +ELD  KV++F+DAI  SYWFEFF+DDLPLWGF+G++  +  N
Sbjct  248  QIDMKFKKNVERTTICIIELDAAKVKQFRDAIGKSYWFEFFIDDLPLWGFIGEVHSDKKN  307

Query  568  KPV---IFTHXSITVKYNXDQII  627
              +   ++T+ +I V+YN DQII
Sbjct  308  DKIQHLLYTNKNIFVRYNGDQII  330



>gb|EYU22789.1| hypothetical protein MIMGU_mgv1a003460mg [Erythranthe guttata]
Length=583

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ D+ VTLWVNKVGPY NPQETYNYYSLPFC    NA H+WGGLGEV+GGNELIDSQI
Sbjct  25   KYQDDEAVTLWVNKVGPYNNPQETYNYYSLPFCHPPGNAAHKWGGLGEVIGGNELIDSQI  84

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
             IKF+++V K  IC++EL+   V++FKDAI+NSYWFEFFMDDLPLWGFVG++  D+  D+
Sbjct  85   EIKFKRDVTKAKICEIELEAANVKQFKDAIDNSYWFEFFMDDLPLWGFVGEVLPDKAHDS  144

Query  568  KPVIFTHXSITVKYNXDQII  627
            K V+ TH ++ + YN DQII
Sbjct  145  KHVLLTHKNLVINYNGDQII  164



>ref|XP_010682854.1| PREDICTED: transmembrane 9 superfamily member 1-like [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+PD+ V LWVNKVGPY NPQETYNY+SLPFC       HRWGGLGEVLGGNEL+DS
Sbjct  34   DHKYEPDEQVVLWVNKVGPYNNPQETYNYFSLPFCHPQGKVAHRWGGLGEVLGGNELVDS  93

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
             + +KF+KNVD+  IC+LELD++K  +F+DAIENSYWFE F+DDLPLWGFVG+L  D+  
Sbjct  94   GLEVKFKKNVDRASICELELDQSKATQFRDAIENSYWFELFIDDLPLWGFVGELRFDKTG  153

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +  +KYN +QII
Sbjct  154  ENAKHVLYTHRNFFIKYNGNQII  176



>ref|XP_006648727.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=568

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            Y+ ++ V LWVNKVGPY NPQETYNYYSLPFC  S+N  H+WGGLGEVLGGNELIDSQI+
Sbjct  13   YQVEEKVMLWVNKVGPYNNPQETYNYYSLPFCHPSDNPVHKWGGLGEVLGGNELIDSQID  72

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDNKPV  576
            IKF ++VDK  IC +ELD  K ++  DAIE+SYWFEFF+DDLPLWGFVG+ DRN+DNK  
Sbjct  73   IKFGRDVDKDTICSMELDPDKAKQLSDAIESSYWFEFFIDDLPLWGFVGEADRNNDNKYF  132

Query  577  IFTHXSITVKYNXDQII  627
            +FTH +I ++YN +QII
Sbjct  133  LFTHKNIVIRYNGNQII  149



>gb|EPS62158.1| hypothetical protein M569_12635, partial [Genlisea aurea]
Length=537

 Score =   175 bits (444),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 114/139 (82%), Gaps = 2/139 (1%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            Y+  + VTLWVNKVGPY NPQETYNYY+LPFC  S NA H+W GLGEVLGGNELIDSQI 
Sbjct  1    YQDGEAVTLWVNKVGPYNNPQETYNYYTLPFCHPSGNAAHKWAGLGEVLGGNELIDSQIK  60

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDNK  570
            IKF+K V+K  IC++E+D  KV++FKDAI+NSYWFEFF+DDLPLWGFVG++  D+  D K
Sbjct  61   IKFKKEVEKTTICEIEMDAEKVKQFKDAIDNSYWFEFFIDDLPLWGFVGEVITDKGHDYK  120

Query  571  PVIFTHXSITVKYNXDQII  627
             V++TH ++ V YN DQII
Sbjct  121  RVLWTHKNLLVHYNRDQII  139



>ref|XP_011096274.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=583

 Score =   175 bits (444),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 118/140 (84%), Gaps = 2/140 (1%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ D+ VTLWVNKVGPY NPQETYNYYSLPFC    +  H+WGGLGEVLGGNELIDSQ+
Sbjct  25   KYQDDESVTLWVNKVGPYNNPQETYNYYSLPFCHPPGSPAHKWGGLGEVLGGNELIDSQL  84

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
             IKF+++V++  IC++EL+  KV++FKDAI+NSYWFEFFMDDLPLWGFVG++  DR +DN
Sbjct  85   EIKFKRDVERTTICEIELEAAKVKQFKDAIDNSYWFEFFMDDLPLWGFVGEVLPDRANDN  144

Query  568  KPVIFTHXSITVKYNXDQII  627
            K V++TH ++ + YN +QII
Sbjct  145  KHVLWTHKNLVINYNGNQII  164



>gb|AAB65482.1| endomembrane protein EMP70 precusor isolog; 68664-64364 [Arabidopsis 
thaliana]
Length=589

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++ VTLWVNKVGPY NPQETYNYYSLPFCR S N  H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQAEEQVTLWVNKVGPYNNPQETYNYYSLPFCRPSGNNVHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            +I IKF KNV++  IC LELDE KV+ FKDAIE+SYWFEFFM    +  FVG+L  D+NS
Sbjct  88   EIAIKFMKNVERSVICPLELDEAKVKHFKDAIESSYWFEFFMGMFHVCCFVGELHPDKNS  147

Query  562  DN-KPVIFTHXSITVKYNXDQII  627
            +N K V++TH +I VKYN DQII
Sbjct  148  ENGKHVLYTHKNIVVKYNKDQII  170



>ref|XP_009631162.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=583

 Score =   173 bits (439),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 118/140 (84%), Gaps = 3/140 (2%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ DDPVTLWVNK  PY NPQETY+YYSLPFCR ++   H+WGGLGEVLGGN+LIDS+I
Sbjct  25   KYQEDDPVTLWVNKAAPYNNPQETYSYYSLPFCRPAD-GDHKWGGLGEVLGGNDLIDSRI  83

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
            +I F++N++K  IC+L+LD +KV +FK AI+NSYWFEFFMDDLP+WGFVG++  DRN D 
Sbjct  84   HINFKRNLEKSSICKLKLDASKVAQFKYAIDNSYWFEFFMDDLPIWGFVGEVHSDRNQDI  143

Query  568  KPVIFTHXSITVKYNXDQII  627
            K VI+TH ++ +KYN DQII
Sbjct  144  KHVIYTHKNLLIKYNGDQII  163



>ref|XP_006384984.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP62781.1| endomembrane protein 70 [Populus trichocarpa]
Length=586

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 115/142 (81%), Gaps = 10/142 (7%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN-APHRWgglgevlggnelID  384
            DH+Y  ++ V LWVNKVGPY NPQETYNYYSLPFC  S N   H+WGGLGEVLGGNELID
Sbjct  28   DHRYGQEEAVKLWVNKVGPYNNPQETYNYYSLPFCHPSSNDGTHKWGGLGEVLGGNELID  87

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRN  558
            SQI++KF KNVDK  ICQLELDE KV++FKDAIENSYWFEFF+      GFVG+L  D+N
Sbjct  88   SQIDLKFAKNVDKAVICQLELDEAKVKQFKDAIENSYWFEFFI------GFVGELRPDKN  141

Query  559  SDN-KPVIFTHXSITVKYNXDQ  621
            SDN K ++FTH SIT+KYN DQ
Sbjct  142  SDNGKHLLFTHKSITIKYNKDQ  163



>gb|EMT15069.1| Transmembrane 9 superfamily member 3 [Aegilops tauschii]
Length=574

 Score =   171 bits (432),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 114/140 (81%), Gaps = 6/140 (4%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK  +PV LWVNKVGPY NPQETYNYYSLPFC+ +EN  H+WGGLGEVLGGNELIDS
Sbjct  27   DHKYKISEPVKLWVNKVGPYNNPQETYNYYSLPFCQPAENPAHKWGGLGEVLGGNELIDS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+I+F KNVDKG IC +ELD  KV++F DAIE+SYWFE F+      GFVG+ D+N++N
Sbjct  87   QIDIQFLKNVDKGPICTIELDAKKVQQFTDAIESSYWFELFI------GFVGETDKNNEN  140

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN +++I
Sbjct  141  KHYLYTHKNIVVKYNGNRVI  160



>ref|XP_001785045.1| predicted protein [Physcomitrella patens]
 gb|EDQ50160.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 107/144 (74%), Gaps = 4/144 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  381
            DH+Y   DPV LWVNKVGPY NPQETYNYYSLPFC   A+ NA H+WGGLGEVL GNELI
Sbjct  28   DHRYGKGDPVMLWVNKVGPYNNPQETYNYYSLPFCSPGAAGNARHKWGGLGEVLEGNELI  87

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGD--LDR  555
            DS++ IKF+  V+K  IC   LD T V  F+ A+  +YWFEFFMDDLPLWGFVG+   D+
Sbjct  88   DSEVEIKFKTPVEKRTICSFTLDGTSVAAFRSAVAQAYWFEFFMDDLPLWGFVGEQHADK  147

Query  556  NSDNKPVIFTHXSITVKYNXDQII  627
            N D K  I+TH  + +KYN DQII
Sbjct  148  NDDEKYTIYTHKDLLIKYNNDQII  171



>gb|AAX96186.1| Endomembrane protein 70 [Oryza sativa Japonica Group]
Length=570

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 114/140 (81%), Gaps = 6/140 (4%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK ++ V LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDS
Sbjct  35   DHKYKAEETVKLWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDS  94

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            Q++IKF KNV+KG IC +ELD+ K+++F DAIE SYWFE F+      GFVG+ D+N++N
Sbjct  95   QVDIKFLKNVEKGPICTIELDDNKIQQFTDAIERSYWFELFI------GFVGETDKNNEN  148

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  ++TH +I VKYN ++II
Sbjct  149  KHYLYTHKNIVVKYNGNRII  168



>ref|XP_002304054.2| hypothetical protein POPTR_0003s011001g, partial [Populus trichocarpa]
 gb|EEE79033.2| hypothetical protein POPTR_0003s011001g, partial [Populus trichocarpa]
Length=485

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 118/149 (79%), Gaps = 9/149 (6%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASEN-APHRWgglgevlggnelID  384
            DH+Y  ++PV LWVNKVGPY NPQETYNYYSLPFC  S + A H+WGGLGEVLGGNELID
Sbjct  30   DHRYGQEEPVKLWVNKVGPYNNPQETYNYYSLPFCHPSGDVATHKWGGLGEVLGGNELID  89

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLW-----GFVGDL  549
            SQI+IKF KNVDKG  CQLELDE KV++FKDAIEN+YW EFF+    ++     GFVG+L
Sbjct  90   SQIDIKFGKNVDKGVTCQLELDEAKVKQFKDAIENNYWLEFFVVYSCIYPYYILGFVGEL  149

Query  550  --DRNSDN-KPVIFTHXSITVKYNXDQII  627
              D+N +N K  +FTH SIT++YN DQII
Sbjct  150  RPDKNGENGKHFLFTHKSITIQYNKDQII  178



