BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF045B06

Length=635
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ADB03784.1|  catalase                                                381   1e-127   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          377   3e-126   Ipomoea batatas [batate]
gb|ACL27272.1|  catalase                                                342   3e-112   Nicotiana benthamiana
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      342   4e-112   Nicotiana sylvestris
emb|CCP37650.1|  catalase-1                                             342   4e-112   Nicotiana tabacum [American tobacco]
gb|AAB71764.1|  catalase 1                                              341   5e-112   Nicotiana tabacum [American tobacco]
dbj|BAC79443.1|  catalase                                               341   5e-112   Acacia ampliceps
ref|NP_001291326.1|  catalase isozyme 1                                 341   5e-112   Sesamum indicum [beniseed]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      340   1e-111   Solanum tuberosum [potatoes]
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             338   1e-111   
gb|AGC65520.1|  catalase                                                340   2e-111   Eriobotrya japonica [loquat]
gb|AAC84138.1|  catalase                                                328   2e-111   Cichorium intybus [radicchio]
gb|AGE15298.2|  catalase 1                                              339   2e-111   Eriobotrya japonica [loquat]
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             338   3e-111   
gb|AFU48609.1|  catalase 1                                              339   3e-111   Nicotiana benthamiana
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             339   3e-111   Populus trichocarpa [western balsam poplar]
gb|AHF21552.1|  catalase                                                339   3e-111   Hylocereus undatus [dragon fruit]
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               339   4e-111   Ricinus communis
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 339   4e-111   Cucumis melo [Oriental melon]
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      337   6e-111   Nelumbo nucifera [Indian lotus]
ref|NP_001237556.1|  catalase-1/2                                       338   6e-111   Glycine max [soybeans]
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      338   7e-111   Nicotiana tomentosiformis
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                338   8e-111   Erythranthe guttata [common monkey flower]
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             339   9e-111   
gb|ACJ71244.1|  catalase 2                                              334   1e-110   Vigna unguiculata
gb|ACJ71245.1|  catalase 2                                              334   1e-110   Vigna unguiculata
gb|AAF61734.1|AF243519_1  catalase 4                                    338   1e-110   Helianthus annuus
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      337   2e-110   Nelumbo nucifera [Indian lotus]
ref|XP_007018034.1|  Catalase 2                                         337   2e-110   
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      337   2e-110   Fragaria vesca subsp. vesca
gb|KJB17474.1|  hypothetical protein B456_003G002800                    336   2e-110   Gossypium raimondii
ref|XP_010437527.1|  PREDICTED: catalase-2                              337   2e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         337   2e-110   Camelina sativa [gold-of-pleasure]
ref|NP_001235974.1|  catalase-3                                         337   2e-110   Glycine max [soybeans]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          337   2e-110   Amborella trichopoda
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          337   2e-110   Vigna radiata var. radiata [golden gram]
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         337   2e-110   Camelina sativa [gold-of-pleasure]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          337   2e-110   Soldanella alpina
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               337   2e-110   Gossypium hirsutum [American cotton]
gb|KHG12976.1|  Catalase isozyme 2                                      337   3e-110   Gossypium arboreum [tree cotton]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    337   3e-110   Gossypium raimondii
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      337   3e-110   Nicotiana sylvestris
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      337   3e-110   Nicotiana tomentosiformis
emb|CDX72514.1|  BnaC07g45360D                                          336   3e-110   
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             337   3e-110   Phaseolus vulgaris [French bean]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              337   3e-110   Cicer arietinum [garbanzo]
emb|CAA64220.1|  catalase                                               337   3e-110   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234186.1|  catalase isozyme 2                                 337   4e-110   
gb|AAK96854.1|  catalase                                                336   4e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           336   4e-110   Sesamum indicum [beniseed]
gb|ADZ45556.1|  catalase                                                336   4e-110   Vigna radiata [mung bean]
gb|ADZ45555.1|  catalase                                                336   4e-110   Vigna radiata [mung bean]
ref|NP_195235.1|  catalase 2                                            336   4e-110   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031791.1|  catalase 2                                         336   4e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           336   4e-110   
dbj|BAH19523.1|  AT4G35090                                              336   4e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KJB14250.1|  hypothetical protein B456_002G115900                    336   5e-110   Gossypium raimondii
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             336   5e-110   
gb|AET97564.1|  catalase                                                336   5e-110   Ziziphus jujuba [Chinese jujube]
gb|AIX10947.1|  putative catalase                                       336   6e-110   Gardenia jasminoides
ref|XP_002521709.1|  catalase, putative                                 336   6e-110   Ricinus communis
gb|KEH36313.1|  catalase heme-binding enzyme                            334   6e-110   Medicago truncatula
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         336   7e-110   Tarenaya hassleriana [spider flower]
gb|AAD17933.1|  catalase                                                336   7e-110   Brassica juncea [brown mustard]
gb|AAF71742.1|AF248491_1  catalase                                      336   7e-110   Raphanus sativus
gb|ABF93811.1|  Catalase-1, putative, expressed                         332   7e-110   Oryza sativa Japonica Group [Japonica rice]
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               336   7e-110   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              336   7e-110   Populus euphratica
gb|ACA50528.1|  putative catalase 2                                     336   7e-110   Brassica napus [oilseed rape]
dbj|BAJ33995.1|  unnamed protein product                                336   7e-110   Eutrema halophilum
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    335   7e-110   
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             335   7e-110   Eutrema salsugineum [saltwater cress]
gb|AAD17935.1|  catalase                                                335   8e-110   Brassica juncea [brown mustard]
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             336   8e-110   Eutrema salsugineum [saltwater cress]
gb|KFK30147.1|  catalase                                                335   8e-110   Arabis alpina [alpine rockcress]
gb|AFN81243.1|  catalase 1                                              335   8e-110   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_009138342.1|  PREDICTED: catalase-2                              335   9e-110   Brassica rapa
ref|XP_007046520.1|  Catalase 2                                         335   1e-109   Theobroma cacao [chocolate]
ref|XP_010530333.1|  PREDICTED: catalase-2                              335   1e-109   Tarenaya hassleriana [spider flower]
ref|NP_001289779.1|  catalase isozyme 1                                 335   1e-109   Nelumbo nucifera [Indian lotus]
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       335   1e-109   Triticum aestivum [Canadian hard winter wheat]
emb|CAE82295.1|  catalase                                               335   1e-109   Homogyne alpina
gb|KHG25152.1|  Catalase isozyme 1                                      335   1e-109   Gossypium arboreum [tree cotton]
gb|AAF61733.1|AF243518_1  catalase 3                                    335   1e-109   Helianthus annuus
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         335   1e-109   Jatropha curcas
gb|AAR84577.1|  catalase 1b                                             333   2e-109   Lotus japonicus
gb|AIA61608.1|  catalase                                                335   2e-109   Gynostemma pentaphyllum [jiaogulan]
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     334   2e-109   Eucalyptus grandis [rose gum]
ref|XP_002301920.1|  catalase family protein                            335   2e-109   Populus trichocarpa [western balsam poplar]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 335   2e-109   Populus euphratica
emb|CAI43948.1|  catalase                                               335   2e-109   Populus deltoides
gb|AAC19397.1|  leaf catalase                                           334   2e-109   Mesembryanthemum crystallinum
ref|NP_001237571.1|  catalase-4                                         334   2e-109   Glycine max [soybeans]
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                334   3e-109   Erythranthe guttata [common monkey flower]
gb|ABM47415.1|  catalase                                                334   3e-109   Prunus avium [gean]
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 334   3e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|AJE26131.1|  catalase                                                334   3e-109   Salix matsudana [tortured willow]
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      334   3e-109   Cucumis melo [Oriental melon]
gb|AAD17936.1|  catalase                                                334   3e-109   Brassica juncea [brown mustard]
gb|AIZ77475.1|  catalase                                                334   3e-109   Triticum aestivum [Canadian hard winter wheat]
gb|ACB11496.1|  catalase                                                334   3e-109   Pinus sylvestris [Scotch pine]
gb|ADC95629.1|  catalase                                                334   3e-109   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             334   3e-109   Capsella rubella
gb|ACJ11733.1|  catalase                                                334   3e-109   Gossypium hirsutum [American cotton]
gb|AAR84578.1|  catalase 1a                                             334   4e-109   Lotus japonicus
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       334   4e-109   Cucumis sativus [cucumbers]
gb|AFU90823.1|  catalase                                                332   4e-109   Populus x beijingensis
emb|CDX69111.1|  BnaC01g03420D                                          333   4e-109   
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      333   5e-109   Prunus mume [ume]
ref|NP_001240021.1|  catalase                                           333   5e-109   Glycine max [soybeans]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      333   6e-109   
gb|KEH36312.1|  catalase heme-binding enzyme                            333   6e-109   Medicago truncatula
gb|AAB62892.1|  catalase-1                                              333   6e-109   Nicotiana glutinosa
gb|EPS69543.1|  catalase                                                333   6e-109   Genlisea aurea
prf||1906388A  catalase                                                 333   6e-109
gb|AAX88799.1|  catalase                                                333   7e-109   Euphorbia characias
emb|CDP07287.1|  unnamed protein product                                333   7e-109   Coffea canephora [robusta coffee]
tpg|DAA43177.1|  TPA: catalase2                                         333   7e-109   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              334   7e-109   Brassica rapa
gb|KJB57963.1|  hypothetical protein B456_009G187600                    333   7e-109   Gossypium raimondii
gb|ABK24453.1|  unknown                                                 333   8e-109   Picea sitchensis
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       330   8e-109   Cucumis sativus [cucumbers]
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      333   9e-109   Solanum lycopersicum
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          333   9e-109   Amborella trichopoda
gb|AAO17721.1|  catalase                                                333   1e-108   Hypericum perforatum
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      333   1e-108   
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             333   1e-108   Prunus persica
emb|CAD42908.1|  catalase                                               333   1e-108   Prunus persica
gb|AFU90822.1|  catalase                                                332   1e-108   Populus tomentosa [Chinese white poplar]
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              332   1e-108   
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              333   1e-108   
gb|ACV92695.1|  catalase                                                333   1e-108   Brassica oleracea
gb|AAD50974.1|AF170272_1  catalase CAT1                                 332   1e-108   Manihot esculenta [manioc]
ref|NP_001048861.1|  Os03g0131200                                       332   1e-108   
ref|XP_010692546.1|  PREDICTED: catalase                                332   1e-108   Beta vulgaris subsp. vulgaris [field beet]
gb|AHB72694.1|  catalase                                                332   2e-108   Beta vulgaris subsp. maritima [sea beet]
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         332   2e-108   Tarenaya hassleriana [spider flower]
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 331   2e-108   
ref|XP_002306976.2|  catalase family protein                            332   2e-108   
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         332   2e-108   Oryza brachyantha
dbj|BAA34714.1|  catalase                                               332   2e-108   Oryza sativa [red rice]
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 332   2e-108   Solanum tuberosum [potatoes]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      332   2e-108   Musa acuminata subsp. malaccensis [pisang utan]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               332   2e-108   Gossypium hirsutum [American cotton]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      332   3e-108   Populus euphratica
gb|AGV54297.1|  peroxisomal catalase                                    332   3e-108   Phaseolus vulgaris [French bean]
gb|ABV55108.1|  catalase 2                                              332   3e-108   Musa acuminata AAA Group [Cavendish banana]
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 330   3e-108   
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             332   3e-108   
dbj|BAH37035.1|  catalase 1                                             332   3e-108   Pisum sativum [garden pea]
dbj|BAJ90861.1|  predicted protein                                      332   3e-108   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFD29285.1|  catalase                                                332   3e-108   Vicia faba [broad bean]
