BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045B10

Length=619
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086042.1|  PREDICTED: LOW QUALITY PROTEIN: protein E6-like  90.5    2e-18   Sesamum indicum [beniseed]
ref|XP_009758887.1|  PREDICTED: probable serine/threonine-protein...  93.2    2e-18   Nicotiana sylvestris
ref|XP_009591056.1|  PREDICTED: probable serine/threonine-protein...  92.0    3e-18   
ref|XP_009757117.1|  PREDICTED: protein E6                            88.2    2e-17   Nicotiana sylvestris
dbj|BAM28759.1|  ROX1 homologue                                       88.2    3e-17   Nicotiana tabacum [American tobacco]
ref|XP_009593819.1|  PREDICTED: probable WRKY transcription facto...  85.9    7e-17   Nicotiana tomentosiformis
ref|XP_006361067.1|  PREDICTED: homeobox protein 2-like               85.9    1e-16   
ref|XP_004232917.1|  PREDICTED: homeobox protein 2-like               86.3    1e-16   Solanum lycopersicum
ref|XP_009783548.1|  PREDICTED: probable cyclin-dependent serine/...  89.0    1e-16   Nicotiana sylvestris
ref|XP_009772856.1|  PREDICTED: probable serine/threonine-protein...  87.8    2e-16   Nicotiana sylvestris
ref|XP_009613470.1|  PREDICTED: homeobox protein 2                    85.5    2e-16   Nicotiana tomentosiformis
emb|CDO99498.1|  unnamed protein product                              84.7    3e-16   Coffea canephora [robusta coffee]
gb|ABH01084.1|  putative ROX1                                         83.2    1e-15   Nicotiana tabacum [American tobacco]
ref|XP_009591057.1|  PREDICTED: GATA zinc finger domain-containin...  84.7    1e-15   
ref|XP_009769426.1|  PREDICTED: homeobox protein 2-like               81.3    3e-15   Nicotiana sylvestris
ref|XP_009618543.1|  PREDICTED: probable serine/threonine-protein...  83.2    5e-15   Nicotiana tomentosiformis
ref|XP_006364298.1|  PREDICTED: protein E6-like                       80.9    1e-14   Solanum tuberosum [potatoes]
gb|EYU43374.1|  hypothetical protein MIMGU_mgv1a012195mg              77.8    6e-14   Erythranthe guttata [common monkey flower]
dbj|BAM28758.1|  ROX1 homologue                                       77.0    2e-13   Nicotiana benthamiana
ref|XP_011096354.1|  PREDICTED: protein E6-like                       70.5    3e-11   Sesamum indicum [beniseed]
gb|KJB69506.1|  hypothetical protein B456_011G030000                  60.8    2e-08   Gossypium raimondii
gb|KJB69505.1|  hypothetical protein B456_011G030000                  59.7    2e-07   Gossypium raimondii
ref|XP_009343874.1|  PREDICTED: protein E6-like                       57.0    2e-06   
ref|XP_010111181.1|  hypothetical protein L484_015064                 56.2    3e-06   Morus notabilis
ref|XP_002279294.1|  PREDICTED: protein E6                            55.8    3e-06   Vitis vinifera
ref|XP_007213825.1|  hypothetical protein PRUPE_ppa009581mg           54.7    1e-05   Prunus persica
ref|XP_008441080.1|  PREDICTED: protein E6                            54.3    1e-05   Cucumis melo [Oriental melon]
ref|XP_008371412.1|  PREDICTED: protein E6-like                       53.9    2e-05   
ref|XP_004485829.1|  PREDICTED: protein E6-like                       53.5    3e-05   Cicer arietinum [garbanzo]
ref|XP_007212675.1|  hypothetical protein PRUPE_ppa018416mg           52.8    3e-05   
ref|XP_008225146.1|  PREDICTED: protein E6                            53.1    3e-05   Prunus mume [ume]
ref|XP_009772857.1|  PREDICTED: probable serine/threonine-protein...  52.8    6e-05   Nicotiana sylvestris
ref|XP_004134947.1|  PREDICTED: protein E6-like                       52.4    6e-05   Cucumis sativus [cucumbers]
ref|XP_004155640.1|  PREDICTED: protein E6-like                       52.4    6e-05   
ref|XP_007159365.1|  hypothetical protein PHAVU_002G232100g           51.2    2e-04   Phaseolus vulgaris [French bean]
ref|XP_009352859.1|  PREDICTED: protein E6                            50.4    3e-04   Pyrus x bretschneideri [bai li]