>ref|XP_006356503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=584

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 115/140 (82%), Gaps = 3/140 (2%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ +D VTLWVNKV PY NPQETY+YYSLP+CR  +   H+ GGLGEVLGGN LIDS+I
Sbjct  26   KYQENDSVTLWVNKVAPYVNPQETYSYYSLPYCRPGDGY-HKQGGLGEVLGGNALIDSRI  84

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
            +IKF+++V+K  IC+L+LD +K+ +FK AI+NSYWFEFFMDDLP+WGFVG++  DR  DN
Sbjct  85   DIKFKRDVEKRSICELKLDASKIARFKYAIDNSYWFEFFMDDLPIWGFVGEVYPDRGGDN  144

Query  568  KPVIFTHXSITVKYNXDQII  627
            K V++TH  I ++YN DQII
Sbjct  145  KHVVYTHKMIQIQYNRDQII  164



>ref|XP_002984084.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
 gb|EFJ15096.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
Length=587

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 109/143 (76%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR-ASENAPHRWgglgevlggnelID  384
            DHKY   D V LWVNKVGPY NPQETYNYYSLPFC+  + N  H+WGGLG VL GNELID
Sbjct  25   DHKYDIGDAVVLWVNKVGPYNNPQETYNYYSLPFCQPGNANPAHKWGGLGAVLEGNELID  84

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRN  558
            SQI+IKF+K+VDK  IC+L+LD+ K  +F+ AIE +YWFEFFMDDLPLWGFVG+    + 
Sbjct  85   SQIDIKFKKSVDKVTICKLDLDQRKAMEFRAAIEETYWFEFFMDDLPLWGFVGEYHHGKA  144

Query  559  SDNKPVIFTHXSITVKYNXDQII  627
             +    I+TH  + +KYN +QII
Sbjct  145  EEQNVAIYTHKHLVIKYNKNQII  167



>ref|XP_002960054.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
 gb|EFJ37593.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
Length=586

 Score =   164 bits (416),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 109/143 (76%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR-ASENAPHRWgglgevlggnelID  384
            DHKY   D V LWVNKVGPY NPQETYNYYSLPFC+  + N  H+WGGLG VL GNELID
Sbjct  25   DHKYDIGDAVVLWVNKVGPYNNPQETYNYYSLPFCQPGNANPAHKWGGLGAVLEGNELID  84

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRN  558
            SQI+IKF+K+VDK  IC+L+L++ K  +F+ AIE +YWFEFFMDDLPLWGFVG+    + 
Sbjct  85   SQIDIKFKKSVDKVTICKLDLNQRKAMEFRAAIEETYWFEFFMDDLPLWGFVGEYHHGKA  144

Query  559  SDNKPVIFTHXSITVKYNXDQII  627
             +    I+TH  + +KYN +QII
Sbjct  145  EEQNVAIYTHKHLVIKYNKNQII  167



>ref|XP_009788011.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=583

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 114/140 (81%), Gaps = 3/140 (2%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ DD VTLWVNK  PY NPQETY+YYSLPFCR ++   H+ GGLGEVLGGN+LIDS+I
Sbjct  25   KYQEDDSVTLWVNKAAPYNNPQETYSYYSLPFCRPAD-GDHKRGGLGEVLGGNDLIDSRI  83

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
            +I F++NV+K  IC L+LD +KV +F+ AI+N YWFEFFMDDLP+WGFVG++  DRN D 
Sbjct  84   DIMFKRNVEKSSICALQLDASKVAQFEYAIDNLYWFEFFMDDLPIWGFVGEVHSDRNQDI  143

Query  568  KPVIFTHXSITVKYNXDQII  627
            K VI+TH ++ +KYN DQII
Sbjct  144  KHVIYTHTNLLIKYNGDQII  163



>gb|EMS58779.1| Transmembrane 9 superfamily member 3 [Triticum urartu]
Length=571

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 111/138 (80%), Gaps = 6/138 (4%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            + +P +PV LWVNKVGPY NPQETYNYYSLPFC  +EN  H+WGGLGEVLGGNELIDSQI
Sbjct  21   RVRPQEPVKLWVNKVGPYNNPQETYNYYSLPFCLPAENPAHKWGGLGEVLGGNELIDSQI  80

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDNKP  573
            +I+F KNVDKG +C +ELD  KV++F DAIE+SYWFE F+      GFVG+ D+N++NK 
Sbjct  81   DIQFLKNVDKGPVCTIELDAKKVQQFTDAIESSYWFELFI------GFVGETDKNNENKH  134

Query  574  VIFTHXSITVKYNXDQII  627
             ++TH +I VKYN +++I
Sbjct  135  YLYTHKNIVVKYNGNRVI  152



>ref|XP_004241844.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=584

 Score =   162 bits (410),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 111/140 (79%), Gaps = 2/140 (1%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            KY+ +D VTLWVNK  PY NPQETY+YYSLP+CR + +  H+WGGLG VLGGN+LIDS+I
Sbjct  25   KYQENDSVTLWVNKAAPYVNPQETYSYYSLPYCRPAADGDHKWGGLGGVLGGNDLIDSRI  84

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNSDN  567
            +IKF+++V+K  IC+L+LD +K+ +FK AI+NSYWFEFFMDDLP+WGFVG++   R   N
Sbjct  85   DIKFKRDVEKRSICELKLDASKIARFKYAIDNSYWFEFFMDDLPIWGFVGEVHPHRVGHN  144

Query  568  KPVIFTHXSITVKYNXDQII  627
               ++TH  I + YN DQII
Sbjct  145  THALYTHKMIQIDYNRDQII  164



>gb|EMT08384.1| Transmembrane 9 superfamily member 3 [Aegilops tauschii]
Length=552

 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 111/138 (80%), Gaps = 6/138 (4%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            +YK  D V LWVNKVGPY NPQETYNY+SLPFC+ SEN  H+WGGLGEVLGGNELIDSQ+
Sbjct  2    QYKAGDSVKLWVNKVGPYNNPQETYNYHSLPFCQPSENPGHKWGGLGEVLGGNELIDSQL  61

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDNKP  573
            +IKF +NV++G IC LELD  K ++F DAIE+SYWFEFF+      GFVG+ D+NS+NK 
Sbjct  62   DIKFLRNVERGSICTLELDPKKTQQFADAIESSYWFEFFI------GFVGETDKNSENKH  115

Query  574  VIFTHXSITVKYNXDQII  627
             ++TH +I VKYN ++II
Sbjct  116  YLYTHKNILVKYNDNRII  133



>emb|CDY44835.1| BnaCnng11910D [Brassica napus]
Length=155

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ ++ VTLWVNKVGPY NPQETYNYYSLPFCR +EN+ H+WGGLGEVLGGNELIDS
Sbjct  30   DHKYQANEQVTLWVNKVGPYNNPQETYNYYSLPFCRKNENSIHKWGGLGEVLGGNELIDS  89

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI+IKF KNVD+  IC LELDE KV+ FKDAIENSYWFE FM    ++ ++  +++    
Sbjct  90   QIDIKFLKNVDRSVICHLELDEAKVKHFKDAIENSYWFELFMGMYHIYLYILLINKCHRK  149

Query  568  KPV  576
            K +
Sbjct  150  KLI  152



>emb|CAN77106.1| hypothetical protein VITISV_037096 [Vitis vinifera]
Length=600

 Score =   152 bits (383),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 111/143 (78%), Gaps = 9/143 (6%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKY+ D+ VTLWVNKVGPY NPQETYNY+SLPFC    NA H+WGGLGEVLGGNELIDS
Sbjct  28   DHKYQTDEQVTLWVNKVGPYNNPQETYNYFSLPFCHPPGNAGHKWGGLGEVLGGNELIDS  87

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
            QI++KF+KNV++  IC +ELD  KV++F+DAI  SYWFEFF+      GF+G++  +  N
Sbjct  88   QIDMKFKKNVERTTICIIELDAAKVKQFRDAIGKSYWFEFFI------GFIGEVHSDKKN  141

Query  568  ---KPVIFTHXSITVKYNXDQII  627
               + +++T+ +I V+YN DQII
Sbjct  142  DKIQHLLYTNKNIFVRYNGDQII  164



>ref|XP_008781557.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Phoenix 
dactylifera]
Length=616

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 115/196 (59%), Gaps = 58/196 (30%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
            +YK DDPV LWVNKVGPY NPQETYNYYSLPFC+ SEN  H+WGGLGEVLGGNELIDSQI
Sbjct  2    QYKADDPVALWVNKVGPYNNPQETYNYYSLPFCQPSENPAHKWGGLGEVLGGNELIDSQI  61

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFF---------------------  510
            +IKFQKNVDKG IC LELD  KV+ F DAI NSYWFEFF                     
Sbjct  62   DIKFQKNVDKGSICMLELDAAKVKHFTDAIVNSYWFEFFIGMFLTVCRFLLSFCSFLKYS  121

Query  511  -----------------MDDLPLWGFV--------GDLD------------RNSDNKPVI  579
                             ++ LP + F          DLD            +N++NK  +
Sbjct  122  RIGIYVHLVIDAFHVIVIECLPFFLFTFPSSLLGHNDLDDLPLWGFVGETDKNNENKHFL  181

Query  580  FTHXSITVKYNXDQII  627
            FTH +I V+YN +QII
Sbjct  182  FTHKNIVVRYNNNQII  197



>ref|XP_001698971.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO99025.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=598

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 4/144 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRAS--ENAPHRWgglgevlggnelI  381
            +HKY   + V+LWVNKVGPY NPQETYNYY LPFC+ +  + A H WGGLGEVL GNELI
Sbjct  29   NHKYADKEQVSLWVNKVGPYNNPQETYNYYYLPFCKLNPKQRAEHSWGGLGEVLQGNELI  88

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DR  555
            +SQ++IK+++ ++   IC + LDE K   F+DAI   YWFE FMDDLP+WGFVG+L  D 
Sbjct  89   NSQLDIKYKEKLESTRICTMTLDERKADIFEDAIRRQYWFELFMDDLPVWGFVGELKKDD  148

Query  556  NSDNKPVIFTHXSITVKYNXDQII  627
              +    I+T     V YN D+II
Sbjct  149  TGNETAYIYTSKRFDVAYNGDRII  172



>ref|XP_011395771.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
 gb|KFM22905.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
Length=591

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 103/144 (72%), Gaps = 6/144 (4%)
 Frame = +1

Query  211  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA--SENAPHRWgglgevlggnelID  384
            H+Y+  DP+TLWVNKVGPY NPQETYNYY LPFC+    E   H+WGGLGEVL GNELID
Sbjct  28   HRYEVGDPITLWVNKVGPYNNPQETYNYYLLPFCKPKPGETPRHKWGGLGEVLQGNELID  87

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVG---DLDR  555
            SQ+++ F+++  +  +C + LD+ K   F +A+   YW+EFF+DDLP+WGFVG   +  R
Sbjct  88   SQVDMAFRRDTARATLCSVHLDDAKTGDFIEAVRRHYWYEFFLDDLPIWGFVGPPPEAAR  147