ref|XP_010094556.1|  Catalase isozyme 1                                 331   3e-108   Morus notabilis
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             331   3e-108   Phaseolus vulgaris [French bean]
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      331   4e-108   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACH63223.1|  catalase                                                331   4e-108   Rheum australe [Himalayan rhubarb]
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    331   4e-108   Arabis alpina [alpine rockcress]
gb|ABY21704.1|  catalase-1 precursor                                    331   4e-108   Panax ginseng [Asiatic ginseng]
emb|CAA45564.1|  catalase                                               331   4e-108   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA43178.1|  TPA: catalase2                                         332   5e-108   
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      331   5e-108   Vitis vinifera
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      331   6e-108   
gb|ACL35349.1|  catalase                                                331   6e-108   Picea glauca
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 330   8e-108   Vitis vinifera
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      330   8e-108   Elaeis guineensis
ref|XP_003558892.1|  PREDICTED: catalase-1                              330   9e-108   Brachypodium distachyon [annual false brome]
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 330   1e-107   
ref|NP_001268098.1|  catalase                                           330   1e-107   Vitis vinifera
ref|XP_009106100.1|  PREDICTED: catalase-2                              330   1e-107   Brassica rapa
emb|CAG23920.1|  catalase                                               330   1e-107   Festuca arundinacea [tall fescue]
gb|KCW68093.1|  hypothetical protein EUGRSUZ_F01775                     327   1e-107   Eucalyptus grandis [rose gum]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 330   1e-107   Phoenix dactylifera
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      330   2e-107   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHF27433.1|  catalase                                                330   2e-107   Cucurbita maxima [Boston marrow]
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 330   2e-107   Eucalyptus grandis [rose gum]
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      329   2e-107   Phoenix dactylifera
gb|ADU56199.1|  catalase                                                329   2e-107   Hevea brasiliensis [jebe]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              329   2e-107   
gb|AAF19965.1|AF207906_1  catalase 1                                    329   2e-107   Zantedeschia aethiopica [arum-lily]
gb|AIS20825.1|  CAT                                                     329   3e-107   Pyrus x bretschneideri [bai li]
dbj|BAA34205.1|  catalase                                               329   3e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      330   3e-107   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAB86582.2|  catalase                                                329   3e-107   Raphanus sativus
emb|CDX76313.1|  BnaA08g10870D                                          328   3e-107   
emb|CDY17510.1|  BnaC03g65530D                                          328   3e-107   Brassica napus [oilseed rape]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             329   4e-107   Citrus clementina [clementine]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      329   4e-107   Citrus sinensis [apfelsine]
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      328   4e-107   Elaeis guineensis
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      328   4e-107   Phoenix dactylifera
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               328   4e-107   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         328   4e-107   Setaria italica
gb|AHF27430.1|  catalase                                                328   5e-107   Cucurbita moschata [ayote]
ref|XP_001784759.1|  predicted protein                                  328   5e-107   
emb|CDP01803.1|  unnamed protein product                                328   5e-107   Coffea canephora [robusta coffee]
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             328   5e-107   Eutrema salsugineum [saltwater cress]
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      328   6e-107   Phoenix dactylifera
gb|ADM96039.1|  catalase                                                328   6e-107   Cucumis sativus [cucumbers]
gb|AAK67359.2|AF390210_1  catalase                                      328   7e-107   Suaeda salsa
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      328   7e-107   Cucumis melo [Oriental melon]
gb|ABB51561.1|  truncated catalase 2                                    326   7e-107   Avicennia marina
gb|AAG61140.2|AF332973_1  catalase 2                                    328   7e-107   Zantedeschia aethiopica [arum-lily]
ref|XP_010061175.1|  PREDICTED: catalase-like                           328   8e-107   Eucalyptus grandis [rose gum]
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 328   8e-107   Prunus mume [ume]
emb|CDY52649.1|  BnaAnng11640D                                          327   8e-107   Brassica napus [oilseed rape]
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             328   9e-107   Prunus persica
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      328   9e-107   Eucalyptus grandis [rose gum]
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          328   9e-107   Helianthus annuus
emb|CAD42909.1|  catalase                                               328   9e-107   Prunus persica
ref|XP_009103333.1|  PREDICTED: catalase-1                              328   9e-107   Brassica rapa
emb|CDY01363.1|  BnaA07g11360D                                          328   9e-107   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             327   1e-106   Selaginella moellendorffii
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            327   1e-106   Pisum sativum [garden pea]
ref|XP_001752315.1|  predicted protein                                  327   1e-106   
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              328   1e-106   Populus euphratica
emb|CDY31877.1|  BnaC07g15270D                                          327   2e-106   Brassica napus [oilseed rape]
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               327   2e-106   Cucurbita pepo
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      327   2e-106   
gb|AFR53082.1|  CAT                                                     327   2e-106   Anthurium andraeanum [flamingo-lily]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          327   2e-106   Avicennia marina
gb|ACL81498.1|  catalase                                                327   3e-106   Ginkgo biloba [ginkgo]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     329   3e-106   Eucalyptus grandis [rose gum]
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      327   3e-106   
gb|AAM97542.1|  catalase 3                                              326   3e-106   Capsicum annuum
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               326   4e-106   Cucurbita pepo
gb|AIP93616.1|  CAT1                                                    326   4e-106   Bassia scoparia [burning bush]
gb|AHA50082.1|  catalase                                                326   5e-106   Eleutherococcus senticosus
gb|AAM97541.1|  catalase 2                                              325   6e-106   Capsicum annuum
prf||2104177A  catalase                                                 325   6e-106
ref|XP_006416379.1|  hypothetical protein EUTSA_v10007795mg             323   7e-106   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 325   7e-106   Phoenix dactylifera
gb|AAF61732.1|AF243517_1  catalase 2                                    325   1e-105   Helianthus annuus
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 325   1e-105   Elaeis guineensis
gb|ACJ76836.3|  catalase                                                325   1e-105   Dimocarpus longan [longan]
gb|AGI65617.1|  catalase                                                324   1e-105   Fragaria x ananassa
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 325   2e-105   Tarenaya hassleriana [spider flower]
prf||1803522A  catalase                                                 324   2e-105
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         324   2e-105   Tarenaya hassleriana [spider flower]
ref|XP_009149539.1|  PREDICTED: catalase-3                              326   2e-105   Brassica rapa
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               324   2e-105   Zea mays [maize]
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               324   3e-105   Zea mays [maize]
gb|AAG43363.1|AF151368_1  catalase                                      324   3e-105   Hevea brasiliensis [jebe]
ref|NP_973873.1|  catalase 3                                            322   3e-105   Arabidopsis thaliana [mouse-ear cress]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               323   4e-105   Cucurbita pepo
gb|AGT16310.1|  catalase                                                323   4e-105   Saccharum hybrid cultivar R570
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             323   5e-105   Capsella rubella
gb|AII23739.1|  catalase                                                322   6e-105   Zostera marina
ref|XP_001696763.1|  catalase/peroxidase                                323   7e-105   Chlamydomonas reinhardtii
gb|AAB70006.1|  catalase                                                323   7e-105   Chlamydomonas reinhardtii
gb|AIU99487.1|  catalase                                                323   7e-105   Saccharum hybrid cultivar ROC22
gb|AAD30291.2|AF139538_1  catalase 2                                    323   8e-105   Raphanus sativus
emb|CDY29519.1|  BnaA06g14510D                                          323   9e-105   Brassica napus [oilseed rape]
gb|AAD30292.1|AF139539_1  catalase 3                                    323   9e-105   Raphanus sativus
gb|AAC17731.1|  catalase 1                                              322   1e-104   Arabidopsis thaliana [mouse-ear cress]
gb|AFW66787.1|  catalase3                                               322   1e-104   
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          322   1e-104   
gb|AHZ13843.1|  catalase                                                322   1e-104   Saccharum hybrid cultivar Yacheng05-179
gb|AAM65021.1|  unknown                                                 322   1e-104   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH56915.1|  AT1G20620                                              322   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031073.1|  catalase 3                                         322   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564121.1|  catalase 1                                            322   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564120.1|  catalase 3                                            322   1e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CDY33636.1|  BnaC08g19360D                                          322   1e-104   Brassica napus [oilseed rape]
gb|AAC19398.1|  root catalase                                           322   1e-104   Mesembryanthemum crystallinum
dbj|BAJ88747.1|  predicted protein                                      323   1e-104   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009110221.1|  PREDICTED: catalase-3                              322   1e-104   Brassica rapa
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         322   1e-104   Brassica rapa
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 335   1e-104   
gb|ADU56198.1|  catalase                                                322   1e-104   Musa acuminata AAA Group [Cavendish banana]
gb|AFW66788.1|  catalase3                                               322   1e-104   
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    322   1e-104   Arabis alpina [alpine rockcress]
gb|AIU99480.1|  catalase                                                322   1e-104   Saccharum spontaneum [fodder cane]
gb|ACJ22771.1|  catalase 1                                              322   1e-104   Jatropha curcas
emb|CDY31878.1|  BnaC07g15280D                                          322   2e-104   Brassica napus [oilseed rape]
gb|AIU99488.1|  catalase                                                322   2e-104   Saccharum hybrid cultivar ROC22
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               322   2e-104   Zea mays [maize]
ref|NP_001105415.1|  catalase isozyme 1                                 322   2e-104   
ref|NP_001241808.1|  catalase isozyme B                                 322   2e-104   Zea mays [maize]
ref|NP_001105310.1|  catalase isozyme 2                                 321   3e-104   
emb|CDY01364.1|  BnaA07g11370D                                          323   3e-104   
gb|AIM43584.1|  catalase                                                321   4e-104   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      321   4e-104   
gb|AIU99486.1|  catalase                                                321   4e-104   
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      322   4e-104   
gb|ADQ28492.1|  catalase                                                321   5e-104   
gb|AIU99481.1|  catalase                                                320   6e-104   
gb|AAB07026.1|  catalase 1                                              320   7e-104   
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 320   7e-104   
ref|XP_002950455.1|  catalase                                           320   7e-104   
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    320   8e-104   
ref|NP_001058635.1|  Os06g0727200                                       320   8e-104   
gb|AIU99479.1|  catalase                                                320   9e-104   
ref|XP_002510677.1|  catalase, putative                                 332   1e-103   
emb|CAA42720.1|  catalase-1                                             320   1e-103   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    320   1e-103   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         319   2e-103   
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               319   2e-103   
ref|XP_010477308.1|  PREDICTED: catalase-1                              319   2e-103   
ref|XP_010498496.1|  PREDICTED: catalase-3                              318   3e-103   
emb|CAA73663.1|  catalase                                               318   4e-103   
dbj|BAA34204.1|  catalase                                               318   4e-103   
gb|ABN71233.2|  catalase                                                318   4e-103   
ref|NP_001045673.1|  Os02g0115700                                       318   5e-103   
ref|XP_010692544.1|  PREDICTED: catalase-like                           318   6e-103   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           318   6e-103
gb|AFW66785.1|  catalase3 isoform 1                                     324   6e-103   
emb|CDY29518.1|  BnaA06g14520D                                          318   6e-103   
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 318   6e-103   
ref|XP_009149540.1|  PREDICTED: catalase-1                              318   7e-103   
emb|CDY31490.1|  BnaC05g15990D                                          318   7e-103   
gb|AAY59707.1|  catalase                                                318   8e-103   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 319   8e-103   
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 318   8e-103   
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      318   8e-103   