>ref|XP_011086042.1| PREDICTED: LOW QUALITY PROTEIN: protein E6-like [Sesamum indicum]
Length=282

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 60/91 (66%), Gaps = 11/91 (12%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVPLQKEPNFIPENETSGYGLYGHESGQLPPSAT  294
            ARDSQ+FNK+ S  N       Q       Q EPNF+PENE S YGLYGHESGQLPPS T
Sbjct  29   ARDSQYFNKVSSTTNTKEIPSNQ-------QAEPNFLPENENS-YGLYGHESGQLPPSTT  80

Query  295  AVNNHAEAEEVPYKKYLPKNYNPVAYVTVPE  387
            A +  ++    P  KYLPKNYNPVAYVT P+
Sbjct  81   AYDTESKQ---PSHKYLPKNYNPVAYVTQPD  108



>ref|XP_009758887.1| PREDICTED: probable serine/threonine-protein kinase clkA, partial 
[Nicotiana sylvestris]
Length=571

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 24/107 (22%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            AR+SQFFNKIPSNN+     ++++  V+P  ++E NF+PENE +GYGLYG+ESGQLPPS 
Sbjct  17   ARESQFFNKIPSNNHT----EKKTQVVIPNKEQEANFLPENENNGYGLYGYESGQLPPST  72

Query  292  TAVNNHAEAEEVPYK---------------KYLPKNYNPVAYVTVPE  387
               NN     E PYK               KYLPKNYNPVA+VTVP+
Sbjct  73   ITTNN----VENPYKEINPATTLTNNIYNSKYLPKNYNPVAHVTVPK  115



>ref|XP_009591056.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
tomentosiformis]
Length=465

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 69/107 (64%), Gaps = 24/107 (22%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            AR+SQFFNKIPSN N     ++++  V+P  + EPNF+PENE +GYGLYGHESGQLPPS 
Sbjct  25   ARESQFFNKIPSNINA----EKKTQVVIPNKESEPNFLPENENNGYGLYGHESGQLPPST  80

Query  292  TAVNNHAEAEEVPYK---------------KYLPKNYNPVAYVTVPE  387
            T  N+     E PYK               KYL KNY+ VAYVTVP+
Sbjct  81   TTTND----VEKPYKEINPTTTLTKNIHNSKYLFKNYDNVAYVTVPK  123



>ref|XP_009757117.1| PREDICTED: protein E6 [Nicotiana sylvestris]
Length=346

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (70%), Gaps = 11/92 (12%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            ARD QFFNKIPSNN      ++++ TV+P  ++EPNF+PENE   YGLYGH+S   P + 
Sbjct  24   ARDGQFFNKIPSNNG-----EKETQTVIPNKEQEPNFMPENENGAYGLYGHDSVTTPNT-  77

Query  292  TAVNNHAEAEEVPYKKYLPKNYNPVAYVTVPE  387
                N+    ++P  KYLPKNYNPV+YVTVPE
Sbjct  78   ----NNPTVHDLPNSKYLPKNYNPVSYVTVPE  105



>dbj|BAM28759.1| ROX1 homologue [Nicotiana tabacum]
Length=346

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 64/92 (70%), Gaps = 11/92 (12%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            ARD QFFNKIPSNN      ++++ TV+P  ++EPNF+PENE   YGLYGH+S   P + 
Sbjct  24   ARDGQFFNKIPSNNG-----EKETQTVIPNKEQEPNFMPENENGAYGLYGHDSVTTPNT-  77

Query  292  TAVNNHAEAEEVPYKKYLPKNYNPVAYVTVPE  387
                N+    ++P  KYLPKNYNPV+YVTVPE
Sbjct  78   ----NNPTVHDLPNSKYLPKNYNPVSYVTVPE  105



>ref|XP_009593819.1| PREDICTED: probable WRKY transcription factor protein 1 [Nicotiana 
tomentosiformis]
Length=239

 Score = 85.9 bits (211),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 63/91 (69%), Gaps = 10/91 (11%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVPLQKEPNFIPENETSGYGLYGHESGQLPP-SA  291
            ARDSQFFNKI  + NNN   KE        +KEPNFIPENE +GYG+YG ESGQL P + 
Sbjct  24   ARDSQFFNKI--STNNNGHEKETKEVTPNKEKEPNFIPENE-NGYGVYGQESGQLSPFTT  80