Query  556  NSDNKPVIFTHXSITVKYNXDQII  627
            + +    I+TH ++ V YN D++I
Sbjct  148  DGE-ATYIYTHKTLDVAYNGDRVI  170



>gb|KIZ05019.1| Transmembrane 9 superfamily member 3, partial [Monoraphidium 
neglectum]
Length=198

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 99/143 (69%), Gaps = 5/143 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRAS--ENAPHRWgglgevlggnelI  381
            +H+Y   +PV LWVNKVGP+ NPQETYNYY+LP+C+A   E A H WGGLGEVL GNELI
Sbjct  28   NHRYADKEPVVLWVNKVGPFNNPQETYNYYALPYCKARPDEPAEHSWGGLGEVLQGNELI  87

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS  561
             SQ++IKF+  V K  IC+  L +  V +F +AI   YWFE FMD+LP+WG+VG++   +
Sbjct  88   HSQLDIKFKVPVPKTLICEKTLSDDDVSEFSEAIRRQYWFELFMDELPMWGYVGEVKHGA  147

Query  562  DNK---PVIFTHXSITVKYNXDQ  621
              +    +++ H  + + YN DQ
Sbjct  148  KGQQPATLLYPHWQLDISYNEDQ  170



>ref|XP_002945998.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
 gb|EFJ52993.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
Length=596

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 99/144 (69%), Gaps = 4/144 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA--SENAPHRWgglgevlggnelI  381
            +HKY+  + V LWVNKVGPY NPQETYNYY LPFC+   +  A H WGGLGEVL GNELI
Sbjct  31   NHKYEDREKVNLWVNKVGPYNNPQETYNYYYLPFCKRHPALKAQHSWGGLGEVLQGNELI  90

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS  561
            +SQ++I ++ N     IC L LDE K + F+DAI   YWFE F+DDLP+WGFVG+L ++ 
Sbjct  91   NSQLDIVYKGNTTGADICSLTLDERKAKVFEDAIRRQYWFELFVDDLPVWGFVGELKKDD  150

Query  562  DN--KPVIFTHXSITVKYNXDQII  627
                +  I+T     + YN D+II
Sbjct  151  AGVERAYIYTSKRFDISYNKDRII  174



>ref|XP_005845268.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
 gb|EFN53166.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
Length=589

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 101/144 (70%), Gaps = 4/144 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA--SENAPHRWgglgevlggnelI  381
            +H+Y+  D VTLWVNKVGPY NPQETYNYY LPFC+   ++   H+WGGLGEVL GNELI
Sbjct  26   NHRYQVGDVVTLWVNKVGPYNNPQETYNYYLLPFCKPKPADKTRHKWGGLGEVLQGNELI  85

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVG--DLDR  555
            DSQ+ +KF+ ++ K  IC + LD+ KV  F +A+   YW+EFF D+LP+WGFVG      
Sbjct  86   DSQLELKFRTDMPKRDICTMNLDDDKVEDFTEAVRRHYWYEFFADELPIWGFVGPPPEQT  145

Query  556  NSDNKPVIFTHXSITVKYNXDQII  627
              D+   I+TH +  + YN D++I
Sbjct  146  KGDSNVYIYTHKTFDIAYNGDRVI  169



>ref|XP_007509634.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19437.1| predicted protein [Bathycoccus prasinos]
Length=629

 Score =   133 bits (335),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 80/180 (44%), Positives = 103/180 (57%), Gaps = 40/180 (22%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR------ASENAPHRWgglgevlgg  369
            DHKY   DP+ LWVNKVGPY NPQETYNYY LPFC+      AS+   H+WGGLGE+L G
Sbjct  31   DHKYASGDPIKLWVNKVGPYNNPQETYNYYELPFCKVEPKDGASKKPVHKWGGLGEILEG  90

Query  370  nelIDSQINIKFQKNVDKGHICQL-ELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGD  546
            NELI S +  KF++++ K  +C   +L E +V KF +AI N YW+EF+MD+LP+WGFVG+
Sbjct  91   NELILSNVEFKFRQDLPKRVMCSTGKLTEKEVEKFSNAIRNHYWYEFYMDELPIWGFVGE  150

Query  547  L---------------------------------DRNSDNKPVIFTHXSITVKYNXDQII  627
                                              D   D K  ++TH S  + YN D+II
Sbjct  151  YVDPNANDDDEEDEEDNSSSNNKKSSSSSSNSGNDAGGDAKVYVYTHRSFDIGYNEDRII  210



>emb|CDY33319.1| BnaAnng04300D [Brassica napus]
Length=544

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/101 (73%), Positives = 84/101 (83%), Gaps = 3/101 (3%)
 Frame = +1

Query  334  HRWgglgevlggnelIDSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFM  513
            H+WGGLGEVLGGNELIDSQI+IKF KNVD+  ICQLELDE KV+ FKDAIENSYWFE FM
Sbjct  44   HKWGGLGEVLGGNELIDSQIDIKFLKNVDRSVICQLELDEAKVKHFKDAIENSYWFELFM  103

Query  514  DDLPLWGFVGDL---DRNSDNKPVIFTHXSITVKYNXDQII  627
            DDLPLWGFVG+L    ++ + K  ++TH SI VKYN DQII
Sbjct  104  DDLPLWGFVGELPPGKKSENGKHALYTHKSINVKYNKDQII  144



>ref|XP_005645983.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21439.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
Length=610

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 96/144 (67%), Gaps = 4/144 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCR--ASENAPHRWgglgevlggnelI  381
             HKY   + V LWVNKVGPY NPQETYNYY LPFC+   ++ A H+WGGLGEVL GNELI
Sbjct  47   THKYNVGEQVRLWVNKVGPYNNPQETYNYYYLPFCKPKQADKAVHKWGGLGEVLQGNELI  106

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVG--DLDR  555
            DSQ+++KF+  V K  IC   L E     F+ A++  YW+E F+DDLP+WGFVG    + 
Sbjct  107  DSQLDMKFRTEVPKKTICSQRLSEPNAVTFRKAVQKHYWYELFIDDLPVWGFVGPPPEEI  166

Query  556  NSDNKPVIFTHXSITVKYNXDQII  627
              +    I+TH S  + YN ++II
Sbjct  167  KDEEHIYIYTHKSFDINYNDNRII  190



>emb|CDY44834.1| BnaCnng11900D [Brassica napus]
Length=547

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +1

Query  334  HRWgglgevlggnelIDSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFM  513
            H+WGGLGEVLGGNELIDSQI+IKF KNVD+  IC LELDE KV+ FKDAIENSYWFE FM
Sbjct  47   HKWGGLGEVLGGNELIDSQIDIKFTKNVDRSVICHLELDEAKVKHFKDAIENSYWFELFM  106

Query  514  DDLPLWGFVGDL--DRNSDN-KPVIFTHXSITVKYNXDQII  627
            DDLPLWGFVG+L   +N +N K V++TH SI VKYN DQII
Sbjct  107  DDLPLWGFVGELAPGKNGENGKHVLYTHKSINVKYNKDQII  147



>emb|CDY12876.1| BnaA09g13980D [Brassica napus]
Length=564

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/101 (75%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +1

Query  334  HRWgglgevlggnelIDSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFM  513
            H+WGGLGEVLGGNELIDSQI+IKF KNVD+  IC LELDE KV+ FKDAIENSYWFE FM
Sbjct  45   HKWGGLGEVLGGNELIDSQIDIKFTKNVDRSVICHLELDEAKVKHFKDAIENSYWFELFM  104

Query  514  DDLPLWGFVGDL--DRNSDN-KPVIFTHXSITVKYNXDQII  627
            DDLPLWGFVG+L   +N +N K V++TH SI VKYN DQII
Sbjct  105  DDLPLWGFVGELAPGKNGENGKHVLYTHKSINVKYNKDQII  145



>ref|NP_001003550.1| transmembrane 9 superfamily member 1 [Danio rerio]
 gb|AAH78291.1| Transmembrane 9 superfamily member 1 [Danio rerio]
Length=609

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 98/142 (69%), Gaps = 5/142 (4%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
             YK  DPV L+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S  
Sbjct  35   SYKQGDPVVLYVNKVGPYHNPQETYHYYTLPVCRPKE-VRHKALSLGEVLDGDRMAESLY  93

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----  561
            NI+F++N D+  +C+L L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +     
Sbjct  94   NIRFKENADRLTLCKLTLSEKEVDQLREAIEELYYFEFVLDDIPIWGFVGYMEESGFLPH  153

Query  562  DNKPVIFTHXSITVKYNXDQII  627
             +K  ++TH  + ++YN D +I
Sbjct  154  SHKVGLWTHLDLNIEYNGDSVI  175



>ref|XP_006809561.1| PREDICTED: transmembrane 9 superfamily member 1-like [Neolamprologus 
brichardi]
Length=609

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 98/141 (70%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S  N
Sbjct  34   YKIGDNVTLYVNKVGPYHNPQETYHYYTLPVCRP-EKVHHKSLSLGEVLDGDRMAESLYN  92

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F+KNV+K  +CQL L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +      
Sbjct  93   IRFKKNVEKTILCQLTLSEKQVDELREAIEELYYFEFVLDDIPIWGFVGYIEESGFLPHS  152

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++YN D +I
Sbjct  153  HKVGLWTHLDFNIEYNGDYVI  173



>ref|XP_004575210.1| PREDICTED: transmembrane 9 superfamily member 1-like [Maylandia 
zebra]
 ref|XP_005952771.1| PREDICTED: transmembrane 9 superfamily member 1-like [Haplochromis 
burtoni]
Length=608

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 98/141 (70%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S  N
Sbjct  33   YKIGDNVTLYVNKVGPYHNPQETYHYYTLPVCRP-EKVHHKSLSLGEVLDGDRMAESLYN  91

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F+KNV+K  +CQL L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +      
Sbjct  92   IRFKKNVEKTILCQLTLSEKQVDELREAIEELYYFEFVLDDIPIWGFVGYIEESGFLPHS  151

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++YN D +I
Sbjct  152  HKVGLWTHLDFNIEYNGDYVI  172



>ref|XP_005754693.1| PREDICTED: transmembrane 9 superfamily member 1-like [Pundamilia 
nyererei]
Length=608

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 98/141 (70%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S  N
Sbjct  33   YKIGDNVTLYVNKVGPYHNPQETYHYYTLPVCRP-EKVHHKSLSLGEVLDGDRMAESLYN  91

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F+KNV+K  +CQL L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +      
Sbjct  92   IRFKKNVEKTILCQLTLSEKQVDELREAIEELYYFEFVLDDIPIWGFVGYIEESGFLPHS  151

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++YN D +I
Sbjct  152  HKVGLWTHLDFNIEYNGDYVI  172



>ref|XP_002509072.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70330.1| predicted protein [Micromonas sp. RCC299]
Length=613

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 97/171 (57%), Gaps = 31/171 (18%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA----SENAPHRWgglgevlggne  375
            DHKY   D VTLWVNKVGP+ NPQETYNY+ LPFC+      +   H+WGGLGE+L GNE
Sbjct  23   DHKYLVGDAVTLWVNKVGPFNNPQETYNYHELPFCKVEGVDGKRPKHKWGGLGEILEGNE  82