emb|CAH61266.1|  catalase                                               318   9e-103   
gb|AIU99483.1|  catalase                                                317   9e-103   
dbj|BAJ92414.1|  predicted protein                                      317   1e-102   
gb|ADY02963.1|  catalase                                                317   1e-102   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               317   1e-102   
gb|AIU99484.1|  catalase                                                317   2e-102   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             317   2e-102   
gb|AEQ30070.1|  catalase                                                317   2e-102   
emb|CDY40645.1|  BnaA03g53180D                                          317   2e-102   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             314   2e-102   
gb|AAC49807.1|  catalase 3                                              317   2e-102   
gb|AIU99482.1|  catalase                                                317   2e-102   
gb|AAP80622.1|AF475100_1  catalase isozyme                              308   3e-102   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      316   3e-102   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         316   3e-102   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      316   3e-102   
gb|AIU99485.1|  catalase                                                316   4e-102   
ref|XP_001779509.1|  predicted protein                                  316   4e-102   
gb|ABK41476.1|  catalase                                                315   5e-102   
emb|CAA43814.1|  catalase                                               315   5e-102   
gb|ABK24543.1|  unknown                                                 315   5e-102   
emb|CDP07288.1|  unnamed protein product                                315   6e-102   
gb|AGT16054.1|  catalase                                                315   7e-102   
gb|AGT16188.1|  catalase                                                315   8e-102   
ref|XP_005645077.1|  catalase                                           315   8e-102   
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             315   8e-102   
dbj|BAA05494.1|  catalase                                               315   9e-102   
gb|AGT16203.1|  catalase                                                315   1e-101   
emb|CDY31488.1|  BnaC05g15970D                                          315   1e-101   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               314   2e-101   
gb|EMT05040.1|  Catalase-1                                              315   2e-101   
gb|AGT15888.1|  catalase                                                313   5e-101   
gb|ABK24449.1|  unknown                                                 313   7e-101   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         312   1e-100   
gb|EMS51034.1|  Catalase isozyme 2                                      312   1e-100   
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          311   2e-100   
gb|AJF34884.1|  catalase                                                311   2e-100   
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          311   2e-100
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    311   3e-100   
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               311   3e-100   
ref|NP_001274863.1|  catalase isozyme 1                                 311   3e-100   
gb|ADN94253.1|  catalase                                                311   3e-100   
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               311   4e-100   
ref|NP_001234827.1|  catalase isozyme 1                                 310   5e-100   
gb|EMS61345.1|  Catalase isozyme 1                                      314   5e-100   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          310   8e-100   
gb|ABC01913.1|  catalase isozyme 1-like protein                         310   1e-99    
gb|AAR97905.1|  catalase                                                309   2e-99    
gb|AAR14052.2|  catalase                                                308   2e-99    
emb|CAA85470.1|  catalase                                               308   2e-99    
ref|XP_011396830.1|  Catalase isozyme 2                                 308   4e-99    
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 306   2e-98    
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        306   2e-98    
gb|ABB72796.1|  catalase isozyme 1-like protein                         306   2e-98    
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      306   3e-98    
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      306   4e-98    
ref|NP_001105416.1|  catalase isozyme 3                                 306   4e-98    
dbj|BAF91369.1|  catalase                                               305   1e-97    
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    305   1e-97    
gb|EMT06167.1|  Catalase isozyme 2                                      310   1e-97    
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             304   1e-97    
gb|ABB88582.1|  catalase                                                304   1e-97    
gb|AAF79625.1|AC027665_26  F5M15.5                                      316   3e-97    
dbj|BAQ21275.1|  catalase                                               302   4e-97    
gb|AAC48918.1|  salicylic acid binding catalase                         302   7e-97    
ref|XP_002890395.1|  F5M15.5                                            314   7e-97    
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               301   2e-96    
gb|KDD77132.1|  catalase                                                301   3e-96    
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     299   2e-95    
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                297   5e-95    
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   298   4e-94    
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          289   1e-91    
emb|CBI29557.3|  unnamed protein product                                277   2e-91    
ref|XP_005708279.1|  catalase                                           283   3e-89    
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          280   2e-88    
gb|AHG98056.1|  catalase                                                273   9e-88    
gb|ADI58890.1|  catalase                                                266   3e-87    
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              275   1e-86    
gb|ADR01107.1|  catalase 3                                              270   5e-86    
gb|AHF27432.1|  catalase                                                273   9e-86    
dbj|BAH20307.1|  AT1G20620                                              271   3e-85    
gb|AHF27429.1|  catalase                                                271   4e-85    
ref|XP_011022275.1|  PREDICTED: catalase-like                           269   4e-84    
ref|XP_005536240.1|  catalase                                           268   1e-83    
gb|ABR16304.1|  unknown                                                 257   1e-79    
gb|AAL38024.1|AF443179_1  catalase                                      247   1e-78    
gb|AIR77003.1|  catalase                                                249   2e-78    
gb|AEB22071.1|  catalase 2                                              243   4e-78    
gb|ACJ71242.1|  catalase 1                                              240   6e-76    
gb|ADU56189.1|  catalase 1                                              233   2e-74    
gb|AAD37788.1|AF149283_1  catalase 1                                    239   3e-73    
ref|XP_005642928.1|  catalase                                           239   2e-72    
ref|XP_005647994.1|  catalase-domain-containing protein                 239   3e-72    
gb|AII80275.1|  catalase                                                233   6e-72    
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg             227   3e-71    
gb|AEG89525.1|  catalase                                                231   5e-71    
ref|XP_005644653.1|  catalase-domain-containing protein                 236   1e-70    
emb|CAB16750.1|  catalase                                               226   4e-70    
gb|ACJ71243.1|  catalase 2                                              220   3e-68    
gb|EJF09706.1|  catalase                                                226   3e-67    
ref|WP_040574212.1|  catalase                                           226   4e-67    
gb|KJB10391.1|  hypothetical protein B456_001G198700                    224   4e-67    
gb|ACY30463.1|  catalase                                                221   5e-67    
ref|XP_005712277.1|  unnamed protein product                            223   3e-66    
gb|AEA86312.1|  catalase isozyme                                        213   7e-66    
emb|CAC37634.1|  catalase 1                                             216   1e-65    
dbj|GAE06714.1|  catalase                                               213   5e-65    
ref|WP_035405433.1|  catalase                                           219   6e-65    
gb|KFK81701.1|  catalase family protein                                 209   3e-64    
emb|CAB56850.1|  catalase                                               216   4e-64    
ref|WP_034700019.1|  catalase                                           218   4e-64    
gb|AAO12509.1|  catalase                                                208   5e-64    
gb|AEQ94083.1|  putative catalase                                       212   5e-64    
ref|WP_036667842.1|  catalase                                           217   6e-64    
ref|WP_015737807.1|  catalase                                           217   6e-64    
ref|WP_018976489.1|  catalase                                           217   6e-64    
ref|WP_009590324.1|  catalase                                           217   6e-64    
ref|WP_036662024.1|  catalase                                           217   7e-64    
ref|WP_006207005.1|  catalase                                           216   9e-64    
ref|WP_036640075.1|  catalase                                           216   1e-63    
ref|WP_036612802.1|  catalase                                           216   1e-63    
ref|WP_025606320.1|  catalase                                           217   1e-63    
ref|WP_024632816.1|  MULTISPECIES: catalase                             216   1e-63    
ref|WP_002978792.1|  catalase                                           216   2e-63    
ref|XP_006380544.1|  hypothetical protein POPTR_0007s08910g             209   3e-63    
gb|AFC01205.1|  catalase                                                209   3e-63    
gb|AAC39465.1|  catalase 3                                              202   8e-63    
emb|CAP74531.1|  putative Td650 protein                                 207   8e-63    
gb|AIM05077.1|  catalase                                                204   9e-63    
ref|WP_011983963.1|  catalase                                           214   9e-63    
ref|WP_028402967.1|  catalase                                           214   9e-63    
ref|WP_044186614.1|  catalase                                           214   1e-62    
ref|WP_017691823.1|  catalase                                           214   1e-62    
ref|WP_007128851.1|  catalase                                           214   1e-62    
ref|WP_025027035.1|  catalase                                           213   1e-62    
ref|WP_032086373.1|  catalase                                           213   1e-62    
ref|WP_031421259.1|  catalase                                           213   1e-62    
gb|AAN78323.1|  catalase1                                               204   1e-62    
ref|WP_029335752.1|  catalase                                           213   2e-62    
ref|WP_024371859.1|  catalase                                           213   2e-62    
ref|WP_015881004.1|  catalase                                           213   2e-62    
ref|WP_026975362.1|  catalase                                           213   2e-62    
ref|WP_028404102.1|  catalase                                           213   2e-62    
ref|WP_037289104.1|  catalase                                           213   2e-62    
ref|WP_027091399.1|  catalase                                           213   2e-62    
ref|WP_036709507.1|  catalase                                           213   3e-62    
ref|WP_002617638.1|  catalase                                           213   3e-62    
ref|WP_021066643.1|  MULTISPECIES: catalase                             213   3e-62    
ref|WP_038700758.1|  catalase                                           213   3e-62    
ref|WP_034776647.1|  catalase                                           212   3e-62    
ref|WP_016508130.1|  catalase                                           212   4e-62    
ref|WP_017674668.1|  catalase                                           212   4e-62    
ref|WP_034804389.1|  catalase                                           212   4e-62    
ref|WP_034817708.1|  catalase                                           212   4e-62    
ref|WP_038335781.1|  catalase                                           213   5e-62    
ref|WP_043068684.1|  catalase                                           212   5e-62    
ref|WP_001069182.1|  MULTISPECIES: catalase                             212   5e-62    
ref|WP_002162341.1|  catalase                                           212   6e-62    
ref|WP_019973735.1|  catalase                                           212   6e-62    
ref|WP_018669668.1|  catalase                                           211   7e-62    
ref|WP_035435964.1|  catalase                                           211   8e-62    
ref|WP_003470096.1|  catalase                                           211   9e-62    
ref|XP_004366029.2|  catalase isozyme 2                                 213   1e-61    
ref|WP_043393481.1|  catalase                                           211   1e-61    
gb|AAS40190.1|  catalase                                                210   1e-61    
emb|CDP01802.1|  unnamed protein product                                210   1e-61    
ref|WP_011246134.1|  catalase                                           211   1e-61    
ref|WP_035957730.1|  catalase                                           211   1e-61    
ref|WP_032818224.1|  hypothetical protein                               202   1e-61    
ref|WP_001069151.1|  catalase                                           211   1e-61    
ref|WP_026826608.1|  catalase                                           211   2e-61    
ref|WP_020060313.1|  catalase                                           211   2e-61    
ref|WP_001069184.1|  MULTISPECIES: catalase                             210   2e-61    
ref|WP_042982436.1|  catalase                                           210   2e-61    
ref|WP_016088914.1|  catalase                                           210   2e-61    
ref|WP_003355010.1|  catalase                                           210   2e-61    
ref|WP_001069185.1|  catalase                                           210   2e-61    
ref|WP_001069183.1|  catalase                                           210   2e-61    
ref|WP_043936623.1|  MULTISPECIES: catalase                             210   2e-61    
ref|WP_001069181.1|  MULTISPECIES: catalase                             210   2e-61    
ref|WP_042542372.1|  hypothetical protein                               202   2e-61    
ref|WP_001069175.1|  catalase                                           210   2e-61    
ref|WP_023521416.1|  catalase                                           210   2e-61    
ref|WP_001069180.1|  MULTISPECIES: catalase                             210   2e-61    
ref|WP_038413367.1|  catalase                                           210   2e-61    
ref|WP_035160169.1|  catalase                                           211   2e-61    
ref|WP_039314934.1|  catalase                                           211   2e-61    