Query  292  TAVNNHAEAEEVPYKKYLPKNYNPVAYVTVP  384
            T +NN      +P  KYLPKNY+PVAYVTVP
Sbjct  81   TPMNN------LPNSKYLPKNYDPVAYVTVP  105



>ref|XP_006361067.1| PREDICTED: homeobox protein 2-like [Solanum tuberosum]
Length=295

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 63/95 (66%), Gaps = 9/95 (9%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVPLQK--EPNFIPENETSGYGLYGHESGQLPPS  288
            ARDSQFFNKI + N NN   ++++  VV   K  EPNFIP+NE + Y +YGHE GQLPPS
Sbjct  26   ARDSQFFNKIHTTNINNDHIEKETKVVVTPNKNQEPNFIPKNE-NAYDVYGHELGQLPPS  84

Query  289  ATAVNNHAEAEEVPYKKYLPKNYNPVAYVTVPEDN  393
                N       +P  KYLPKNYN VAYVTVP+ N
Sbjct  85   TPTTN------LIPNNKYLPKNYNSVAYVTVPQYN  113



>ref|XP_004232917.1| PREDICTED: homeobox protein 2-like [Solanum lycopersicum]
Length=342

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 66/100 (66%), Gaps = 11/100 (11%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP--LQKEPNFIPENETSGYGLYGHESGQLPPS  288
            ARD QFFNK+PSNN      ++++ATVVP   Q+EPNF+PENE   YGLYGHES     S
Sbjct  25   ARDGQFFNKVPSNNG-----EKEAATVVPNKEQQEPNFMPENENGAYGLYGHES----VS  75

Query  289  ATAVNNHAEAEEVPYKKYLPKNYNPVAYVTVPEDNNNDDA  408
              +   +      P  KYLPKNYNPV+YVTV EDN N++ 
Sbjct  76   TPSTTTNTNDNNFPNSKYLPKNYNPVSYVTVAEDNTNENT  115



>ref|XP_009783548.1| PREDICTED: probable cyclin-dependent serine/threonine-protein 
kinase DDB_G0292550 [Nicotiana sylvestris]
Length=1001

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 23/104 (22%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            AR+SQFFN +PSNNN     ++++  V+P  ++EPNF+PENE +GYGLYGHESGQ PPS 
Sbjct  25   ARESQFFNTVPSNNNA----EKKTQVVIPNKEQEPNFLPENENNGYGLYGHESGQHPPST  80

Query  292  TAVNNHAEAEEVPYK--------------KYLPKNYNPVAYVTV  381
            T +N+     E PYK              KYL KNY+ VAYVTV
Sbjct  81   TTIND----VEKPYKEINPTTLTNNIHNSKYLSKNYDHVAYVTV  120



>ref|XP_009772856.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
sylvestris]
Length=547

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 24/105 (23%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            AR+SQFFNKIPSNNN     ++++  V+P  ++EP+F+P NE +GYGLYGHESGQLPPS 
Sbjct  25   ARESQFFNKIPSNNNA----EKKTQVVIPNKEQEPHFLPTNENNGYGLYGHESGQLPPST  80

Query  292  TAVNNHAEAEEVPYK---------------KYLPKNYNPVAYVTV  381
            T  N+     E PYK               KYL KNY+ VAYVTV
Sbjct  81   TTTND----VEKPYKEINPTPTLTNNIHNSKYLSKNYDHVAYVTV  121



>ref|XP_009613470.1| PREDICTED: homeobox protein 2 [Nicotiana tomentosiformis]
Length=346

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 14/92 (15%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            ARD QFFNK+PSNN      ++++ TV+P  ++EPNF+PENE   YGLYGH+S       
Sbjct  24   ARDGQFFNKVPSNNG-----EKETQTVIPNKEQEPNFMPENENGAYGLYGHDS-------  71

Query  292  TAVNNHAEAEEVPYKKYLPKNYNPVAYVTVPE  387
                N+     +P  KYLPKNYNPV+YVTVPE
Sbjct  72   -VTTNNPSVHNLPNSKYLPKNYNPVSYVTVPE  102



>emb|CDO99498.1| unnamed protein product [Coffea canephora]
Length=302

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 63/113 (56%), Gaps = 27/113 (24%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP---------LQKEPNFIPENETSGYGLYGHE  267
            ARD Q FNKIPSNN       +++   VP          ++EPNFIPENE  GYGLYGHE
Sbjct  21   ARDPQLFNKIPSNNGA-----KETQVAVPRSEETLNNKQEQEPNFIPENENGGYGLYGHE  75