Query  376  lIDSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVG----  543
            LIDS +  +F+ +  K  +C   LD   V+KFK AI + YW+EF MDDLP+WGFVG    
Sbjct  83   LIDSNMEFRFRHDQPKKTMCVTSLDANDVKKFKRAIRHHYWYEFVMDDLPIWGFVGEHVD  142

Query  544  -----------------------DLDRNSDNKPVIFTHXSITVKYNXDQII  627
                                   D+  +      I+TH +  + YN D+II
Sbjct  143  ERSTLTGSKSATTTAEAADLMADDVVEHRGGTVYIYTHKTFDISYNGDRII  193



>ref|XP_010739917.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Larimichthys 
crocea]
Length=609

 Score =   123 bits (309),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 98/141 (70%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S  +
Sbjct  34   YKQGDNVTLFVNKVGPYHNPQETYHYYTLPVCRP-EKVHHKSLSLGEVLDGDRMAESLYH  92

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NVDK  +CQL L E +V + ++AIE  ++FEF +DD+P+WGFVG ++ +      
Sbjct  93   IRFRENVDKKTLCQLTLSEKQVDQLREAIEELFYFEFVLDDIPIWGFVGYIEESGFLPHS  152

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++YN D +I
Sbjct  153  HKVGLWTHLDFNIEYNGDSVI  173



>ref|XP_007255923.1| PREDICTED: transmembrane 9 superfamily member 1 [Astyanax mexicanus]
Length=605

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
             YK  DPVTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S  
Sbjct  29   SYKQGDPVTLYVNKVGPYHNPQETYHYYTLPVCRPKE-VRHKALSLGEVLDGDRMAESLY  87

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----  561
             I F++N ++  +CQL L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +     
Sbjct  88   KIHFRENTERQTLCQLSLTEKEVDQLREAIEELYYFEFVLDDVPIWGFVGYMEESGFLPH  147

Query  562  DNKPVIFTHXSITVKYNXDQII  627
             +K  ++TH    ++YN D +I
Sbjct  148  SHKVGLWTHLDFNIEYNGDSVI  169



>ref|XP_010884102.1| PREDICTED: transmembrane 9 superfamily member 1 [Esox lucius]
Length=612

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 96/141 (68%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  DPVTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S   
Sbjct  37   YKQGDPVTLYVNKVGPYHNPQETYHYYTLPVCRPKE-VHHKSLSLGEVLDGDRMAESLYE  95

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            IKF++N +K  +C L L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +      
Sbjct  96   IKFRENTEKKTLCGLTLTEKEVDQLREAIEELYYFEFVLDDIPIWGFVGYMEESGFLPHS  155

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++YN D +I
Sbjct  156  HKVGLWTHLDFNIEYNGDSVI  176



>emb|CDQ70386.1| unnamed protein product [Oncorhynchus mykiss]
Length=595

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
             YK  DPVTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S  
Sbjct  21   SYKQGDPVTLYVNKVGPYHNPQETYHYYTLPVCRPKE-VHHKSLSLGEVLDGDRMAESLY  79

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----  561
             IKF+ N +K  +CQL L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +     
Sbjct  80   EIKFRDNTEKKLLCQLTLTEKEVDQLREAIEELYYFEFVLDDIPIWGFVGYMEESGFLPH  139

Query  562  DNKPVIFTHXSITVKYNXDQII  627
             +K  ++TH    ++YN + +I
Sbjct  140  SHKVGLWTHLDFNIEYNGNSVI  161



>ref|XP_003457937.2| PREDICTED: transmembrane 9 superfamily member 1-like [Oreochromis 
niloticus]
Length=609

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 97/141 (69%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S   
Sbjct  34   YKQGDNVTLYVNKVGPYHNPQETYHYYTLPVCRP-EKVHHKSLSLGEVLDGDRMAESLYY  92

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +CQL L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +      
Sbjct  93   IRFRENVEKKALCQLTLSEKQVDELREAIEELYYFEFVLDDIPIWGFVGYIEESGFLPHS  152

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++YN D +I
Sbjct  153  HKVGLWTHLDFNIEYNGDSVI  173



>ref|XP_009064505.1| hypothetical protein LOTGIDRAFT_196341 [Lottia gigantea]
 gb|ESO84885.1| hypothetical protein LOTGIDRAFT_196341 [Lottia gigantea]
Length=583

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 87/140 (62%), Gaps = 1/140 (1%)
 Frame = +1

Query  211  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-S  387
            H YK  + V LW+N VGPY+N QETY Y+SLPFCR S+ +   +            ++ S
Sbjct  26   HIYKDAEEVVLWMNTVGPYHNRQETYEYFSLPFCRGSKESIGHYHETLGEALLGVELEFS  85

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
             I+I F+ ++ K   C +EL+E K++ F  A++N YW++ ++DDLP+WG VG++D N+  
Sbjct  86   GIDIDFKGDMSKTEYCSVELNEDKLQAFVYAVQNHYWYQMYIDDLPIWGIVGEIDENNGK  145

Query  568  KPVIFTHXSITVKYNXDQII  627
            +  I++H    + YN  QI+
Sbjct  146  EYYIWSHKKFDIGYNGRQIV  165



>emb|CBN81815.1| Transmembrane 9 superfamily member 1 [Dicentrarchus labrax]
Length=594

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 98/141 (70%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S  +
Sbjct  19   YKQGDNVTLYVNKVGPYHNPQETYHYYTLPVCRP-EKVHHKSLSLGEVLDGDRMAESLYH  77

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +CQL L E +V + ++AIE  ++FEF +DD+P+WGFVG ++ +      
Sbjct  78   IRFRENVEKKTLCQLILSEKQVDELREAIEELFYFEFVLDDIPIWGFVGYIEESGFLPHS  137

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++YN D +I
Sbjct  138  HKVGLWTHLDFNIEYNGDSVI  158



>ref|XP_008436895.1| PREDICTED: transmembrane 9 superfamily member 1 [Poecilia reticulata]
Length=594

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 97/142 (68%), Gaps = 5/142 (4%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
             YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  +   H+   LGEVL G+ + +S  
Sbjct  18   SYKKGDNVTLYVNKVGPYHNPQETYHYYTLPVCRP-DKVHHKSLSLGEVLDGDRMAESLY  76

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----  561
             I+FQ+NVD+  +C+L L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +     
Sbjct  77   FIRFQENVDRKTLCKLTLSEKQVDELREAIEELYYFEFVLDDIPIWGFVGYIEESGFLPH  136

Query  562  DNKPVIFTHXSITVKYNXDQII  627
             +K  ++TH    ++YN D +I
Sbjct  137  SHKVGLWTHLDFNIEYNGDSVI  158



>ref|XP_007548006.1| PREDICTED: transmembrane 9 superfamily member 1 [Poecilia formosa]
Length=594

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 97/142 (68%), Gaps = 5/142 (4%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
             YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  +   H+   LGEVL G+ + +S  
Sbjct  18   SYKKGDNVTLYVNKVGPYHNPQETYHYYTLPVCRP-DKVHHKSLSLGEVLDGDRMAESLY  76

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----  561
             I+FQ+NVD+  +C+L L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +     
Sbjct  77   FIRFQENVDRKTLCKLTLSEKQVDELREAIEELYYFEFVLDDIPIWGFVGYIEESGFLPH  136

Query  562  DNKPVIFTHXSITVKYNXDQII  627
             +K  ++TH    ++YN D +I
Sbjct  137  SHKVGLWTHLDFNIEYNGDSVI  158



>ref|XP_008305730.1| PREDICTED: transmembrane 9 superfamily member 1 [Cynoglossus 
semilaevis]
Length=609

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 97/141 (69%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  D VTL+VNKVGPY+NPQETY++Y+LP CR  E   H+   LGEVL G+ + +S   
Sbjct  34   YKQGDNVTLFVNKVGPYHNPQETYHFYTLPVCRP-EKVHHKSLSLGEVLDGDRMAESLYQ  92

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +CQL L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +      
Sbjct  93   IRFKENVEKKTLCQLTLSEKQVDQLREAIEELYYFEFVLDDIPIWGFVGYIEESGFLPHS  152

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    +++N D +I
Sbjct  153  HKVGLWTHLDFNIEFNGDSVI  173



>ref|XP_005803703.1| PREDICTED: transmembrane 9 superfamily member 1-like [Xiphophorus 
maculatus]
Length=594

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
             YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  +   H+   LGEVL G+ + +S  
Sbjct  18   SYKKGDNVTLYVNKVGPYHNPQETYHYYTLPVCRP-DKVHHKSLSLGEVLDGDRMAESLY  76

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----  561
             I FQ+NVDK  +C+L L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +     
Sbjct  77   VIPFQENVDKKTLCKLTLSEKQVDELREAIEELYYFEFVLDDIPIWGFVGYIEESGFLPH  136

Query  562  DNKPVIFTHXSITVKYNXDQII  627
             +K  ++TH    ++YN D +I
Sbjct  137  SHKVGLWTHLDFNIEYNGDSVI  158



>ref|XP_001689987.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDP09725.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=605

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 94/146 (64%), Gaps = 6/146 (4%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH Y+PDD V LW +KVGP+ NP ETY YYSLP+C+  +   H+  G+GEV+  N +  +
Sbjct  38   DHSYQPDDKVPLWASKVGPFTNPSETYEYYSLPYCQPKDGVKHKLLGMGEVVDANRMAST  97

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDR----  555
               ++F+KN  +  +C+  LD+ K+ KF+ A+E  ++F+ + DDLP+WGF+G +++    
Sbjct  98   PYQLQFRKNRQREAVCEQLLDQEKLAKFRKAVEEDWYFQMYYDDLPVWGFIGKMEKLFKP  157

Query  556  --NSDNKPVIFTHXSITVKYNXDQII  627
               ++ K  +FTH    +KYN D +I
Sbjct  158  GGVTEYKYYLFTHIDFDIKYNDDSVI  183



>ref|XP_008276179.1| PREDICTED: transmembrane 9 superfamily member 1 [Stegastes partitus]
 ref|XP_008276180.1| PREDICTED: transmembrane 9 superfamily member 1 [Stegastes partitus]
 ref|XP_008276181.1| PREDICTED: transmembrane 9 superfamily member 1 [Stegastes partitus]
Length=609

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 97/141 (69%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S  +
Sbjct  34   YKQLDNVTLYVNKVGPYHNPQETYHYYTLPVCRP-EKVHHKSLSLGEVLDGDRMAESLYH  92

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C L L E +V + ++AIE  Y+FEF +DD+P+WGFVG ++ +      
Sbjct  93   IRFRENVEKKTLCHLTLSEKQVDELREAIEELYYFEFVLDDIPIWGFVGYIEESGFLPHS  152

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++YN + +I
Sbjct  153  HKVALWTHLDFNIEYNGNSVI  173



>gb|EWM22128.1| transmembrane 9 superfamily member 3 [Nannochloropsis gaditana]
Length=601