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/185 (98%), Positives = 183/185 (99%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHL+EKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLIEKIQNFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVKMYTREGN+DLVGNNFPVFFIRDG QFPDVIHAFKPNPKSHIQENWRILDYLSHLP
Sbjct  121  GFAVKMYTREGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  180

Query  619  ESLNT  633
            ESLNT
Sbjct  181  ESLNT  185



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/185 (97%), Positives = 182/185 (98%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDPSKYRPSSSFNTPFCTTN GAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP
Sbjct  1    MDPSKYRPSSSFNTPFCTTNSGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVKMYTR GN+DLVGNNFPVFFIRDG QFPDVIHAFKPNPKSHIQENWRILDYLSHLP
Sbjct  121  GFAVKMYTRGGNWDLVGNNFPVFFIRDGTQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  180

Query  619  ESLNT  633
            ESLNT
Sbjct  181  ESLNT  185



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   342 bits (876),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   342 bits (876),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   342 bits (876),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   341 bits (875),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   341 bits (875),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/185 (88%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FNTPF TTN G PV+NN  ALT+GSRGPILLEDYHLVEKI NFTRER P
Sbjct  1    MDPYKYRPSSTFNTPFWTTNSGTPVYNNDSALTIGSRGPILLEDYHLVEKIANFTRERTP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+LD+ S+LP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHIQEYWRVLDFCSYLP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   341 bits (875),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   340 bits (873),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_006382987.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382988.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382989.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60784.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60785.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60786.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=434

 Score =   338 bits (867),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   340 bits (871),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  619  ESLNT  633
            ESL T
Sbjct  181  ESLLT  185



>gb|AAC84138.1| catalase [Cichorium intybus]
Length=182

 Score =   328 bits (842),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RPSS++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNSPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEXWRILDFLSHHP  180

Query  619  ES  624
            ES
Sbjct  181  ES  182



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVGSRGP+LLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVWNNNSSLTVGSRGPVLLEDYHLIEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  619  ESLNT  633
            ESL T
Sbjct  181  ESLLT  185



>ref|XP_006382990.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382991.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60787.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60788.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=455

 Score =   338 bits (867),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   339 bits (870),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = +1

Query  82   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  261
            DP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RER+PE
Sbjct  1    DPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPILLEDYHLVEKLANFDRERVPE  60

Query  262  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  441
            RVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  442  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  621
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPE  180

Query  622  SLN  630
            SL+
Sbjct  181  SLH  183



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   339 bits (870),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSFNT F TTN GAPVWNNT A+T+G RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNTTFWTTNSGAPVWNNTSAMTIGQRGPVLLEDYHLIEKITNFHRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ER+VHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+LD+ SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGMKFPDVIHAFKPNPKSHIQEYWRVLDFCSHHP  180

Query  619  ESLNT  633
            ESLNT
Sbjct  181  ESLNT  185



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   339 bits (869),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP + RPSS FNTPF TTN GAPVWNN  +LTVGSRGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPDV+HAFKPNPKSH+QENWRI D+LSH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHLQENWRIFDFLSHVP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   339 bits (869),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RPSS++NTPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKQRPSSAYNTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010242895.1| PREDICTED: catalase isozyme 1-like isoform X2 [Nelumbo nucifera]
Length=433

 Score =   337 bits (863),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   338 bits (868),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   338 bits (867),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 173/184 (94%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+ FCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSTFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|EYU36566.1| hypothetical protein MIMGU_mgv1a005245mg [Erythranthe guttata]
Length=492

 Score =   338 bits (867),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_006382986.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60783.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=519

 Score =   339 bits (869),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/184 (86%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ACJ71244.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   334 bits (857),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ACJ71245.1| catalase 2, partial [Vigna unguiculata]
Length=394

 Score =   334 bits (857),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAF61734.1|AF243519_1 catalase 4 [Helianthus annuus]
Length=492

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/185 (85%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RPSS+++TPF TTN GAPV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYDTPFWTTNAGAPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  619  ESLNT  633
            ESLNT
Sbjct  181  ESLNT  185



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF +TN GAPVWNN  +LTVG+RGPI+LEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWSTNSGAPVWNNNSSLTVGTRGPIMLEDYHLVEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_004300681.1| PREDICTED: catalase isozyme 1 [Fragaria vesca subsp. vesca]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|KJB17474.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=451

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RPSS+FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 173/185 (94%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+PF TTN GAPVWN+  +LTVGSRGPILLEDYHL+EK+ +FTRER P
Sbjct  1    MDPYKYRPSSAYNSPFMTTNAGAPVWNDDSSLTVGSRGPILLEDYHLIEKLAHFTRERTP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ER+VHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQENWRILD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDPMKFPDVIHAFKPNPKSHIQENWRILDFLSHHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLST  185



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYR SS+FNTPF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAFNTPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   337 bits (864),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSF++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFMTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   336 bits (862),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RPS++FN+PF TTN GAP+WNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSTAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+ DG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   337 bits (863),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RERI 
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIA  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDIAHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|NP_001031791.1| catalase 2 [Arabidopsis thaliana]
 gb|AEE86463.1| catalase 2 [Arabidopsis thaliana]
Length=474

 Score =   336 bits (861),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPS +FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSRAFNSPFMTTNSGAPVWNNNDSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>dbj|BAH19523.1| AT4G35090 [Arabidopsis thaliana]
Length=474

 Score =   336 bits (861),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   336 bits (862),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+P+ TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   336 bits (861),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FNTPF TTN G PVWNN  ALTVG+RGPILLEDYHLVEK+ N+TRERIP
Sbjct  1    MDPYKFRPSSAFNTPFWTTNAGGPVWNNDSALTVGTRGPILLEDYHLVEKLANWTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPD IHA KPNPKSHIQE+WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVRDAMKFPDSIHALKPNPKSHIQESWRILDFFSHLP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLST  185



>ref|XP_002521709.1| catalase, putative [Ricinus communis]
 gb|EEF40696.1| catalase, putative [Ricinus communis]
Length=492

 Score =   336 bits (861),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTH+I+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|KEH36313.1| catalase heme-binding enzyme [Medicago truncatula]
Length=430

 Score =   334 bits (856),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+ DG  FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   336 bits (861),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   336 bits (861),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   336 bits (861),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|ABF93811.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
Length=382

 Score =   332 bits (851),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   336 bits (861),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+ N+PF TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   336 bits (861),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   336 bits (861),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKSYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   336 bits (861),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_010063132.1| PREDICTED: LOW QUALITY PROTEIN: catalase isozyme 1-like [Eucalyptus 
grandis]
Length=490

 Score =   335 bits (860),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   335 bits (860),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   335 bits (860),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_006412154.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53607.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=518