Query  268  SGQLPPSATAVNN-----HAEAEEVPYK--------KYLPKNYNPVAYVTVPE  387
            SGQLPPS T   N     +     +PY         KYLPKNYN  +YVT PE
Sbjct  76   SGQLPPSTTTTINPSGEPYKATTNLPYNNEPRDSYPKYLPKNYNTESYVTEPE  128



>gb|ABH01084.1| putative ROX1 [Nicotiana tabacum]
Length=346

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 14/92 (15%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            ARD QFFNK+PSNN      ++++ TV+P  ++EPNF+P NE   YGLYGH+S       
Sbjct  24   ARDGQFFNKVPSNNG-----EKETQTVIPNKEQEPNFMPXNENGAYGLYGHDS-------  71

Query  292  TAVNNHAEAEEVPYKKYLPKNYNPVAYVTVPE  387
                N+     +P  KYLPKNYNPV+YVTVPE
Sbjct  72   -VTTNNPSVHNLPNSKYLPKNYNPVSYVTVPE  102



>ref|XP_009591057.1| PREDICTED: GATA zinc finger domain-containing protein 14-like 
[Nicotiana tomentosiformis]
Length=458

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 65/105 (62%), Gaps = 24/105 (23%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            AR+SQF NKI SN N     ++++  V+P  ++EPNF+PENE +GYG+YGHESGQL  S 
Sbjct  25   ARESQFLNKISSNYNA----EKKTQVVIPNKEQEPNFLPENENNGYGIYGHESGQLSLST  80

Query  292  TAVNNHAEAEEVPYK---------------KYLPKNYNPVAYVTV  381
            T  N+     E PYK               KYLPKNYN VAYVTV
Sbjct  81   TTTND----VEKPYKEINPTTTLTNNIHNSKYLPKNYNHVAYVTV  121



>ref|XP_009769426.1| PREDICTED: homeobox protein 2-like [Nicotiana sylvestris]
Length=267

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVPLQKEPNFIPENETSGYGLYGHESGQLPPSAT  294
            ARD++FFNKI  +  NN   KE        ++EPNFIPENE +GYG+Y HESGQL PS T
Sbjct  24   ARDNKFFNKI--STTNNGREKETKEGTPNKEQEPNFIPENE-NGYGVYDHESGQLSPSTT  80

Query  295  AVNNHAEAEEVPYKKYLPKNYNPVAYVTV  381
               N+     +P  KYLPKNYNPVAYV V
Sbjct  81   NPTNN-----IPNSKYLPKNYNPVAYVIV  104



>ref|XP_009618543.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
tomentosiformis]
Length=497

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 16/101 (16%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            AR+SQFFNKIP N       ++++  V+P  + EPNF+PENE + YGLYGHESGQLPPS 
Sbjct  25   ARESQFFNKIPGNVVA----EKKTQVVIPNKESEPNFLPENENNVYGLYGHESGQLPPST  80

Query  292  TAVNNHAEA-----------EEVPYKKYLPKNYNPVAYVTV  381
            T  N+  ++             +   KYL KNY+ V YVTV
Sbjct  81   TTTNDVEKSYKEINPTTTLTNNIHNSKYLSKNYDHVVYVTV  121



>ref|XP_006364298.1| PREDICTED: protein E6-like [Solanum tuberosum]
Length=352

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 63/96 (66%), Gaps = 8/96 (8%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            ARD QFFNK+PSNN      ++++ TVVP  ++EPNF+PENE   YGLYGHES   P + 
Sbjct  24   ARDGQFFNKVPSNNG-----EKETQTVVPNKEQEPNFMPENENGAYGLYGHESVSTPSTT  78

Query  292  TAVNNHAEAEEVPY--KKYLPKNYNPVAYVTVPEDN  393
            T   +        +   KYLPKNYNPV+YVTV EDN
Sbjct  79   TTTTHTNNPNVNNFPNSKYLPKNYNPVSYVTVAEDN  114



>gb|EYU43374.1| hypothetical protein MIMGU_mgv1a012195mg [Erythranthe guttata]
Length=259