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 87/142 (61%), Gaps = 4/142 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAP--HRWgglgevlggnelI  381
            +HKY   D VTLWVNKVGPY+NP ETY YY LPFC+  E      R   LGE L G+EL+
Sbjct  30   NHKYAEGDEVTLWVNKVGPYHNPHETYEYYDLPFCKPVEGVETRRRSNSLGEQLEGHELM  89

Query  382  DSQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS  561
            +S   + F K+V K  +C ++L     + F  A++N YW++ ++DDLP+WG VG+ D   
Sbjct  90   NSGYLLSFTKDVAKTKVCSMKLSAEDAKTFASAVDNRYWYQLYLDDLPIWGMVGEADETG  149

Query  562  DNKPVIFTHXSITVKYNXDQII  627
                 I+TH  +++ YN   +I
Sbjct  150  AQS--IYTHRKLSLGYNGPNVI  169



>ref|XP_002939067.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004910820.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Xenopus 
(Silurana) tropicalis]
Length=589

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 99/144 (69%), Gaps = 5/144 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            D++YKP DPV ++VNKVGPY+NPQETY+YY LP C A E   H+   LGEVL G+ + +S
Sbjct  23   DNRYKPGDPVMMYVNKVGPYHNPQETYHYYQLPVC-APEQIRHKSLTLGEVLDGDRMAES  81

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS--  561
               I F++NV++  +C+++L  ++V + + AIE  Y+FEF +DD+P+ GF+G ++ +   
Sbjct  82   MYRITFRQNVERQTLCEMKLSLSQVEELRRAIEELYYFEFVLDDIPIRGFLGYMEESGFL  141

Query  562  --DNKPVIFTHXSITVKYNXDQII  627
               +K  ++ H  I ++YN D+II
Sbjct  142  PHTHKIGLWAHLDINIEYNDDRII  165



>ref|XP_004081008.1| PREDICTED: transmembrane 9 superfamily member 1 [Oryzias latipes]
 ref|XP_011487110.1| PREDICTED: transmembrane 9 superfamily member 1 [Oryzias latipes]
Length=594

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 97/141 (69%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  D VTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ + +S  +
Sbjct  19   YKQGDNVTLYVNKVGPYHNPQETYHYYTLPVCRP-EKVHHKSLSLGEVLDGDRMAESLYH  77

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +CQL L E +V + ++AIE  Y+FEF + ++P+WGFVG ++ +      
Sbjct  78   IRFRENVEKKTLCQLTLSEKQVDQLREAIEELYYFEFVLAEIPIWGFVGYIEESGFLPHS  137

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++YN + +I
Sbjct  138  HKVGLWTHLDFNIEYNGESVI  158



>gb|AEE63341.1| unknown [Dendroctonus ponderosae]
Length=577

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 85/141 (60%), Gaps = 4/141 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            +H Y  ++ V LW+N VGPY+N QETYNY+SLPFC  S+ +   +            ++ 
Sbjct  22   NHIYDTNEEVVLWMNTVGPYHNRQETYNYFSLPFCVGSKESISHYHETLSEALQGVELEI  81

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S I++ F+ NV K   C ++LDE K + F  A++N YW++ ++DDLP+WG VG++    D
Sbjct  82   SGIDMDFKTNVAKTEYCAVQLDEAKYKAFVYAVKNHYWYQMYIDDLPIWGVVGEVK---D  138

Query  565  NKPVIFTHXSITVKYNXDQII  627
            N   I+TH    + YN  QII
Sbjct  139  NNFYIWTHKKFEIGYNGKQII  159



>gb|ENN73181.1| hypothetical protein YQE_10235, partial [Dendroctonus ponderosae]
 gb|ERL92379.1| hypothetical protein D910_09693 [Dendroctonus ponderosae]
Length=577

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 85/141 (60%), Gaps = 4/141 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            +H Y  ++ V LW+N VGPY+N QETYNY+SLPFC  S+ +   +            ++ 
Sbjct  22   NHIYDTNEEVVLWMNTVGPYHNRQETYNYFSLPFCVGSKESISHYHETLSEALQGVELEI  81

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S I++ F+ NV K   C ++LDE K + F  A++N YW++ ++DDLP+WG VG++    D
Sbjct  82   SGIDMDFKTNVAKTEYCAVQLDEAKYKAFVYAVKNHYWYQMYIDDLPIWGVVGEVK---D  138

Query  565  NKPVIFTHXSITVKYNXDQII  627
            N   I+TH    + YN  QII
Sbjct  139  NNFYIWTHKKFEIGYNGKQII  159



>ref|XP_002956625.1| hypothetical protein VOLCADRAFT_110022 [Volvox carteri f. nagariensis]
 gb|EFJ42227.1| hypothetical protein VOLCADRAFT_110022 [Volvox carteri f. nagariensis]
Length=605

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 94/146 (64%), Gaps = 6/146 (4%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH YK DDPV LW +KVGP+ NP ETY YYSLP+C+  +   H+  G+GEV+  N +  +
Sbjct  38   DHTYKVDDPVPLWASKVGPFTNPSETYEYYSLPYCQPKDGVKHKLLGMGEVVDANRMAST  97

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDR----  555
               ++F+KN ++  IC+  LD  ++ KF+ A++  ++F+ + DDLP+WGF+G +++    
Sbjct  98   PYQLQFRKNRNRELICEQLLDGDRLAKFRKAVKEDWYFQMYYDDLPVWGFIGKMEKLFKP  157

Query  556  --NSDNKPVIFTHXSITVKYNXDQII  627
               ++ K  +FTH    +KYN D +I
Sbjct  158  GGVTEYKYYLFTHIDFDIKYNDDSVI  183



>gb|EEZ99577.1| hypothetical protein TcasGA2_TC001563 [Tribolium castaneum]
Length=578

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 87/141 (62%), Gaps = 4/141 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            +H Y  ++ V LW+N VGPY+N QETY Y+SLPFC  S++  + +            ++ 
Sbjct  22   NHIYGDNEEVILWMNTVGPYHNRQETYAYFSLPFCVGSKDTINHYHETLSEALQGVELEF  81

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S I+I+F+ NV KG  C ++L+E K + F  A++N YW++ ++DDLP+WG VG++    D
Sbjct  82   SGIDIEFKSNVQKGEYCAVQLNEDKYKVFVYAVKNHYWYQMYIDDLPIWGVVGEIK---D  138

Query  565  NKPVIFTHXSITVKYNXDQII  627
            N   I+TH    + YN  QII
Sbjct  139  NNYYIWTHKKFEIGYNGKQII  159



>ref|XP_967117.1| PREDICTED: transmembrane 9 superfamily member 3 [Tribolium castaneum]
Length=577

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 87/141 (62%), Gaps = 4/141 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            +H Y  ++ V LW+N VGPY+N QETY Y+SLPFC  S++  + +            ++ 
Sbjct  22   NHIYGDNEEVILWMNTVGPYHNRQETYAYFSLPFCVGSKDTINHYHETLSEALQGVELEF  81

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S I+I+F+ NV KG  C ++L+E K + F  A++N YW++ ++DDLP+WG VG++    D
Sbjct  82   SGIDIEFKSNVQKGEYCAVQLNEDKYKVFVYAVKNHYWYQMYIDDLPIWGVVGEIK---D  138

Query  565  NKPVIFTHXSITVKYNXDQII  627
            N   I+TH    + YN  QII
Sbjct  139  NNYYIWTHKKFEIGYNGKQII  159



>gb|ERG85277.1| transmembrane 9 superfamily member 3 [Ascaris suum]
Length=592

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 89/143 (62%), Gaps = 4/143 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            DH YK  + V LW+N VGPY N QETY Y+SLPFCR S+ +   +            +D 
Sbjct  33   DHIYKDGEEVVLWMNTVGPYSNRQETYTYFSLPFCRGSKQSIGHYHETLGEALLGVELDF  92

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S ++IKF++NV+K   C+  L +   + F  A++N+YW++ ++D+LP++G VG++D +S 
Sbjct  93   SGLDIKFKENVEKMTFCKKTLTDEDYKAFIYAVQNNYWYQMYLDELPMYGMVGEID-SST  151

Query  565  NKPV--IFTHXSITVKYNXDQII  627
              P   +FTH  + + YN +QI+
Sbjct  152  TPPTYKLFTHKKLEIGYNKNQIV  174



>gb|EGT53827.1| hypothetical protein CAEBREN_03110 [Caenorhabditis brenneri]
Length=580

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 87/143 (61%), Gaps = 4/143 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            DH Y+ D+ V LW+N VGPY N QETY Y+SLPFC+  +     +            ++ 
Sbjct  21   DHLYEVDEEVVLWMNTVGPYSNRQETYTYFSLPFCKGEKKEIGHYHETMGESLLGVELEF  80

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S ++IKF+ N  K  +CQ +L ET  +    AI+NSY+++ ++DD+P+WG VG++D NS 
Sbjct  81   SGLDIKFRTNTKKTIVCQKKLTETDYKTLLYAIQNSYYYQMYLDDMPIWGMVGEID-NSV  139

Query  565  NKPV--IFTHXSITVKYNXDQII  627
            N P   ++TH  + + YN  Q++
Sbjct  140  NPPAYKLYTHKRLDIGYNDKQVV  162



>gb|KHN75714.1| Transmembrane 9 superfamily member 3 [Toxocara canis]
Length=581

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 89/142 (63%), Gaps = 2/142 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            DH Y+  D V LW+N VGPY N QETY Y+SLPFCR S++    +            +D 
Sbjct  22   DHIYRDGDEVVLWMNTVGPYNNRQETYTYFSLPFCRGSKHTIGHYHETLGEALLGVELDF  81

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S ++IKF++NV+K   C+  L + + + F  A++++YW++ ++D+LP++G VG++D ++ 
Sbjct  82   SGLDIKFKENVEKVTFCKKTLSDEEYKAFVYAVQSNYWYQMYLDELPMYGMVGEVDMSTA  141

Query  565  NKPV-IFTHXSITVKYNXDQII  627
                 +FTH  + + YN DQI+
Sbjct  142  PPTYKLFTHKKLEIGYNKDQIV  163



>ref|XP_006519680.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X4 [Mus 
musculus]
Length=417

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>ref|XP_003967994.1| PREDICTED: transmembrane 9 superfamily member 1-like [Takifugu 
rubripes]
Length=611

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = +1

Query  214  KYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQI  393
             YK  + VTL+VNKVGPY+NPQETY+YY+LP CR  E   H+   LGEVL G+ +  S  
Sbjct  35   SYKQGENVTLYVNKVGPYHNPQETYHYYTLPVCRP-EKIHHKSLTLGEVLDGDRMAQSLY  93

Query  394  NIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----  561
            +I F++NV++  +CQL L E +V + ++AIE  ++FEF +DD+P+WGFVG L+ +     
Sbjct  94   HIPFRENVERKTVCQLTLTEKQVDQLREAIEELFYFEFVLDDIPIWGFVGYLEESGFLPH  153

Query  562  DNKPVIFTHXSITVKYNXDQII  627
             +K  ++TH    ++YN + +I
Sbjct  154  SHKVGLWTHLDFNIEYNGNAVI  175



>ref|XP_006519679.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Mus 
musculus]
Length=503