 Score =   336 bits (862),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   335 bits (860),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   335 bits (860),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   335 bits (860),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPV+NN  +L+VG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYNNNSSLSVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSS N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSSHNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPS++F++PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSTAFDSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>emb|CAE82295.1| catalase [Homogyne alpina]
Length=492

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RP+S++N+PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPASAYNSPFLTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  619  ESLNT  633
            ESLNT
Sbjct  181  ESLNT  185



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAF61733.1|AF243518_1 catalase 3 [Helianthus annuus]
Length=492

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/185 (85%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RPSS++N PF TTN G PV+NNT +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKQRPSSAYNAPFWTTNAGLPVYNNTASLTVGNRGPILLEDYHLIEKLANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ER+VHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERIVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPTIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA K YTREGNFD+VGNNFPVFF RD   FPDVIHAFKPNPKSHIQE+WRILD+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDAMAFPDVIHAFKPNPKSHIQEDWRILDFLSHHP  180

Query  619  ESLNT  633
            ESLNT
Sbjct  181  ESLNT  185



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   335 bits (859),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQESWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AAR84577.1| catalase 1b [Lotus japonicus]
 gb|AAR84579.1| catalase 1b [Lotus japonicus]
Length=449

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKNRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDIT+LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|KCW70315.1| hypothetical protein EUGRSUZ_F03557 [Eucalyptus grandis]
Length=479

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FNT F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPHKYRPSSAFNTSFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYFTTNSGAPVYNNNSSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   334 bits (857),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFMTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLR PGVQTP+IVRFSTVIHERGSPE+IRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRGPGVQTPVIVRFSTVIHERGSPESIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   334 bits (857),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+F+TPF TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDTPFWTTNSGAPVWNNDSSLTVGSRGPVLLEDYHLVEKLATFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQENWRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQENWRILDFFSHLP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   334 bits (857),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSNYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   334 bits (857),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+F+TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFSTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNFGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AIZ77475.1| catalase, partial [Triticum aestivum]
Length=490

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKYRPSSAYNSPFWTTNAGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRA GVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAAGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+PF T N GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTANSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNMPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+H+TCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHVTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNNSMTVGVRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP ++RPSS +NTPF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSGYNTPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDIT+L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   332 bits (852),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = +1

Query  82   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  261
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  262  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  441
            RVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  442  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  621
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  622  SLN  630
            SL+
Sbjct  181  SLH  183



>emb|CDX69111.1| BnaC01g03420D [Brassica napus]
Length=480

 Score =   333 bits (855),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK+YT EGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKLYTGEGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   333 bits (855),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   333 bits (855),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKLRPSSAFNSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|KEH36312.1| catalase heme-binding enzyme [Medicago truncatula]
Length=492

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS++N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+ DG  FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVHDGMNFPDMVHALKPNPKSHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PFCTTN GAP  NN   LTVG+RG +LLEDYHLVEK+ NF RER+P
Sbjct  1    MDPYKYRPSSAFNSPFCTTNSGAPEKNNNSYLTVGARGLVLLEDYHLVEKLANFDRERVP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|EPS69543.1| catalase [Genlisea aurea]
Length=492

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNHSLTVGTRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLT ADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTSADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNP+SHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPRSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>prf||1906388A catalase
Length=492

 Score =   333 bits (854),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AAX88799.1| catalase [Euphorbia characias]
Length=493

 Score =   333 bits (854),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSGFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFF+VTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFQVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   333 bits (854),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GA VWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPCKYRPSSAFNSPFWTTNSGASVWNNNSSLTVGTRGPVLLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>tpg|DAA43177.1| TPA: catalase2 [Zea mays]
Length=493

 Score =   333 bits (854),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_009108682.1| PREDICTED: catalase-2-like isoform X1 [Brassica rapa]
Length=514

 Score =   334 bits (856),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   333 bits (854),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAP+WNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   333 bits (854),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|KGN55500.1| hypothetical protein Csa_4G658600 [Cucumis sativus]
Length=405

 Score =   330 bits (846),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  88   SKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERV  267
            S  RPSS+F+TPF TTN GAPVWNN  ALT+GSRGPILLEDYHLVEK+ NF RERIPERV
Sbjct  3    SHQRPSSAFDTPFWTTNSGAPVWNNNSALTIGSRGPILLEDYHLVEKLANFDRERIPERV  62

Query  268  VHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFA  447
            VHARGA+AKGFFEVTHDITHLTCADFLRAPG QTP+IVRFSTVIHERGSPET+RDPRGFA
Sbjct  63   VHARGASAKGFFEVTHDITHLTCADFLRAPGTQTPVIVRFSTVIHERGSPETLRDPRGFA  122

Query  448  VKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESL  627
            VK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL
Sbjct  123  VKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESL  182

Query  628  N  630
            +
Sbjct  183  H  183



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   333 bits (853),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   333 bits (853),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNCPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++H+ KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHSLKPNPKTHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPV++N  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVYSNDHSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFP FF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+F++PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = +1

Query  82   DPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPE  261
            DP KYRPSS+F TP+ TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPE
Sbjct  1    DPYKYRPSSAFGTPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPE  60

Query  262  RVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRG  441
            RVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRG
Sbjct  61   RVVHARGASAKGFFEVTHDISGLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRG  120

Query  442  FAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPE  621
            FAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PE
Sbjct  121  FAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPE  180

Query  622  SLN  630
            SL+
Sbjct  181  SLH  183



>ref|XP_009108684.1| PREDICTED: catalase-2-like isoform X3 [Brassica rapa]
Length=474

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF T N GAPVWNN   +TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTANSGAPVWNNNSPMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENW +LD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWGVLDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSS NTPF TT+ GAPVWNN  ++TVG+RGPILLEDYH++EK+ NFTRERIP
Sbjct  1    MDPCKFRPSSSNNTPFWTTDAGAPVWNNNSSMTVGTRGPILLEDYHMIEKLANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGMSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA K YTREGNFD+VGNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WRI D+LSH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRIFDFLSHHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLST  185



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010692546.1| PREDICTED: catalase [Beta vulgaris subsp. vulgaris]
Length=492

 Score =   332 bits (852),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR++D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AHB72694.1| catalase [Beta vulgaris subsp. maritima]
Length=492

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ N P+CTTN GAPVWNN  +LTV  RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNAPYCTTNSGAPVWNNNSSLTVSHRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADF+RAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFMRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR++D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVMDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   332 bits (852),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHSSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHER SPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERASPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_008348922.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=445

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  619  ESLNT  633
            ESL T
Sbjct  181  ESLLT  185



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>dbj|BAA34714.1| catalase [Oryza sativa]
Length=492

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKGRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+LSH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFLSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+ N+PF TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAANSPFMTTNSGAPVYNNNSSLTVGTRGPILLEDYHLLEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS++N+PF TTN GAPVWNN  ++TVGSRGPILLEDYHLVEKI  F RERIP
Sbjct  1    MDPYKFRPSSNYNSPFWTTNSGAPVWNNNASITVGSRGPILLEDYHLVEKIAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVG RG  LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGQYLLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+P+ TTN GA VWNN  +LTVGSRGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPYWTTNSGASVWNNNSSLTVGSRGPILLEDYHLVEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ABV55108.1| catalase 2 [Musa acuminata AAA Group]
Length=492

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+QE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHVQEYWRVFDFLSHHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>ref|XP_008382478.1| PREDICTED: catalase isozyme 1-like [Malus domestica]
Length=453

 Score =   330 bits (846),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNAGAPVSNNNSSLTVGPRGPVLLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFF+RD  +FPDVIHAFKPNPKSHIQE WR+LD+LSH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFVRDAMKFPDVIHAFKPNPKSHIQEYWRVLDFLSHHP  180

Query  619  ESLNT  633
            ESL T
Sbjct  181  ESLLT  185



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/180 (86%), Positives = 169/180 (94%), Gaps = 0/180 (0%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  270
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  3    QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  62

Query  271  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  450
            HARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  63   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  122

Query  451  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  630
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  123  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  182



>dbj|BAH37035.1| catalase 1 [Pisum sativum]
Length=494

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>dbj|BAJ90861.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSFN+P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKHRPSSSFNSPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWR+LD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AFD29285.1| catalase [Vicia faba]
Length=494

 Score =   332 bits (850),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFFTTNSGAPVWNNNSSLTVGQRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQEFWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   331 bits (849),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPV+NN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVYNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFF+RDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPKNHIQENWRILDFFSHFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_009398521.1| PREDICTED: catalase isozyme A [Musa acuminata subsp. malaccensis]
Length=492

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSF+T F TTN GAPVWN+  ALTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTVGSRGPILLEDYHLVEKIAHFARERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+QE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHVQEYWRVFDFLSHHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>gb|ACH63223.1| catalase [Rheum australe]
Length=492

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ ++P+ TTN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKFRPSSAHDSPYWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKIVNFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AK FFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKVFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|KFK44176.1| hypothetical protein AALP_AA1G224400 [Arabis alpina]
Length=492

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP ++RPSS+ ++PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRFRPSSANDSPFFTTNSGAPVWNNNSSLTVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ABY21704.1| catalase-1 precursor [Panax ginseng]
Length=492

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP ++RPSS+FN+ + TTN GAPVWNN  +LTVG+RGPILLEDY LVEKI NF RERIP
Sbjct  1    MDPYQHRPSSAFNSSYWTTNSGAPVWNNNSSLTVGTRGPILLEDYQLVEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIMDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RG ILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGLILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIH RGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHARGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDIVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>tpg|DAA43178.1| TPA: catalase2 [Zea mays]
Length=531

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   331 bits (849),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THDI++LTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISNLTCADFLRAPGVQTPVILRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   331 bits (848),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP ++RPSS+FN+PF TTN GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HL CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLXCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFP FF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPXFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ACL35349.1| catalase [Picea glauca]
Length=492

 Score =   331 bits (848),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS++N+PF TTN GAPVWNN  +LT+GSRGPILLEDYHLVEKI  F RER+P
Sbjct  1    MDPYKHRPSSAYNSPFWTTNSGAPVWNNNSSLTIGSRGPILLEDYHLVEKIAQFDRERVP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCAD LRAPGVQTPLIVRFSTVIHERGSPET RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADLLRAPGVQTPLIVRFSTVIHERGSPETPRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEDWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   330 bits (847),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE WR++D+LS+ P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSYHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLST  185