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVPLQKEPNFIPENETSGYGLYGHESGQLPPSAT  294
            AR++QFFNK  + N NN +         PL  +P+F+PENE +GYGL GH S QLPPSA 
Sbjct  27   ARENQFFNKASTTNTNNDNLVPDDVEKEPLNNQPDFLPENE-NGYGLSGHNSVQLPPSAA  85

Query  295  AVNNHAEAEEVPYKKYLPKNYNPVAYVTVPEDNN  396
                     + P  KYLP+NYNPVAYVT PE  N
Sbjct  86   TT-----ESKRPLPKYLPRNYNPVAYVTEPEATN  114



>dbj|BAM28758.1| ROX1 homologue [Nicotiana benthamiana]
Length=346

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 14/92 (15%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHESGQLPPSA  291
            ARD QFFNK+     + ++ ++Q+ TV+P  ++EPNF+PENE    G YGH+S   P + 
Sbjct  24   ARDGQFFNKV-----SRNNGEKQTQTVIPNKEQEPNFMPENEN---GAYGHDSVTTPNT-  74

Query  292  TAVNNHAEAEEVPYKKYLPKNYNPVAYVTVPE  387
                N+    ++P  KYLPKNYNPV+YVTVPE
Sbjct  75   ----NNPTVHDLPISKYLPKNYNPVSYVTVPE  102



>ref|XP_011096354.1| PREDICTED: protein E6-like [Sesamum indicum]
Length=302

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 57/93 (61%), Gaps = 6/93 (6%)
 Frame = +1

Query  127  QFFNKIPsnnnnnsssKEQSATVVPLQKEPNFIPENETSGYGLYGHESGQLPPSAT----  294
            Q FNK+PS  N N+   +        Q++PNF+P+N  S YGLYGH++G LPPS T    
Sbjct  29   QIFNKVPSTGNKNAVPNDVKEAPNNQQEQPNFLPDNGNS-YGLYGHDTGLLPPSTTTGEP  87

Query  295  -AVNNHAEAEEVPYKKYLPKNYNPVAYVTVPED  390
             + + +    + P  KYLPKNYN VAYVT PE+
Sbjct  88   ASTSLYDTETKQPVHKYLPKNYNTVAYVTEPEE  120



>gb|KJB69506.1| hypothetical protein B456_011G030000 [Gossypium raimondii]
Length=193

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 7/100 (7%)
 Frame = +1

Query  127  QFFNKIPsnnn--nnsssKEQSATVVPLQKEPNFIPENETSGYGLYGHESGQLPPSATAV  300
            +FF+KIPS N      ++KE+  T+   ++EP F+PE + +GYGLYGHESGQLPPS T+ 
Sbjct  25   EFFSKIPSVNTNEKEVTNKEEQTTLGKKEQEPRFVPETQ-NGYGLYGHESGQLPPSTTST  83

Query  301  NNHAEAEEVPYKKYLPKNYNPVAYVTVPEDNNNDDAKFMA  420
                E    P K +  + YN +         NN D+ F +
Sbjct  84   KETYEPYVTPVKYHPDEPYNSIP----ASKTNNKDSYFYS  119



>gb|KJB69505.1| hypothetical protein B456_011G030000 [Gossypium raimondii]
Length=275

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 57/100 (57%), Gaps = 7/100 (7%)
 Frame = +1

Query  127  QFFNKIPs--nnnnnsssKEQSATVVPLQKEPNFIPENETSGYGLYGHESGQLPPSATAV  300
            +FF+KIPS   N    ++KE+  T+   ++EP F+PE + +GYGLYGHESGQLPPS T+ 
Sbjct  25   EFFSKIPSVNTNEKEVTNKEEQTTLGKKEQEPRFVPETQ-NGYGLYGHESGQLPPSTTST  83

Query  301  NNHAEAEEVPYKKYLPKNYNPVAYVTVPEDNNNDDAKFMA  420
                E    P K +  + YN +         NN D+ F +
Sbjct  84   KETYEPYVTPVKYHPDEPYNSIP----ASKTNNKDSYFYS  119



>ref|XP_009343874.1| PREDICTED: protein E6-like [Pyrus x bretschneideri]
Length=343

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 56/113 (50%), Gaps = 26/113 (23%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP------------------LQKEPNFIPENET  240
            AR+SQFF+K+ S+NNNN    E + T  P                   ++EP FIPE + 
Sbjct  25   ARESQFFSKVASSNNNNVKKSELTKTETPKTESPETELPKTESSVFKQEQEPTFIPETQ-  83