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>ref|XP_001950058.1| PREDICTED: transmembrane 9 superfamily member 3 [Acyrthosiphon 
pisum]
Length=589

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 94/141 (67%), Gaps = 2/141 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENA-PHRWgglgevlggnelID  384
            +H YK ++ V LW+N VGPY+N QETY Y+SLPFC   +++  H    LGE L G ELI 
Sbjct  32   NHLYKSNEEVVLWMNTVGPYHNRQETYTYFSLPFCAGPKDSISHYHETLGEALQGVELIH  91

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S + ++F++++ K   CQ+ LD+ K++ F  A+ N YW++ ++DDLP+WG VG+LD  ++
Sbjct  92   SGLEMRFKEDISKVPFCQVNLDDNKLKAFIYAVRNHYWYQMYIDDLPIWGIVGELDE-TN  150

Query  565  NKPVIFTHXSITVKYNXDQII  627
            NK  I+TH    + +N   I+
Sbjct  151  NKYYIWTHKKFDIGFNDHHIV  171



>ref|XP_011243511.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X3 [Mus 
musculus]
Length=474

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>ref|XP_005836386.1| hypothetical protein GUITHDRAFT_67884 [Guillardia theta CCMP2712]
 gb|EKX49406.1| hypothetical protein GUITHDRAFT_67884 [Guillardia theta CCMP2712]
Length=584

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 93/146 (64%), Gaps = 7/146 (5%)
 Frame = +1

Query  211  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA-SENAPHRWgglgevlggnelIDS  387
             +Y  ++ VTLW NK+GPY NPQETY+YY+LPFCR  ++    +W GLGE L GN L+ S
Sbjct  21   QRYTDNESVTLWANKIGPYENPQETYSYYTLPFCRLNADKWQSKWAGLGEALEGNSLVKS  80

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL------  549
               I F+ +V+K   C ++LD+  +  F+ A+ N YWF   +D+LP+W  VG++      
Sbjct  81   DYGISFKHDVEKALNCAVKLDKRSLDMFQYAVSNHYWFNLVLDELPMWAMVGEVRESKLG  140

Query  550  DRNSDNKPVIFTHXSITVKYNXDQII  627
            + + D++  IFTH   ++ YN D+II
Sbjct  141  NHSGDDEKYIFTHKHFSIAYNGDRII  166



>ref|XP_004225719.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3-like [Ciona intestinalis]
Length=581

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 87/142 (61%), Gaps = 3/142 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRAS-ENAPHRWgglgevlggnelID  384
             H YK D+ V LW+N VGPY+N QETY Y+ LPFC+   E+   R             + 
Sbjct  23   SHTYKDDEDVLLWMNTVGPYHNRQETYEYFRLPFCKGGKESLIDRHHENLGDALQGVELK  82

Query  385  SQ-INIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS  561
             Q ++IKF++NV+    C++ELD+ K   F  A++N YW++ +MDDLP+WG VG+ D N 
Sbjct  83   YQALDIKFKQNVEPTKYCEIELDQKKYESFVYAVDNHYWYQMYMDDLPIWGIVGEADENG  142

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            ++   ++TH  + + YN +QI+
Sbjct  143  EDF-YMWTHKKLEIGYNDNQIV  163



>ref|XP_006835458.1| PREDICTED: charged multivesicular body protein 4a-like isoform 
X1 [Chrysochloris asiatica]
Length=815

 Score =   117 bits (292),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 64/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  245  YKTGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  303

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C L+L  T+V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  304  IRFRENVEKRILCHLQLSSTQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  363

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  364  HKIGLWTHLDFHLEFHRDRII  384



>ref|XP_008487150.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Diaphorina citri]
Length=542

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 86/142 (61%), Gaps = 2/142 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            +HKY   D V LW+N VGPY+N QETY+Y+SLPFC  ++     +            ++ 
Sbjct  24   NHKYDTHDEVVLWMNTVGPYHNRQETYSYFSLPFCYGTKKEISHYHETLGEALQGVELEF  83

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S I+I F+ N+ K   C   LDE K++ F  A++N YW++ ++DDLP+WG VG+++  SD
Sbjct  84   SGIDIDFKDNIAKTTYCGTRLDEEKLKAFIYAVKNHYWYQMYIDDLPIWGIVGEVEELSD  143

Query  565  NKP-VIFTHXSITVKYNXDQII  627
            +    ++TH    + YN D+I+
Sbjct  144  HTNYYLWTHKKFDIGYNGDRIV  165



>gb|EEE68090.1| hypothetical protein OsJ_26137 [Oryza sativa Japonica Group]
Length=864

 Score =   116 bits (290),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 60/143 (42%), Positives = 92/143 (64%), Gaps = 4/143 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH+YK  D V L+ NKVGP++NP ETY YY LPFC A ++   +   LGEVL G+ L+D+
Sbjct  30   DHRYKDGDYVPLYANKVGPFHNPSETYRYYDLPFC-APDHPKDKREALGEVLNGDRLVDA  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
               + F+++ +   +CQ  L + +V K +DA+   Y+F+ + DDLPLWGF+G LD++ + 
Sbjct  89   PYELNFKEDRNSKVLCQKSLSKVEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDKDKEQ  148

Query  568  ---KPVIFTHXSITVKYNXDQII  627
               K ++F H    + YN D++I
Sbjct  149  GNAKYLLFKHIHFDIMYNGDRVI  171



>ref|XP_002963357.1| hypothetical protein SELMODRAFT_166118 [Selaginella moellendorffii]
 gb|EFJ35228.1| hypothetical protein SELMODRAFT_166118 [Selaginella moellendorffii]
Length=589

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 90/142 (63%), Gaps = 3/142 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH Y  +D V L+ NKVGP++NP ETY Y+ LPFC  S N  H+   LGEVL G+ ++ +
Sbjct  30   DHTYGENDKVPLYANKVGPFHNPSETYQYFDLPFCEPS-NLKHKSEDLGEVLEGDRMVTT  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            + NI F+ + +   +C  +L+    RKF+ AIE  Y+F+ F DDLPLWGFVG L  D   
Sbjct  89   RYNITFKTDKETEELCSFKLEPETKRKFRSAIEQDYYFQMFFDDLPLWGFVGKLQTDEKK  148

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            + + ++FTH    + +N +++I
Sbjct  149  EERYMLFTHVHFEIAFNDNRVI  170



>ref|XP_002974646.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
 gb|EFJ24166.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
Length=589

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 90/142 (63%), Gaps = 3/142 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH Y  +D V L+ NKVGP++NP ETY Y+ LPFC  S N  H+   LGEVL G+ ++ +
Sbjct  30   DHTYGENDKVPLYANKVGPFHNPSETYQYFDLPFCEPS-NLKHKSEDLGEVLEGDRMVTT  88

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDL--DRNS  561
            + NI F+ + +   +C  +L+    RKF+ AIE  Y+F+ F DDLPLWGFVG L  D   
Sbjct  89   RYNITFKTDKETEELCSFKLEPETKRKFRSAIEQDYYFQMFFDDLPLWGFVGKLQTDEKK  148

Query  562  DNKPVIFTHXSITVKYNXDQII  627
            + + ++FTH    + +N +++I
Sbjct  149  EERYMLFTHVHFEIAFNDNRVI  170



>gb|EMS60954.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=590

 Score =   114 bits (286),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 92/143 (64%), Gaps = 4/143 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK  D V L+ NKVGP++NP ETY YY LPFC A E+   +   LGEVL G+ L+D+
Sbjct  28   DHKYKEGDRVPLYANKVGPFHNPSETYRYYDLPFC-APEHPKDKREALGEVLNGDRLVDA  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD-  564
               + F+++ +   +C+  L + +V K +DA+   Y+F+ + DDLPLWGF+G LDRN + 
Sbjct  87   PYELNFKEDTNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDRNKEH  146

Query  565  --NKPVIFTHXSITVKYNXDQII  627
               K ++F H    + YN D++I
Sbjct  147  GGGKCLLFKHIHFDIMYNNDRVI  169



>ref|XP_004972768.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Setaria 
italica]
Length=768

 Score =   115 bits (288),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 60/143 (42%), Positives = 92/143 (64%), Gaps = 4/143 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK  D V L+ NKVGP++NP ETY YY LPFC A E+   +   LGEVL G+ L+D+
Sbjct  206  DHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFC-APEHPKDKKEALGEVLNGDRLVDA  264

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRN---  558
               + F+++ +   +C+  L + +V K +DA+   Y+F+ + DDLPLWGF+G +D++   
Sbjct  265  PYELNFKEDKNSKILCEKTLTKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKMDKDREQ  324

Query  559  SDNKPVIFTHXSITVKYNXDQII  627
             D K ++F H    + YN +++I
Sbjct  325  GDAKYLLFKHIHFDIMYNDNRVI  347



>ref|XP_002062013.1| GK16877 [Drosophila willistoni]
 gb|EDW72999.1| GK16877 [Drosophila willistoni]
Length=586

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 2/140 (1%)
 Frame = +1

Query  211  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-S  387
            HKY   + V LW+N VGPY+N QETY Y+SLPFCR +++    +            ++ S
Sbjct  30   HKYNDQEEVVLWMNTVGPYHNRQETYAYFSLPFCRGTKDTISHYHETLSEALQGVELELS  89

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
               + F +N  +  IC +EL E K + F  A+ N YW++ ++D LP+WG VG+ D   D 
Sbjct  90   GYQMAFAQNKKRNVICGVELTEEKTKAFTYAVMNEYWYQMYIDGLPIWGKVGERDER-DG  148

Query  568  KPVIFTHXSITVKYNXDQII  627
            K  IFTH    + YN  QI+
Sbjct  149  KYYIFTHKKFDIGYNGQQIV  168



>ref|NP_001012155.1| transmembrane 9 superfamily member 1 precursor [Rattus norvegicus]
 sp|Q66HF2.1|TM9S1_RAT RecName: Full=Transmembrane 9 superfamily member 1; Flags: Precursor 
[Rattus norvegicus]
 gb|AAH81891.1| Transmembrane 9 superfamily member 1 [Rattus norvegicus]
Length=589

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>ref|XP_006854108.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
 gb|ERN15575.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
Length=631

 Score =   114 bits (286),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 58/145 (40%), Positives = 92/145 (63%), Gaps = 6/145 (4%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHKYK  D V L+ NKVGP++NP ETY YY LPFC + E+   +   LGEVL G+ L+D+
Sbjct  67   DHKYKQGDRVPLYANKVGPFHNPSETYRYYDLPFC-SPEHVTEKREDLGEVLNGDRLVDA  125

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
               ++F+   +   +C+ +L + KV + +DA+   Y+F+ + DDLP+WGF+G +D+++  
Sbjct  126  PYQLQFRLERESEVLCKKKLSKDKVAQLRDAVNKDYYFQMYYDDLPIWGFIGKVDKDNKA  185

Query  568  KP-----VIFTHXSITVKYNXDQII  627
             P     ++F H    + YN D++I
Sbjct  186  DPSEYRYLLFKHIHFEISYNKDRVI  210



