BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045E09

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006339901.1|  PREDICTED: heat shock factor protein HSF24-like  71.6    1e-11   Solanum tuberosum [potatoes]
ref|XP_009797839.1|  PREDICTED: heat shock factor protein HSF24       70.5    2e-11   Nicotiana sylvestris
dbj|BAA83710.1|  heat shock factor                                    70.5    2e-11   Nicotiana tabacum [American tobacco]
ref|XP_009589845.1|  PREDICTED: heat shock factor protein HSF24       70.1    3e-11   Nicotiana tomentosiformis
ref|XP_004232034.1|  PREDICTED: heat shock factor protein HSF24       67.0    4e-10   
sp|P22335.1|HSF24_SOLPE  RecName: Full=Heat shock factor protein ...  64.3    4e-09   Solanum peruvianum [Peruvian tomato]



>ref|XP_006339901.1| PREDICTED: heat shock factor protein HSF24-like [Solanum tuberosum]
Length=302

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 61/95 (64%), Gaps = 4/95 (4%)
 Frame = +1

Query  1    GSSHDDSINKVDNSADL---NSSQNKdddddddENGETLKLFGVLLKEKKRKRDHDDNTD  171
            GSS ++ + +V    DL    S  + DD +DDDE G+TLKLFGVLLKEKK+KR  D+N D
Sbjct  209  GSSLEELVKEVGGVKDLEEQGSYNDNDDKEDDDEKGDTLKLFGVLLKEKKKKRGPDENID  268

Query  172  FSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  276
                  K MK ++D  N PWMK+S   G+S KVCN
Sbjct  269  TCGGRGKMMKTTVDY-NGPWMKMSSAAGESSKVCN  302



>ref|XP_009797839.1| PREDICTED: heat shock factor protein HSF24 [Nicotiana sylvestris]
Length=292

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = +1

Query  91   ENGETLKLFGVLLKEKKRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKV  270
            E G+TLKLFGVLLKE K+KR  D+N D S +  K MK ++D  N PWMK+S  PG+S KV
Sbjct  233  EKGDTLKLFGVLLKENKKKRGPDENADISGSRGKMMK-TMDY-NLPWMKMSSAPGESNKV  290

Query  271  CN  276
            CN
Sbjct  291  CN  292



>dbj|BAA83710.1| heat shock factor [Nicotiana tabacum]
Length=292

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 2/62 (3%)
 Frame = +1

Query  91   ENGETLKLFGVLLKEKKRKRDHDDNTDFSAASTKEMKPSIDCKNAPWMKISPVPGKSGKV  270
            E G+TLKLFGVLLKE K+KR  D+N D S +  K MK ++D  N PWMK+S  PG+S KV
Sbjct  233  EKGDTLKLFGVLLKENKKKRGPDENADISGSRGKMMK-TMDY-NLPWMKMSSAPGESNKV  290

Query  271  CN  276
            CN
Sbjct  291  CN  292



>ref|XP_009589845.1| PREDICTED: heat shock factor protein HSF24 [Nicotiana tomentosiformis]
Length=296

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +1

Query  1    GSSHDDSINKVDNSADLNSSQNKdddddddENGETLKLFGVLLKEKKRKRDHDDNTDFSA  180
            GSSH + + +V  +      Q  +DD DDDE G+TLKLFGVLLKE K+KR  D+N D S 
Sbjct  207  GSSHGELVKEVIGAVKDLEEQGSNDDQDDDEKGDTLKLFGVLLKENKKKRGPDENADISG  266

Query  181  ASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  276
            +  K M  ++D  N PWMK+S   G+S K+CN
Sbjct  267  SHGK-MTKTVDY-NLPWMKLSSATGESSKICN  296



>ref|XP_004232034.1| PREDICTED: heat shock factor protein HSF24 [Solanum lycopersicum]
Length=301

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = +1

Query  1    GSSHDDSINKVDNSADL---NSSQNKdddddddENGETLKLFGVLLKEKKRKRDHDDNTD  171
            GSS ++ + +V    DL    S  + DD +DDDE G+TLKLFGVLLKEKK+KR  DDN +
Sbjct  209  GSSLEELVKEVGGVKDLEEQGSYNDNDDKEDDDEKGDTLKLFGVLLKEKKKKRGPDDNIE  268

Query  172  FSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  276
                  K MK ++D  N PWMK+S   G+S KVCN
Sbjct  269  TCGGRGKMMK-TVDY-NGPWMKMSSTAGESSKVCN  301



>sp|P22335.1|HSF24_SOLPE RecName: Full=Heat shock factor protein HSF24; AltName: Full=Heat 
shock transcription factor 24; Short=HSTF 24; AltName: 
Full=Heat stress transcription factor [Solanum peruvianum]
 emb|CAA39034.1| heat stress transcription factor [Solanum peruvianum]
Length=301

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 61/95 (64%), Gaps = 5/95 (5%)
 Frame = +1

Query  1    GSSHDDSINKVDNSADL---NSSQNKdddddddENGETLKLFGVLLKEKKRKRDHDDNTD  171
            GSS ++ + +V    DL    S  + DD +DDDE G+TLKLFGVLLKEKK+KR  D+N +
Sbjct  209  GSSLEELVKEVGGVKDLEEQGSYNDNDDKEDDDEKGDTLKLFGVLLKEKKKKRGPDENIE  268

Query  172  FSAASTKEMKPSIDCKNAPWMKISPVPGKSGKVCN  276
                  K MK ++D  N PWMK+S   G+S KVCN
Sbjct  269  TCGGRGKMMK-TVDY-NGPWMKMSSPAGESSKVCN  301



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510