Query  241  SGYGLYGHESGQLPPSATAVNNHAEAEEVPYKKYLPKNYNPVAYVTVPEDNNN  399
            +GYGLYGHESGQLPPS ++          PY        N   Y   P +NNN
Sbjct  84   NGYGLYGHESGQLPPSTSSNGG-------PYNTVAATTTNGAPYKYTPNNNNN  129



>ref|XP_010111181.1| hypothetical protein L484_015064 [Morus notabilis]
 gb|EXC30572.1| hypothetical protein L484_015064 [Morus notabilis]
Length=312

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 7/70 (10%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVV-------PLQKEPNFIPENETSGYGLYGHESG  273
            AR +Q FNK+P+ NNN   +   + TVV         ++EP FIP+ + +GYGLYGHE G
Sbjct  24   ARVNQAFNKVPALNNNEKETPTTTTTVVDPKNNNKKEEQEPGFIPDTQNNGYGLYGHEYG  83

Query  274  QLPPSATAVN  303
            QLPPS T  N
Sbjct  84   QLPPSETNTN  93



>ref|XP_002279294.1| PREDICTED: protein E6 [Vitis vinifera]
 emb|CAN60306.1| hypothetical protein VITISV_005068 [Vitis vinifera]
Length=253

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 47/73 (64%), Gaps = 11/73 (15%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSAT----------VVPLQKEPNFIPENETSGYGLYGH  264
            ARDSQFF+K+ + NNNN++ KE+S            +   ++EP F+P+ +  GYGLYGH
Sbjct  25   ARDSQFFSKVTNPNNNNNNVKEESQLPNKEELESKQLKEQEQEPTFVPDTQ-EGYGLYGH  83

Query  265  ESGQLPPSATAVN  303
             SGQLPPS T  N
Sbjct  84   GSGQLPPSTTGNN  96



>ref|XP_007213825.1| hypothetical protein PRUPE_ppa009581mg [Prunus persica]
 gb|EMJ15024.1| hypothetical protein PRUPE_ppa009581mg [Prunus persica]
Length=286

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 46/65 (71%), Gaps = 6/65 (9%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSA--TVVPLQK---EPNFIPENETSGYGLYGHESGQL  279
            AR+SQFF+K+ + NNN +  KE     T  P+++   EP FIPE + SGYGLYGHESGQL
Sbjct  25   ARESQFFSKVANVNNNKNYEKETEVPKTETPVKRQEQEPAFIPETQ-SGYGLYGHESGQL  83

Query  280  PPSAT  294
            PP+ T
Sbjct  84   PPTTT  88



>ref|XP_008441080.1| PREDICTED: protein E6 [Cucumis melo]
Length=302

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +1

Query  181  QSATVVPLQKEPNFIPENETSGYGLYGHESGQLPPSATA  297
            +  T  P  ++PNFIP+ + +GYGLYGHESGQLPP++ +
Sbjct  66   EKTTTSPQDQQPNFIPQTQDNGYGLYGHESGQLPPNSDS  104



>ref|XP_008371412.1| PREDICTED: protein E6-like [Malus domestica]
Length=363

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 38/65 (58%), Gaps = 9/65 (14%)
 Frame = +1

Query  205  QKEPNFIPENETSGYGLYGHESGQLPPSATAVNNHAEAEEVPYKKYLPKNYNPVAYVTVP  384
            +KEP FIPE + +GYGLYGHESGQLPPS T           PY KY P N N + Y    
Sbjct  76   EKEPTFIPETQ-NGYGLYGHESGQLPPSTTTNGE-------PY-KYTPNNNNNLPYTAEA  126

Query  385  EDNNN  399
            E  +N
Sbjct  127  EKQHN  131



>ref|XP_004485829.1| PREDICTED: protein E6-like [Cicer arietinum]
Length=260

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 45/66 (68%), Gaps = 5/66 (8%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsss---KEQSATVVPLQKEPNFIPENETSGYGLYGH-ESGQLP  282
            ARDSQFF+K+  +NNN  +    KE+  T  P Q++P+FIPE E S YGLYGH +S QLP
Sbjct  24   ARDSQFFSKVTHSNNNKETEIPNKEEPITNKPDQQQPHFIPETENS-YGLYGHDDSDQLP  82