>ref|XP_002634585.1| Hypothetical protein CBG08396 [Caenorhabditis briggsae]
 emb|CAP28227.1| Protein CBG08396 [Caenorhabditis briggsae]
Length=580

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 87/143 (61%), Gaps = 4/143 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            DH Y+ D+ V LW+N VGPY N QETY Y+SLPFC+  +     +            ++ 
Sbjct  21   DHLYEVDEEVVLWMNTVGPYSNRQETYTYFSLPFCKGDKKEIGHYHETMGESLLGVELEF  80

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S ++IKF+ N  K  +CQ +L ET  +    AI+NSY+++ ++DD+P+WG VG++D NS 
Sbjct  81   SGLDIKFRTNTKKTVVCQKKLTETDYKTLLYAIQNSYYYQMYLDDMPIWGMVGEID-NSV  139

Query  565  NKPV--IFTHXSITVKYNXDQII  627
            + P   ++TH  + + YN  Q++
Sbjct  140  SPPTYKLYTHKRLDIGYNDKQVV  162



>ref|XP_006252052.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Rattus 
norvegicus]
 ref|XP_006252053.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Rattus 
norvegicus]
 ref|XP_008768910.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Rattus 
norvegicus]
 gb|EDM14255.1| rCG23597, isoform CRA_a [Rattus norvegicus]
 gb|EDM14256.1| rCG23597, isoform CRA_a [Rattus norvegicus]
Length=606

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>ref|NP_500130.1| Protein Y41D4A.4 [Caenorhabditis elegans]
 emb|CCD72812.1| Y41D4A.4, isoform a [Caenorhabditis elegans]
Length=580

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 87/143 (61%), Gaps = 4/143 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            DH Y+ D+ V LW+N VGPY N QETY Y+SLPFC+  +     +            ++ 
Sbjct  21   DHLYEVDEEVVLWMNTVGPYSNRQETYTYFSLPFCKGEKKEIGHYHETMGESLLGVELEF  80

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S ++IKF+ N  K  +C+ +L ET  +    AI+NSY+++ ++DD+P+WG VG++D N+ 
Sbjct  81   SGLDIKFRTNTKKTVVCEKKLTETDYKTLLYAIQNSYYYQMYLDDMPIWGMVGEID-NTV  139

Query  565  NKPV--IFTHXSITVKYNXDQII  627
            N P   ++TH  + + YN  Q++
Sbjct  140  NPPAYKLYTHKRLDIGYNDKQVV  162



>gb|AAF98161.1|AF269152_1 transmembrane protein TM9SF1 [Mus musculus]
Length=605

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>ref|XP_005770609.1| hypothetical protein EMIHUDRAFT_196296 [Emiliania huxleyi CCMP1516]
 gb|EOD18180.1| hypothetical protein EMIHUDRAFT_196296 [Emiliania huxleyi CCMP1516]
Length=176

 Score =   108 bits (271),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 87/135 (64%), Gaps = 9/135 (7%)
 Frame = +1

Query  211  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA--SENAPHRWgglgevlggnelID  384
            H Y+  +   LWVNKVGPY+NPQETY +YSLPFC +   E   HR+  LGEVL GN+LI 
Sbjct  21   HLYQTSEATHLWVNKVGPYHNPQETYTFYSLPFCSSFPVEKLEHRYDWLGEVLEGNDLIA  80

Query  385  SQINIKFQKNV-DKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRN-  558
            S   ++F++ V D   +C +ELDE    +   AI N YW+++++DDLP+WG VG+L  + 
Sbjct  81   SGFELRFREPVPDHTKVCSMELDEESAAQLSFAIHNHYWYQWYLDDLPIWGMVGELTTSD  140

Query  559  -----SDNKPVIFTH  588
                 S  + ++FTH
Sbjct  141  SDEDESQAEALLFTH  155



>gb|ERE89416.1| transmembrane 9 superfamily member 1 isoform 2 [Cricetulus griseus]
Length=589

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKKILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>ref|XP_009009848.1| hypothetical protein HELRODRAFT_184872 [Helobdella robusta]
 gb|ESO13128.1| hypothetical protein HELRODRAFT_184872 [Helobdella robusta]
Length=582

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 93/141 (66%), Gaps = 2/141 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA-SENAPHRWgglgevlggnelID  384
            DH Y+ D+ V LW+N VGPYYN QETY Y +LPFC     +  H    +GE L G EL  
Sbjct  25   DHIYQDDEQVVLWMNTVGPYYNQQETYIYTTLPFCLGPVSSVLHHHETIGEALQGVELTF  84

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S I+I F+K+  K   C++++DE K + F  AI+N+YW++ +MDDLP+WG VG+  + S+
Sbjct  85   SGIDIDFKKDAAKQSYCEIKMDEVKYQAFAYAIKNNYWYQMYMDDLPIWGSVGEKPK-SE  143

Query  565  NKPVIFTHXSITVKYNXDQII  627
            ++  I+TH +  + YN ++I+
Sbjct  144  DELFIYTHKNFQIGYNGNRIV  164



>ref|XP_004698552.1| PREDICTED: transmembrane 9 superfamily member 1 [Echinops telfairi]
Length=898

 Score =   115 bits (288),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 63/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  DPV L+VNKVGPY+NPQETY+YY LP C + E   H+   LGEVL G+ + +S   
Sbjct  331  YKAGDPVILYVNKVGPYHNPQETYHYYQLPVC-SPEKIRHKSLSLGEVLDGDRMAESLYK  389

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C L+L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  390  IRFRENVEKRILCHLQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  449

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  450  HKIGLWTHLDFHLEFHRDRII  470



>ref|NP_083056.2| transmembrane 9 superfamily member 1 precursor [Mus musculus]
 ref|XP_006519675.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Mus 
musculus]
 ref|XP_006519676.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Mus 
musculus]
 ref|XP_006519677.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Mus 
musculus]
 ref|XP_006519678.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Mus 
musculus]
 sp|Q9DBU0.2|TM9S1_MOUSE RecName: Full=Transmembrane 9 superfamily member 1; Flags: Precursor 
[Mus musculus]
 gb|AAH17617.1| Tm9sf1 protein [Mus musculus]
 dbj|BAB23535.2| unnamed protein product [Mus musculus]
 dbj|BAE31250.1| unnamed protein product [Mus musculus]
 dbj|BAE31295.1| unnamed protein product [Mus musculus]
 gb|EDL36266.1| transmembrane 9 superfamily member 1, isoform CRA_a [Mus musculus]
 gb|EDL36267.1| transmembrane 9 superfamily member 1, isoform CRA_a [Mus musculus]
Length=606

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>emb|CDH93343.1| Y41D4A.4, isoform e [Caenorhabditis elegans]
Length=589

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 87/143 (61%), Gaps = 4/143 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            DH Y+ D+ V LW+N VGPY N QETY Y+SLPFC+  +     +            ++ 
Sbjct  21   DHLYEVDEEVVLWMNTVGPYSNRQETYTYFSLPFCKGEKKEIGHYHETMGESLLGVELEF  80

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S ++IKF+ N  K  +C+ +L ET  +    AI+NSY+++ ++DD+P+WG VG++D N+ 
Sbjct  81   SGLDIKFRTNTKKTVVCEKKLTETDYKTLLYAIQNSYYYQMYLDDMPIWGMVGEID-NTV  139

Query  565  NKPV--IFTHXSITVKYNXDQII  627
            N P   ++TH  + + YN  Q++
Sbjct  140  NPPAYKLYTHKRLDIGYNDKQVV  162



>ref|XP_005370493.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Microtus 
ochrogaster]
 ref|XP_005370494.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Microtus 
ochrogaster]
Length=606

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 95/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S  +
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYD  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>ref|XP_010598840.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X3 [Loxodonta 
africana]
Length=815

 Score =   115 bits (287),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 63/141 (45%), Positives = 93/141 (66%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  245  YKTGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  303

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  304  IRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVIDDLPIRGFVGYMEESGFLPHS  363

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ DQII
Sbjct  364  HKIGLWTHLDFHLEFHRDQII  384



>ref|XP_003502106.1| PREDICTED: transmembrane 9 superfamily member 1 [Cricetulus griseus]
 ref|XP_003502107.1| PREDICTED: transmembrane 9 superfamily member 1 [Cricetulus griseus]
 ref|XP_007609248.1| PREDICTED: transmembrane 9 superfamily member 1 [Cricetulus griseus]
 gb|EGW11552.1| Transmembrane 9 superfamily member 1 [Cricetulus griseus]
 gb|ERE89415.1| transmembrane 9 superfamily member 1 isoform 2 [Cricetulus griseus]
Length=606

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKKILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>ref|XP_011056752.1| PREDICTED: transmembrane 9 superfamily member 3 [Acromyrmex echinatior]
 gb|EGI63922.1| Transmembrane 9 superfamily member 3 [Acromyrmex echinatior]
Length=588

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 87/145 (60%), Gaps = 7/145 (5%)
 Frame = +1

Query  211  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-S  387
            H Y+  D V LW++ VGPY+N QETY+YYSLPFC  ++N  + +            +  S
Sbjct  27   HIYEDGDEVVLWMSTVGPYHNRQETYSYYSLPFCTGTKNVINHYHETLAEALQGIELKFS  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSDN  567
             + I+F++++ K   CQ+ L+E   + F  AI+N YW++ ++DDLP+WG VG+++ N+D 
Sbjct  87   GLEIEFKEDISKTEYCQISLNEESQKAFAYAIKNQYWYQMYIDDLPIWGVVGEME-NNDG  145

Query  568  KPV-----IFTHXSITVKYNXDQII  627
              V     I+TH    + YN  QI+
Sbjct  146  VSVSDSYYIWTHKKFDIGYNGKQIV  170



>ref|XP_003755940.1| PREDICTED: transmembrane 9 superfamily member 1 [Sarcophilus 
harrisii]
Length=605

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 95/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            Y+P DPV L+VNKVGPY+NPQETY+YY LP C + E   H+   LGEVL G+ + +S   
Sbjct  35   YQPGDPVMLYVNKVGPYHNPQETYHYYQLPVC-SPEKIRHKSLSLGEVLDGDRMAESMYQ  93

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +CQ+ L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  94   IRFRENVEKRTLCQMRLTFAQVERLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  153

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+I+
Sbjct  154  HKIGLWTHLDFHLEFHGDRIV  174



>ref|XP_001699211.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO98851.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=594

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 93/143 (65%), Gaps = 3/143 (2%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DHK+KP   + L+ NKVGP+ NP ETY YY+LPFC+ ++   ++   LGEVL G+ L+ +
Sbjct  31   DHKFKPGSDIMLYANKVGPFQNPTETYQYYNLPFCQPTDGKEYKTEFLGEVLEGDRLVTT  90

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDR---N  558
               ++F+ +V+   +C+  L    ++KF+DA++  Y+F+ F DDLP+WGF+G +++    
Sbjct  91   PYKLQFRTDVENAVLCKRTLTAGDLKKFRDAVKQDYYFQMFYDDLPVWGFIGKVEKIVQQ  150