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   330 bits (847),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGIRGPILLEDYHVIEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   330 bits (847),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVG RGPILLEDYHLVEKI NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPMWSTNSGAPVWNNDNSLTVGPRGPILLEDYHLVEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNNFPVFF+RD  QFPDVI AFKPNPKSHIQE WRILD+ S+ P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHIQEPWRILDFCSYHP  180

Query  619  ESL  627
            ESL
Sbjct  181  ESL  183



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 172/185 (93%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+P+ TTN GAPV+NN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNSPYFTTNAGAPVYNNDSSLTVGSRGPVLLEDYHLVEKLANFQRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE WR++D+LS+ P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFIRDAMKFPDVIHAFKPNPKSHIQEYWRVVDFLSYHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLST  185



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHIQENWR++D+ S  P
Sbjct  121  GFAVKFYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSPHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEKI +F RERIP
Sbjct  1    MDPYKYRPSSSFNGPQWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA+K YTREGN+DL GNNFPVFFIRDG +FPD++HA KPNPK+HIQENWR+LD+ SH P
Sbjct  121  GFAIKFYTREGNWDLAGNNFPVFFIRDGMKFPDMVHALKPNPKTHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|KCW68093.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=399

 Score =   327 bits (838),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLST  185



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVT+D++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTNDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHSLKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_009392261.1| PREDICTED: catalase isozyme A-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=492

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/183 (84%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  619  ESL  627
            ESL
Sbjct  181  ESL  183



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   330 bits (845),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLIEKLANFERERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD IHAFKPNPKS+IQE WRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFFSHQP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLST  185



>ref|XP_008812256.1| PREDICTED: catalase isozyme B [Phoenix dactylifera]
Length=478

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ N PF TTN GAPVWNN  +LTVGSRGP+ LEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPVFLEDYHLIEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSH+QENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHLQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ADU56199.1| catalase [Hevea brasiliensis]
Length=492

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ N+ F TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNSSFFTTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA++KGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASSKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQE WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKSHIQETWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  270
            ++RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  6    QHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  65

Query  271  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  450
            HARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  66   HARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  125

Query  451  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  630
            K YTREGNFDLVGNNFPVFF+ DG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  126  KFYTREGNFDLVGNNFPVFFVHDGMKFPDMVHALKPNPKSHIQENWRILDFFSHFPESLH  185



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   329 bits (844),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP + RPSS+FN+PF TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPK+HIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKTHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   329 bits (843),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+PF TTN GAPV NN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPFWTTNSGAPVSNNNSSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HL+CADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLSCADFLRAPGVQTPVIVRFSTVIHEHGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   329 bits (843),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSFN P  +TN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKHRPSSSFNGPLWSTNSGAPVWNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
             FA+K YTREGN+DLVGNNFPVFFIRDG +FPD++H+ KPNPKSH+QENWRILD+ SH P
Sbjct  121  VFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHVQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_009392260.1| PREDICTED: catalase isozyme A-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSF+T F TTN GAPVWN+  ALT+GSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKFRPSSSFDTNFTTTNAGAPVWNDDQALTMGSRGPILLEDYHLIEKVAHFARERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THD+THL+CADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLSCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   329 bits (843),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 170/184 (92%), Gaps = 1/184 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRP+SS+N+PF T N GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPASSYNSPFFT-NSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  59

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  120  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  179

Query  619  ESLN  630
            ESLN
Sbjct  180  ESLN  183



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  270
            +YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  2    QYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVV  61

Query  271  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  450
            HARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  62   HARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  121

Query  451  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  630
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH PESLN
Sbjct  122  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLN  181



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  270
            +YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  2    QYRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVV  61

Query  271  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  450
            HARGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAV
Sbjct  62   HARGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAV  121

Query  451  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  630
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH PESLN
Sbjct  122  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHPESLN  181



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   329 bits (843),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RP+SSFN PF TTN GAPVWNN  ++T+G RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPASSFNAPFFTTNSGAPVWNNNSSMTIGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD+++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP ++RPSS+ N PF TTN GAPVWNN  +LTVGSRGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYRHRPSSTHNAPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHVIEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSLTVGTRGPILLEDYHVIEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  100  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  279
            PSS+FN+PFCTTN GAPV+NN  +LTVG+RGP+LLEDYHLVEK+ NF RER+PERVVHAR
Sbjct  1    PSSAFNSPFCTTNSGAPVFNNNSSLTVGARGPVLLEDYHLVEKLANFDRERVPERVVHAR  60

Query  280  GATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  459
            GA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  61   GASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  460  TREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  630
            TREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH+PESL+
Sbjct  121  TREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHVPESLH  177



>ref|XP_004985840.1| PREDICTED: catalase-1-like [Setaria italica]
Length=492

 Score =   328 bits (842),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 154/184 (84%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+ N P  +TN GAPVW+N  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAHNGPHWSTNSGAPVWSNDHSLTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWR+LD+ SH P
Sbjct  121  GFAVKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVLDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   328 bits (842),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++NTPFCTTN GAPVWNNT  +++G RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSIGERGPILLEDYQLIEKIATFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  619  ESL  627
            ESL
Sbjct  181  ESL  183



>ref|XP_001784759.1| predicted protein [Physcomitrella patens]
 gb|EDQ50419.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   328 bits (842),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS +NTPF TTN G+PVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYNTPFWTTNQGSPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPE IRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPEAIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNN PVFFIRDG +FPD+IHA KPNPKSHIQE WRI+D+ SH+P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEAWRIMDFFSHVP  180

Query  619  ESLN  630
            ES N
Sbjct  181  ESCN  184



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   328 bits (842),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS++N+ F TTN GAPVWNN  +LTVGSRGP+LLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAYNSTFFTTNSGAPVWNNNSSLTVGSRGPVLLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRTPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_006416378.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
 gb|ESQ34731.1| hypothetical protein EUTSA_v10007472mg [Eutrema salsugineum]
Length=492

 Score =   328 bits (842),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP ++RPSS+ ++PF TTN GAPVWNN  +L+VG+RGPILLEDYHL+EKI NF RERIP
Sbjct  1    MDPYRHRPSSAHDSPFFTTNSGAPVWNNNSSLSVGTRGPILLEDYHLLEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+I RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIARFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   328 bits (841),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSSF+T + TTN G PVWN+  ALTVG+RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSSFDTTYTTTNAGGPVWNDDQALTVGARGPILLEDYHLIEKIAHFARERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+I+RFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPIILRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   328 bits (841),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++NTPFCTTN GAPVWNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPVWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKG FEVTHD++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGLFEVTHDVSDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNNFPVFF+RD  QFPDVI AFKPNPKSHIQE WRILD+ S+ P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHIQEPWRILDFCSYHP  180

Query  619  ESL  627
            ESL
Sbjct  181  ESL  183



>gb|AAK67359.2|AF390210_1 catalase [Suaeda salsa]
Length=492

 Score =   328 bits (841),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ N+P+ T N GAPVWNN  +LTVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSANNSPYFTANSGAPVWNNNNSLTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR+PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   328 bits (841),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/183 (83%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISDLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFP+VI AFKPNPKSHIQE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPEVIRAFKPNPKSHIQEPWRFLDFCSYHP  180

Query  619  ESL  627
            ESL
Sbjct  181  ESL  183



>gb|ABB51561.1| truncated catalase 2 [Avicennia marina]
Length=424

 Score =   326 bits (835),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KY PSSSFNTP  TTNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FTRERIP
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHIQESWRILDFCSHFP  180

Query  619  ESLNT  633
            ESL T
Sbjct  181  ESLLT  185



>gb|AAG61140.2|AF332973_1 catalase 2 [Zantedeschia aethiopica]
Length=492

 Score =   328 bits (841),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSSS++  F TTN G PVWN+  ALTVGSRGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPCKYRPSSSYDASFTTTNAGGPVWNDDVALTVGSRGPILLEDYHLIEKVAHFARERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THD+THLT ADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTFADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKS++QE WR+LD+LSHLP
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSNVQEYWRVLDFLSHLP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   328 bits (840),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF RERIP
Sbjct  1    MDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   328 bits (840),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   327 bits (837),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 166/179 (93%), Gaps = 0/179 (0%)
 Frame = +1

Query  94   YRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVH  273
            YRP+SS+N+PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIPERVVH
Sbjct  43   YRPASSYNSPFFTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIPERVVH  102

Query  274  ARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVK  453
            ARGA+AKGFFEVTHDI++LTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPRGFAVK
Sbjct  103  ARGASAKGFFEVTHDISNLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVK  162

Query  454  MYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  630
             YTREGNFDLVGNN PVFFIRDG +FPD++HA KPNPKSHIQENWR++D+ SH PESLN
Sbjct  163  FYTREGNFDLVGNNIPVFFIRDGMKFPDMVHALKPNPKSHIQENWRVMDFFSHHPESLN  221



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   328 bits (840),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   328 bits (840),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLST  185



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   328 bits (840),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDIT LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQE+WRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQEDWRIMDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   328 bits (840),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+F++P+ TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFDSPYWTTNAGAPVWNNDSSLTVGPRGPVLLEDYHLVEKLATFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  +FPD I AFKPNPKSHIQE WRILD+ SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMKFPDAIRAFKPNPKSHIQETWRILDFFSHLP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>ref|XP_009103333.1| PREDICTED: catalase-1 [Brassica rapa]
Length=492

 Score =   328 bits (840),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>emb|CDY01363.1| BnaA07g11360D [Brassica napus]
Length=492

 Score =   328 bits (840),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_002980247.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
 gb|EFJ18507.1| hypothetical protein SELMODRAFT_178171 [Selaginella moellendorffii]
Length=492

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N+   TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSAYNSAHFTTNTGAPVWNNNASLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNNFPVFF+RDG +FPD++HA KPNP++HIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDMVGNNFPVFFVRDGMKFPDMVHALKPNPRTHIQENWRIMDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>sp|P25890.1|CATA_PEA RecName: Full=Catalase [Pisum sativum]
 emb|CAA42736.1| catalase [Pisum sativum]
Length=494

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKHRPSSAFNSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFF+ DG  FPD++HA KPNP++HIQENWRILD+  + P
Sbjct  121  GFAVKFYTREGNYDLVGNNFPVFFVHDGMNFPDMVHALKPNPQTHIQENWRILDFFYNFP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_001752315.1| predicted protein [Physcomitrella patens]
 gb|EDQ83048.1| predicted protein [Physcomitrella patens]
Length=492