Query  283  PSATAV  300
             + TA 
Sbjct  83   STTTAT  88



>ref|XP_007212675.1| hypothetical protein PRUPE_ppa018416mg, partial [Prunus persica]
 gb|EMJ13874.1| hypothetical protein PRUPE_ppa018416mg, partial [Prunus persica]
Length=233

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 7/71 (10%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVPLQK---EPNFIPENETSGYGL---YGHESGQ  276
            AR++QFF+K+ + NN+N+  KE      PL+K   EP FIPE + SGYGL   YGH SGQ
Sbjct  25   ARENQFFSKVANVNNHNNYEKEIPIAETPLKKQEQEPAFIPETQ-SGYGLDGLYGHGSGQ  83

Query  277  LPPSATAVNNH  309
            LPP+ T    H
Sbjct  84   LPPTPTNTVGH  94



>ref|XP_008225146.1| PREDICTED: protein E6 [Prunus mume]
Length=296

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 6/60 (10%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSAT-----VVPLQKEPNFIPENETSGYGLYGHESGQL  279
            AR+SQFF K+ + NNNN+  KE   T     V   ++EP FIPE + SGYGLYGHESGQL
Sbjct  25   ARESQFFRKVANVNNNNNYEKETEVTKTETPVKKQEQEPAFIPETQ-SGYGLYGHESGQL  83



>ref|XP_009772857.1| PREDICTED: probable serine/threonine-protein kinase clkA [Nicotiana 
sylvestris]
Length=388

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 40/53 (75%), Gaps = 5/53 (9%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVP-LQKEPNFIPENETSGYGLYGHES  270
            AR+SQFFNKI SN N     ++++  V+P  ++EPNF+P NE +GYGLYGH++
Sbjct  25   ARESQFFNKISSNYNA----EKKTQVVIPNKEREPNFLPTNENNGYGLYGHDT  73



>ref|XP_004134947.1| PREDICTED: protein E6-like [Cucumis sativus]
 gb|KGN49252.1| hypothetical protein Csa_6G518090 [Cucumis sativus]
Length=302

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  178  EQSATVVPLQKEPNFIPENETSGYGLYGHESGQLPPSATA  297
            E++ T     ++PNFIP+ + +GYGLYGHESGQLPP++ +
Sbjct  62   EKTTTSSQNNQQPNFIPQTQDNGYGLYGHESGQLPPNSNS  101



>ref|XP_004155640.1| PREDICTED: protein E6-like [Cucumis sativus]
Length=301

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +1

Query  178  EQSATVVPLQKEPNFIPENETSGYGLYGHESGQLPPSATA  297
            E++ T     ++PNFIP+ + +GYGLYGHESGQLPP++ +
Sbjct  62   EKTTTSSQNNQQPNFIPQTQDNGYGLYGHESGQLPPNSNS  101



>ref|XP_007159365.1| hypothetical protein PHAVU_002G232100g [Phaseolus vulgaris]
 gb|ESW31359.1| hypothetical protein PHAVU_002G232100g [Phaseolus vulgaris]
Length=362

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 42/65 (65%), Gaps = 3/65 (5%)
 Frame = +1

Query  115  ARDSQFFNKI-PsnnnnnsssKEQSATV-VPLQKEPNFIPENETSGYGLYGHESGQLPPS  288
            AR+SQFF+K+ P NN   +      A++  P Q++P F+P+ E S YGLYGHE+G  PPS
Sbjct  42   ARESQFFSKVTPLNNLKQTEITNNEASLNKPEQQQPVFLPQTENS-YGLYGHETGLHPPS  100

Query  289  ATAVN  303
             T  N
Sbjct  101  TTTTN  105



>ref|XP_009352859.1| PREDICTED: protein E6 [Pyrus x bretschneideri]
Length=311

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 44/77 (57%), Gaps = 16/77 (21%)
 Frame = +1

Query  115  ARDSQFFNKIPsnnnnnsssKEQSATVVPL---------------QKEPNFIPENETSGY  249
            ARDSQFF+K+ S+NNNN    E   T  P                ++EP F+ E + +GY
Sbjct  26   ARDSQFFSKVASSNNNNVKESELPKTESPKTETPKTESPVFNPEKEQEPTFVQETQ-NGY  84

Query  250  GLYGHESGQLPPSATAV  300
            GLYGHESGQLPP+ +  
Sbjct  85   GLYGHESGQLPPATSTT  101



Lambda      K        H        a         alpha
   0.309    0.128    0.369    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520