Query  559  SDNKPVIFTHXSITVKYNXDQII  627
              +K  +FTH    + YN D+II
Sbjct  151  GTHKYFLFTHFHFDLSYNDDRII  173



>ref|XP_011259429.1| PREDICTED: transmembrane 9 superfamily member 3 [Camponotus floridanus]
 gb|EFN66277.1| Transmembrane 9 superfamily member 3 [Camponotus floridanus]
Length=588

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 88/146 (60%), Gaps = 7/146 (5%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            +H Y+  D V LW++ VGPY+N QETY+YYSLPFC   +N  + +            +  
Sbjct  26   NHLYEDGDEVVLWMSTVGPYHNRQETYSYYSLPFCTGIKNVINHYHETLSEALQGIELKF  85

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S ++I+F++++ K   CQ+ L+E   + F  AI+N YW++ ++DDLP+WG VG+L+ N+D
Sbjct  86   SGLDIEFKEDISKTEYCQISLNEESQKAFVYAIKNQYWYQMYIDDLPIWGVVGELE-NND  144

Query  565  NKPV-----IFTHXSITVKYNXDQII  627
               V     I+TH    + YN  QI+
Sbjct  145  GVAVSDSYYIWTHKKFDIGYNGKQIV  170



>ref|XP_001380199.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Monodelphis 
domestica]
 ref|XP_007479929.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Monodelphis 
domestica]
Length=605

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 95/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            Y+P DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  35   YQPGDPVMLYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESMYQ  93

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +CQ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  94   IRFRENVEKQTLCQMQLTFAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  153

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+I+
Sbjct  154  HKIGLWTHLDFHLEFHGDRIV  174



>ref|XP_006835459.1| PREDICTED: charged multivesicular body protein 4a-like isoform 
X2 [Chrysochloris asiatica]
Length=613

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  161  YKTGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  219

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C L+L  T+V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  220  IRFRENVEKRILCHLQLSSTQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  279

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  280  HKIGLWTHLDFHLEFHRDRII  300



>gb|EMT19161.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=590

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 92/143 (64%), Gaps = 4/143 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            DH+YK  D V L+ NKVGP++NP ETY YY LPFC A E+   +   LGEVL G+ L+D+
Sbjct  28   DHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFC-APEHPKDKREALGEVLNGDRLVDA  86

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD-  564
               + F+++ +   +C+  L + +V K +DA+   Y+F+ + DDLPLWGF+G LDRN + 
Sbjct  87   PYELNFKEDTNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDRNKEH  146

Query  565  --NKPVIFTHXSITVKYNXDQII  627
               K ++F H    + YN D++I
Sbjct  147  GGGKCLLFKHIHFDIMYNNDRVI  169



>ref|XP_005780441.1| hypothetical protein EMIHUDRAFT_60194, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD28012.1| hypothetical protein EMIHUDRAFT_60194, partial [Emiliania huxleyi 
CCMP1516]
Length=221

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 87/135 (64%), Gaps = 9/135 (7%)
 Frame = +1

Query  211  HKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRA--SENAPHRWgglgevlggnelID  384
            H Y+  +   LWVNKVGPY+NPQETY +YSLPFC +   E   HR+  LGEVL GN+LI 
Sbjct  7    HLYQTSEATHLWVNKVGPYHNPQETYTFYSLPFCSSFPVEKLEHRYDWLGEVLEGNDLIA  66

Query  385  SQINIKFQKNV-DKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRN-  558
            S   ++F++ V D   +C +ELDE    +   AI N YW+++++DDLP+WG VG+L  + 
Sbjct  67   SGFELRFREPVPDHTKVCSMELDEESAAQLSFAIHNHYWYQWYLDDLPIWGMVGELTTSD  126

Query  559  -----SDNKPVIFTH  588
                 S  + ++FTH
Sbjct  127  SDEDESQAEALLFTH  141



>dbj|BAD90204.1| mKIAA4036 protein [Mus musculus]
Length=629

 Score =   114 bits (284),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 51/141 (36%), Positives = 88/141 (62%), Gaps = 2/141 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            +H Y+  + V LW+N VGPY+N QETY Y+SLPFC  S+ +   +            ++ 
Sbjct  72   EHTYQDKEEVVLWMNTVGPYHNRQETYKYFSLPFCVGSKKSISHYHETLGEALQGVELEF  131

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S ++IKF+ +V  G  C+++LD+ K   F  AI+N YW++ ++DDLP+WG VG+ D N +
Sbjct  132  SGLDIKFKDDVMPGTYCEIDLDKEKRDAFVYAIKNHYWYQMYIDDLPIWGIVGEADENGE  191

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +   ++T+  + + +N ++I+
Sbjct  192  DY-YLWTYKKLEIGFNGNRIV  211



>ref|XP_006036573.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Alligator 
sinensis]
 ref|XP_006036574.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Alligator 
sinensis]
Length=599

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 97/144 (67%), Gaps = 5/144 (3%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDS  387
            + +YKP DPV L+VNKVGPY+NPQETY+YY LP C + E   H+   LGEVL G+ + +S
Sbjct  25   EAQYKPGDPVMLYVNKVGPYHNPQETYHYYQLPVC-SPEKIQHKSLTLGEVLDGDRMAES  83

Query  388  QINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS--  561
               I+F++NV+K  +C+++L   +V + + AIE  Y+FEF +DDLPL GFVG ++ +   
Sbjct  84   LYQIRFRENVEKRTLCEMKLSPDQVAQLRRAIEELYYFEFVVDDLPLRGFVGYMEESGFL  143

Query  562  --DNKPVIFTHXSITVKYNXDQII  627
               +K  ++TH    +++N + I+
Sbjct  144  PHSHKVGLWTHLDFHLEWNGNHIV  167



>ref|XP_011163701.1| PREDICTED: transmembrane 9 superfamily member 3 [Solenopsis invicta]
Length=584

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 85/141 (60%), Gaps = 1/141 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            +H Y+  D V LW++ VGPY+N QETY+YYSLPFC  ++N  + +            +  
Sbjct  26   NHVYEDGDEVVLWMSTVGPYHNRQETYSYYSLPFCTGTKNVINHYHETLAEALQGIELKF  85

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S ++I+F++++ K   CQ+ L+E   + F  AI+N YW++ ++DDLP+WG VG+++ +  
Sbjct  86   SGLDIEFKEDISKTEYCQISLNEESQKAFAYAIKNQYWYQMYIDDLPIWGVVGEVESDEI  145

Query  565  NKPVIFTHXSITVKYNXDQII  627
                I+ H    + YN  QI+
Sbjct  146  PDYYIWAHKKFDIGYNGKQIV  166



>ref|XP_005085662.1| PREDICTED: transmembrane 9 superfamily member 1 [Mesocricetus 
auratus]
Length=606

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YKP DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  36   YKPGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  94

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C L+L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  95   IRFRENVEKRTLCHLQLSPPQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  154

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  155  HKIGLWTHLDFHLEFHGDRII  175



>ref|XP_007130112.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Physeter 
catodon]
Length=633

 Score =   114 bits (284),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/141 (44%), Positives = 93/141 (66%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  63   YKAGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  121

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  122  IRFRENVEKRILCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  181

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  182  HKIGLWTHLDFHLEFHGDRII  202



>ref|XP_003143038.1| endomembrane protein emp70 [Loa loa]
 gb|EFO21029.1| endomembrane protein emp70 [Loa loa]
Length=581

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 87/144 (60%), Gaps = 6/144 (4%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            DH Y+  + + LW+N VGPY N QETY Y+SLPFCR  +++   +            +D 
Sbjct  22   DHLYRDGEEIVLWMNTVGPYSNRQETYAYFSLPFCRGPKHSISHYHETLGEALLGVELDY  81

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S ++IKF++NV+K   C+  L E   ++F  A+ N+YW++ ++D+LP++G VG++D  S 
Sbjct  82   SGLDIKFKENVEKMEFCKKTLSEEDYKQFVYAVRNNYWYQMYLDELPMYGMVGEID--ST  139

Query  565  NKP---VIFTHXSITVKYNXDQII  627
              P    +FTH  + + YN  QI+
Sbjct  140  TTPPNYRLFTHKKLEIGYNGKQIV  163



>ref|XP_001957525.1| GF10453 [Drosophila ananassae]
 gb|EDV40331.1| GF10453 [Drosophila ananassae]
Length=599

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = +1

Query  208  DHKYKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelID-  384
            +HKY   D V LW+N VGPY+N QETY Y+SLPFC   +++   +            ++ 
Sbjct  42   NHKYNDRDEVVLWMNTVGPYHNRQETYAYFSLPFCSGQKSSISHYHETLSEALQGVELEF  101

Query  385  SQINIKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNSD  564
            S   + F+ +V K  IC + L E   + F  A++N YW++ ++D LP+WG VG+ D   D
Sbjct  102  SGYEMAFKADVSKAIICMVTLQEESTKAFTYAVKNEYWYQMYIDGLPIWGKVGERDER-D  160

Query  565  NKPVIFTHXSITVKYNXDQII  627
             K  IFTH    + YN  QI+
Sbjct  161  GKFYIFTHKKFDIGYNGQQIV  181



>ref|XP_007536361.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Erinaceus 
europaeus]
Length=818

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/141 (44%), Positives = 94/141 (67%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  DPV L+VNKVGPY+NPQETY+YY LP C + E   H+   LGEVL G+ + +S   
Sbjct  246  YKTGDPVILYVNKVGPYHNPQETYHYYQLPVC-SPEKIRHKSLSLGEVLDGDRMAESLYE  304

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C ++L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  305  IRFRENVEKRTLCHMQLSSAQVEQLRQAIEELYYFEFVVDDLPIRGFVGYMEESGFLPHS  364

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  365  HKIGLWTHLDFHLEFHGDRII  385



>ref|XP_004463432.1| PREDICTED: transmembrane 9 superfamily member 1 isoform 1 [Dasypus 
novemcinctus]
Length=814

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 63/141 (45%), Positives = 93/141 (66%), Gaps = 5/141 (4%)
 Frame = +1

Query  217  YKPDDPVTLWVNKVGPYYNPQETYNYYSLPFCRASENAPHRWgglgevlggnelIDSQIN  396
            YK  DPV L+VNKVGPY+NPQETY+YY LP C   E   H+   LGEVL G+ + +S   
Sbjct  244  YKAGDPVILYVNKVGPYHNPQETYHYYQLPVC-CPEKIRHKSLSLGEVLDGDRMAESLYE  302

Query  397  IKFQKNVDKGHICQLELDETKVRKFKDAIENSYWFEFFMDDLPLWGFVGDLDRNS----D  564
            I+F++NV+K  +C L+L   +V + + AIE  Y+FEF +DDLP+ GFVG ++ +      
Sbjct  303  IRFRENVEKRILCHLQLSSAQVEQLRQAIEELYYFEFVLDDLPIRGFVGYMEESGFLPHS  362

Query  565  NKPVIFTHXSITVKYNXDQII  627
            +K  ++TH    ++++ D+II
Sbjct  363  HKIGLWTHLDFHLEFHGDRII  383



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250