 Score =   327 bits (839),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS ++TPF TTN GAPVWNN  +LTVG RGP+LLEDYHLVEK+  F RERIP
Sbjct  1    MDPYKYRPSSQYDTPFWTTNQGAPVWNNNNSLTVGPRGPVLLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNN PVFFIRDG +FPD+IHA KPNPKSHIQE WRI+D+ SH+P
Sbjct  121  GFAVKFYTREGNFDMVGNNIPVFFIRDGIKFPDMIHALKPNPKSHIQEPWRIMDFFSHVP  180

Query  619  ESLN  630
            E+ N
Sbjct  181  EACN  184



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/180 (85%), Positives = 168/180 (93%), Gaps = 0/180 (0%)
 Frame = +1

Query  91   KYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVV  270
            +YRPSSS+N+PF TTN GAPVWNN  +LTVGSRGPILLEDYHLVEK+ NF RERIPERVV
Sbjct  24   QYRPSSSYNSPFFTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVV  83

Query  271  HARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAV  450
            HARGA+AKGFFEVT+DI+HLTCADFLRAPGVQTP+IVRFSTVIHE GSPET+RDPRGFAV
Sbjct  84   HARGASAKGFFEVTNDISHLTCADFLRAPGVQTPVIVRFSTVIHELGSPETLRDPRGFAV  143

Query  451  KMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  630
            K YTREGNFDLVGNNFPVFFIRDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  144  KFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  203



>emb|CDY31877.1| BnaC07g15270D [Brassica napus]
Length=492

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP + RPSS+ ++PF TTN GAPVWNN  +LT G+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYRVRPSSAHDSPFFTTNSGAPVWNNNSSLTAGTRGPILLEDYHLLEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLR PGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITHLTCADFLRGPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/183 (83%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVH RGA+AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHRRGASAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQEPWRYLDFCSYHP  180

Query  619  ESL  627
            ESL
Sbjct  181  ESL  183



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+F+T + TTN G PVWN+  ALTVGSRGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFDTAYTTTNAGGPVWNDDQALTVGSRGPILLEDYHLIEKIAHFARERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THD+T+LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>gb|AFR53082.1| CAT [Anthurium andraeanum]
Length=492

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 171/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++++ F TTN G PVWN+  ALT+G+RGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPYKYRPSSAYDSNFTTTNAGGPVWNDDVALTIGTRGPILLEDYHLIEKVAHFARERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNP+S+IQE WR+LD LSHLP
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSNIQEYWRVLDILSHLP  180

Query  619  ESLNT  633
            ES++T
Sbjct  181  ESMHT  185



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KY PSSSFNTP  TTNGG PV+N+  +LTVG+RGP+LLEDY L++K+ +FTRERIP
Sbjct  1    MDPYKYCPSSSFNTPHTTTNGGHPVYNDNSSLTVGTRGPVLLEDYQLIDKLAHFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGATAKGFFEVTHD++HLTCADFLRAPGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNNFPVFFIRD  +FPDVIHAFKPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDIVGNNFPVFFIRDAIKFPDVIHAFKPNPKSHIQESWRILDFCSHFP  180

Query  619  ESLNT  633
            ESL T
Sbjct  181  ESLLT  185



>gb|ACL81498.1| catalase [Ginkgo biloba]
Length=492

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS++N+P+CTTN GAPVWNNT +LT+G+RGP+LLEDYHL+EK+  FTRERIP
Sbjct  1    MDPYKHRPSSAYNSPYCTTNQGAPVWNNTSSLTLGNRGPVLLEDYHLIEKLSVFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLR+PGVQTPLIVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRSPGVQTPLIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNN PVFF RD  QFPDVI A KPNPK+HIQE WR LDYLSHLP
Sbjct  121  GFAVKFYTREGNFDIVGNNIPVFFTRDAIQFPDVIRALKPNPKTHIQEPWRYLDYLSHLP  180

Query  619  ES  624
            ES
Sbjct  181  ES  182



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   329 bits (844),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  67   PLISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTR  246
            P  +MDP KYRPSS+ ++ F TTN GAPVWNN  +LTVG+RGP+LLEDYHL+EKI NF R
Sbjct  89   PPTAMDPYKYRPSSAHDSSFWTTNSGAPVWNNNASLTVGTRGPVLLEDYHLLEKIANFDR  148

Query  247  ERIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETI  426
            ERIPERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+
Sbjct  149  ERIPERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETL  208

Query  427  RDPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYL  606
            RDPRGFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ 
Sbjct  209  RDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRIVDFF  268

Query  607  SHLPESLN  630
            SH PESL+
Sbjct  269  SHHPESLH  276



>ref|XP_010061173.1| PREDICTED: catalase isozyme 2-like isoform X1 [Eucalyptus grandis]
Length=496

 Score =   327 bits (837),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++++ F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYDSSFWTTNYGAPVWNNDSSLTVGTRGPILLEDYHLLEKLANFERERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVG NFPVFFIRD  +FPD IHAFKPNPKS+IQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDLVGINFPVFFIRDAMKFPDAIHAFKPNPKSNIQEMWRIIDFLSHQP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLST  185



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   326 bits (836),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ N+P+ TTN GAPV+NN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAANSPYWTTNSGAPVYNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDIT LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITRLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   326 bits (836),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/183 (81%), Positives = 166/183 (91%), Gaps = 0/183 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++NTPFCTTN GAP+WNNT  ++VG RGPILLEDY L+EKI  FTRERIP
Sbjct  1    MDPYKYRPSSAYNTPFCTTNSGAPIWNNTAVMSVGERGPILLEDYQLIEKIATFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++ L+CADFLRAPGVQTP+IVRFSTVIHER SPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSDLSCADFLRAPGVQTPVIVRFSTVIHERVSPETVRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RD  QFPDVI AFKPNPKSH+QE+WR LD+ S+ P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDAMQFPDVIRAFKPNPKSHLQESWRFLDFCSYHP  180

Query  619  ESL  627
            ESL
Sbjct  181  ESL  183



>gb|AIP93616.1| CAT1 [Bassia scoparia]
Length=492

 Score =   326 bits (836),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ N+P  TTN GAPVWN+  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKFRPSSAHNSPHFTTNSGAPVWNDNSSMTVGHRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THDI+HLTCADFLR+PGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFETTHDISHLTCADFLRSPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRIMDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AHA50082.1| catalase [Eleutherococcus senticosus]
Length=492

 Score =   326 bits (835),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS+FN+P+ TTN GAP WNN  +LTVG+RGPILLEDY LVE I NF RERIP
Sbjct  1    MDPYKYRPSSAFNSPYWTTNSGAPAWNNNSSLTVGTRGPILLEDYQLVEIIANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFS VIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISKLTCADFLRAPGVQTPVIVRFSIVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KP+PKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPSPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +1

Query  103  SSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHARG  282
            SS+FN+PFCTTN GAPVWNN  +LTVG+RGP+LLEDYHLVEK+ NF RERI ERVVHARG
Sbjct  1    SSAFNSPFCTTNSGAPVWNNNSSLTVGARGPVLLEDYHLVEKLANFDRERIAERVVHARG  60

Query  283  ATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMYT  462
            A+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK YT
Sbjct  61   ASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYT  120

Query  463  REGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  630
            REGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQENWR+LD+ SH PESL+
Sbjct  121  REGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQENWRVLDFFSHHPESLH  176



>prf||2104177A catalase
Length=492

 Score =   325 bits (834),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYR SS++N PF TTN GAPV+NN  +LTVGSRGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYKYRSSSAYNAPFWTTNSGAPVYNNNNSLTVGSRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDIT LTCADFLRAPGVQTP+IVR STVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITALTCADFLRAPGVQTPVIVRLSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPD++H+ KPNPKSHIQE+WRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHSLKPNPKSHIQEDWRIMDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_006416379.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
 gb|ESQ34732.1| hypothetical protein EUTSA_v10007795mg [Eutrema salsugineum]
Length=405

 Score =   323 bits (827),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  619  ESLNT  633
            ESL T
Sbjct  181  ESLLT  185



>ref|XP_008778560.1| PREDICTED: catalase isozyme 2-like [Phoenix dactylifera]
Length=482

 Score =   325 bits (833),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/185 (83%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+F+  + TTN GAPVWN+  ALTVG RGPILLEDYHL+EKI +F RERIP
Sbjct  1    MDPYKFRPSSAFDPTYTTTNAGAPVWNDDQALTVGPRGPILLEDYHLIEKIAHFARERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THD+THLTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSHIQE WR+ D+LSH P
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHIQEYWRVFDFLSHHP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>gb|AAF61732.1|AF243517_1 catalase 2 [Helianthus annuus]
Length=492

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N PF TTN GAPV+NN  +LTVG+RGPILLEDYH VEK+ NF RERIP
Sbjct  1    MDPYKYRPSSAYNAPFWTTNYGAPVYNNDSSLTVGTRGPILLEDYHFVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+ LTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISALTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++H+ KPNPKSHIQE+WRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHSLKPNPKSHIQEDWRILDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   325 bits (833),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+ N+PF TTN GAPVWNN  +LTVG+RGPILLEDYH++EK+  F RERIP
Sbjct  1    MDPYKFRPSSANNSPFWTTNSGAPVWNNNSSLTVGNRGPILLEDYHVIEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFL APGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLHAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFVRDGIKFPDMVHALKPNPKSHIQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   325 bits (832),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K  PSS+FN PF TTN GAPVWN+  ALTVG RGP+LLEDYHLVEK+ +F RER P
Sbjct  1    MDPYKPIPSSNFNAPFMTTNAGAPVWNDDNALTVGKRGPVLLEDYHLVEKLAHFARERTP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+I+RFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPIILRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRD  +FPDV+HAFKPNPKSHIQE+WRILD+ +H+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDAIKFPDVVHAFKPNPKSHIQESWRILDFCAHIP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLST  185



>gb|AGI65617.1| catalase, partial [Fragaria x ananassa]
Length=467

 Score =   324 bits (830),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  100  PSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIPERVVHAR  279
            PSS++++PF TTN GAPVWNN  +LT+G+RGPILLEDYHLVEK+ NF RERIPERVVHAR
Sbjct  1    PSSAYDSPFWTTNSGAPVWNNNSSLTIGARGPILLEDYHLVEKLANFDRERIPERVVHAR  60

Query  280  GATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPRGFAVKMY  459
            GA+AKGFFEVTHDI+HLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPRGFAVK Y
Sbjct  61   GASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFY  120

Query  460  TREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLPESLN  630
            TREGNFDLVGNNFPVFF+RDG +FPD++HA KPNPKSHIQENWRILD+ SH PESL+
Sbjct  121  TREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLH  177



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSS ++P+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDSPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RD R
Sbjct  61   ERVVHARGFSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETMRDIR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA K YTREGNFDLVGNNFPVFF RDG QFPD IHA KPNP ++IQENWRILDY SH P
Sbjct  121  GFATKFYTREGNFDLVGNNFPVFFTRDGVQFPDTIHALKPNPVTNIQENWRILDYFSHFP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>prf||1803522A catalase
Length=491

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  179

Query  619  ESLN  630
            ESL+
Sbjct  180  ESLH  183



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/185 (81%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSSS +TP+ TTNGGAPV+NN  +LTVG+RGPILLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKFRPSSSHDTPYYTTNGGAPVYNNISSLTVGTRGPILLEDYHLIEKVANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARG +AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RD R
Sbjct  61   ERVVHARGFSAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETMRDIR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFA K YTREGNFD+VGNNFPVFF RDG QFPD IHA KPNP ++IQENWRILDY SH P
Sbjct  121  GFATKFYTREGNFDIVGNNFPVFFTRDGVQFPDTIHALKPNPVTNIQENWRILDYFSHFP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +1

Query  70   LISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRE  249
             I+MDP KYRPSS++N+PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRE
Sbjct  49   FITMDPYKYRPSSAYNSPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRE  108

Query  250  RIPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIR  429
            RIPERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+R
Sbjct  109  RIPERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMR  168

Query  430  DPRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLS  609
            D RGFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+S
Sbjct  169  DIRGFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMS  228

Query  610  HLPESLNT  633
            HLPESL T
Sbjct  229  HLPESLLT  236



>sp|P12365.3|CATA2_MAIZE RecName: Full=Catalase isozyme 2 [Zea mays]
 emb|CAA38588.1| catalase [Zea mays]
Length=491

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS+FN P+ TTN GAPVWNN  +LTVG+RGPILLEDYH  EK+ NF RERIP
Sbjct  1    MDPYKHRPSSAFNAPYWTTNSGAPVWNNDSSLTVGARGPILLEDYH-CEKLANFDRERIP  59

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDITHLTCADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  60   ERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  119

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DLVGNNFPVFFIRDG +FPD++HA KPNP++HIQ+NWRILD+ SH P
Sbjct  120  GFAVKFYTREGNWDLVGNNFPVFFIRDGIKFPDMVHALKPNPRTHIQDNWRILDFFSHHP  179

Query  619  ESLN  630
            ESL+
Sbjct  180  ESLH  183



>sp|P18123.2|CATA3_MAIZE RecName: Full=Catalase isozyme 3 [Zea mays]
 gb|AAC37357.1| catalase [Zea mays]
Length=496

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/187 (80%), Positives = 171/187 (91%), Gaps = 0/187 (0%)
 Frame = +1

Query  73   ISMDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRER  252
            ++MDP+K+RPSSS +T   TTN GAPVWN+  ALTVG RGPILLEDYHL+EK+ +F RER
Sbjct  1    MTMDPTKFRPSSSHDTTVTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEKVAHFARER  60

Query  253  IPERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRD  432
            IPERVVHARGA+AKGFFE THD+T LTCADFLRAPGV+TP+IVRFSTVIHERGSPETIRD
Sbjct  61   IPERVVHARGASAKGFFECTHDVTSLTCADFLRAPGVRTPVIVRFSTVIHERGSPETIRD  120

Query  433  PRGFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSH  612
            PRGFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNP+SH+QE WR+ D+LSH
Sbjct  121  PRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPRSHVQEYWRVFDFLSH  180

Query  613  LPESLNT  633
            LPESL+T
Sbjct  181  LPESLHT  187



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   324 bits (830),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K  PS+++N  F TTN GAPVWNN  +LTVG+RGPILLEDYHL+EK+ NF RERIP
Sbjct  1    MDPYKNLPSNAYNCSFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLLEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTH+++ LTCADFLRAPGVQTP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFEVTHNVSQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +FPDV+HAFKPNPKSHIQE+WRI D+LSH+P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPKSHIQESWRIFDFLSHVP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>ref|NP_973873.1| catalase 3 [Arabidopsis thaliana]
 gb|AEE29994.1| catalase 3 [Arabidopsis thaliana]
Length=427

 Score =   322 bits (824),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  619  ESLNT  633
            ESL T
Sbjct  181  ESLLT  185



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   323 bits (829),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP ++RPSS+FN PF TTN GAPVWNN  ++TVG RGPILLEDYHLVEK+ NF RERIP
Sbjct  1    MDPYRHRPSSAFNAPFWTTNSGAPVWNNNSSMTVGPRGPILLEDYHLVEKLANFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDIT+L+CADFLRAPGVQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDITNLSCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFFIRDG +F   +H  KPNPKSHIQENWRILD+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFTRHVHPLKPNPKSHIQENWRILDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>gb|AGT16310.1| catalase [Saccharum hybrid cultivar R570]
Length=493

 Score =   323 bits (829),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP+K+RPSSS +T   TTN GAPVWN+  ALTVG RGPILLEDYHL+EK+ +F RERIP
Sbjct  1    MDPTKFRPSSSHDTTVTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEKVAHFARERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFE THD+T LTCADFLRAPGV+TP+IVRFSTVIHERGSPETIRDPR
Sbjct  61   ERVVHARGASAKGFFECTHDVTSLTCADFLRAPGVRTPVIVRFSTVIHERGSPETIRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGN+DL+GNNFPVFFIRDG +FPDVIHAFKPNPKSH+QE WR+ D+LSHLP
Sbjct  121  GFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPKSHVQEYWRVFDFLSHLP  180

Query  619  ESLNT  633
            ESL+T
Sbjct  181  ESLHT  185



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   323 bits (828),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 152/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N PF TTNGGAPV NN  +LTVG RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTVGERGPVLLEDYHLIEKVANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  619  ESLNT  633
            ESL T
Sbjct  181  ESLLT  185



>gb|AII23739.1| catalase [Zostera marina]
Length=477

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP+K+RPSS FN+P+ TTN GAPVWNN  +LTVGSRGPILLEDYHL+EKI  F RERIP
Sbjct  1    MDPTKFRPSSDFNSPYWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKIAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHDI+HLTCADFLRAP VQTP+IVRFSTVIHERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDISHLTCADFLRAPAVQTPVIVRFSTVIHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNNFPVFF RDG +FP+  HA K NPK+HIQ+NWRI+D+ SH P
Sbjct  121  GFAVKFYTREGNFDLVGNNFPVFFTRDGMKFPEKHHAKKTNPKTHIQDNWRIMDFFSHHP  180

Query  619  ESLN  630
            ESLN
Sbjct  181  ESLN  184



>ref|XP_001696763.1| catalase/peroxidase [Chlamydomonas reinhardtii]
 gb|EDP00871.1| catalase/peroxidase [Chlamydomonas reinhardtii]
Length=493

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP+K RPSS++NTP+ TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA AKGFFEVTHDI+ LT ADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNN PVFFIRDG +FPD++HAFKPNPKSHIQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP  180

Query  619  ES  624
            ES
Sbjct  181  ES  182



>gb|AAB70006.1| catalase [Chlamydomonas reinhardtii]
Length=493

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP+K RPSS++NTP+ TTN GAPVWNN  ++TVG+RGPILLEDYHLVEK+  F RERIP
Sbjct  1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA AKGFFEVTHDI+ LT ADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFD+VGNN PVFFIRDG +FPD++HAFKPNPKSHIQE WRI+D+LSH P
Sbjct  121  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP  180

Query  619  ES  624
            ES
Sbjct  181  ES  182



>gb|AIU99487.1| catalase [Saccharum hybrid cultivar ROC22]
Length=492

 Score =   323 bits (827),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP K+RPSS  N+ F TTN GAPVWNN  ALTVG RGPILLEDYHL+EK+  F RERIP
Sbjct  1    MDPYKHRPSSGSNSSFWTTNSGAPVWNNNSALTVGQRGPILLEDYHLIEKLAQFDRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARGA+AKGFFEVTHD++HLTCADFLRAPGVQTP+IVRFSTV+HERGSPET+RDPR
Sbjct  61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK+YTREGNFDLVGNN PVFFIRDG +FPD++HAFKPNPK+++QENWRI+D+ SH P
Sbjct  121  GFAVKLYTREGNFDLVGNNMPVFFIRDGMKFPDMVHAFKPNPKTNLQENWRIVDFFSHHP  180

Query  619  ESLN  630
            ESL+
Sbjct  181  ESLH  184



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   323 bits (827),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 168/185 (91%), Gaps = 0/185 (0%)
 Frame = +1

Query  79   MDPSKYRPSSSFNTPFCTTNGGAPVWNNTCALTVGSRGPILLEDYHLVEKIQNFTRERIP  258
            MDP KYRPSS++N PF TTNGGAPV NN  +LT+G RGP+LLEDYHL+EK+ NFTRERIP
Sbjct  1    MDPYKYRPSSAYNAPFYTTNGGAPVSNNISSLTIGERGPVLLEDYHLIEKVANFTRERIP  60

Query  259  ERVVHARGATAKGFFEVTHDITHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETIRDPR  438
            ERVVHARG +AKGFFEVTHDI++LTCADFLRAPGVQTP+IVRFSTV+HER SPET+RD R
Sbjct  61   ERVVHARGISAKGFFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVVHERASPETMRDIR  120

Query  439  GFAVKMYTREGNFDLVGNNFPVFFIRDGAQFPDVIHAFKPNPKSHIQENWRILDYLSHLP  618
            GFAVK YTREGNFDLVGNN PVFFIRDG QFPDV+HA KPNPK++IQE WRILDY+SHLP
Sbjct  121  GFAVKFYTREGNFDLVGNNTPVFFIRDGIQFPDVVHALKPNPKTNIQEYWRILDYMSHLP  180

Query  619  ESLNT  633
            ESL T
Sbjct  181  ESLLT  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500