BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF044O24

Length=604
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002277525.1|  PREDICTED: CAAX prenyl protease 1 homolog          259   6e-81   Vitis vinifera
ref|XP_011093122.1|  PREDICTED: CAAX prenyl protease 1 homolog          257   3e-80   Sesamum indicum [beniseed]
gb|ACU19312.1|  unknown                                                 248   2e-79   Glycine max [soybeans]
gb|KJB41394.1|  hypothetical protein B456_007G102500                    252   5e-79   Gossypium raimondii
ref|XP_004229884.1|  PREDICTED: CAAX prenyl protease 1 homolog          253   7e-79   Solanum lycopersicum
ref|XP_006444969.1|  hypothetical protein CICLE_v10020054mg             254   7e-79   
ref|XP_004133850.1|  PREDICTED: CAAX prenyl protease 1 homolog          253   1e-78   Cucumis sativus [cucumbers]
ref|XP_008438005.1|  PREDICTED: CAAX prenyl protease 1 homolog          253   1e-78   Cucumis melo [Oriental melon]
ref|XP_004155836.1|  PREDICTED: CAAX prenyl protease 1 homolog          253   1e-78   
gb|KJB41393.1|  hypothetical protein B456_007G102500                    252   1e-78   Gossypium raimondii
ref|XP_006339615.1|  PREDICTED: CAAX prenyl protease 1 homolog          253   2e-78   Solanum tuberosum [potatoes]
gb|KDO86290.1|  hypothetical protein CISIN_1g014430mg                   247   3e-78   Citrus sinensis [apfelsine]
gb|KHG15702.1|  CAAX prenyl protease 1 -like protein                    252   3e-78   Gossypium arboreum [tree cotton]
gb|KJB41392.1|  hypothetical protein B456_007G102500                    251   4e-78   Gossypium raimondii
gb|KDO86289.1|  hypothetical protein CISIN_1g014430mg                   247   9e-78   Citrus sinensis [apfelsine]
ref|XP_009762715.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    249   2e-77   Nicotiana sylvestris
gb|EYU35101.1|  hypothetical protein MIMGU_mgv1a006971mg                249   2e-77   Erythranthe guttata [common monkey flower]
ref|XP_003534542.1|  PREDICTED: CAAX prenyl protease 1 homolog          249   3e-77   Glycine max [soybeans]
ref|XP_009773920.1|  PREDICTED: CAAX prenyl protease 1 homolog          249   3e-77   Nicotiana sylvestris
ref|XP_009762714.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    249   3e-77   Nicotiana sylvestris
ref|XP_007051723.1|  Peptidase family M48 family protein                249   5e-77   
ref|XP_007139795.1|  hypothetical protein PHAVU_008G059300g             249   5e-77   Phaseolus vulgaris [French bean]
ref|XP_010919128.1|  PREDICTED: CAAX prenyl protease 1 homolog          249   5e-77   Elaeis guineensis
gb|KHM99334.1|  CAAX prenyl protease 1 like                             248   6e-77   Glycine soja [wild soybean]
ref|XP_003552415.1|  PREDICTED: CAAX prenyl protease 1 homolog          248   6e-77   Glycine max [soybeans]
ref|XP_008810111.1|  PREDICTED: CAAX prenyl protease 1 homolog          248   6e-77   Phoenix dactylifera
gb|KDO86288.1|  hypothetical protein CISIN_1g014430mg                   247   6e-77   Citrus sinensis [apfelsine]
gb|KDO86287.1|  hypothetical protein CISIN_1g014430mg                   248   7e-77   Citrus sinensis [apfelsine]
ref|XP_009628878.1|  PREDICTED: CAAX prenyl protease 1 homolog          248   7e-77   Nicotiana tomentosiformis
ref|XP_007218054.1|  hypothetical protein PRUPE_ppa006168mg             246   7e-77   
emb|CDP08773.1|  unnamed protein product                                248   9e-77   Coffea canephora [robusta coffee]
ref|XP_006491174.1|  PREDICTED: CAAX prenyl protease 1 homolog          247   2e-76   Citrus sinensis [apfelsine]
ref|XP_010053753.1|  PREDICTED: CAAX prenyl protease 1 homolog          247   2e-76   Eucalyptus grandis [rose gum]
ref|XP_009615410.1|  PREDICTED: CAAX prenyl protease 1 homolog          247   2e-76   Nicotiana tomentosiformis
ref|XP_002511907.1|  caax prenyl protease ste24, putative               247   2e-76   Ricinus communis
ref|XP_008232992.1|  PREDICTED: CAAX prenyl protease 1 homolog          246   3e-76   Prunus mume [ume]
ref|XP_002320821.1|  CAAX protease family protein                       246   5e-76   Populus trichocarpa [western balsam poplar]
ref|XP_007218053.1|  hypothetical protein PRUPE_ppa006168mg             246   6e-76   Prunus persica
ref|XP_011036976.1|  PREDICTED: CAAX prenyl protease 1 homolog          245   1e-75   Populus euphratica
ref|XP_010261328.1|  PREDICTED: CAAX prenyl protease 1 homolog          244   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_006396278.1|  hypothetical protein EUTSA_v10028603mg             246   3e-75   
ref|XP_008805562.1|  PREDICTED: CAAX prenyl protease 1 homolog          244   3e-75   Phoenix dactylifera
emb|CDY07191.1|  BnaCnng02060D                                          244   3e-75   
ref|XP_010933964.1|  PREDICTED: CAAX prenyl protease 1 homolog          243   7e-75   Elaeis guineensis
ref|XP_010544403.1|  PREDICTED: CAAX prenyl protease 1 homolog          243   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_002302601.1|  CAAX protease family protein                       242   1e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010669929.1|  PREDICTED: CAAX prenyl protease 1 homolog          242   1e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009111448.1|  PREDICTED: CAAX prenyl protease 1 homolog          242   2e-74   Brassica rapa
ref|XP_009400731.1|  PREDICTED: CAAX prenyl protease 1 homolog          242   3e-74   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY48517.1|  BnaA09g00060D                                          241   4e-74   Brassica napus [oilseed rape]
ref|XP_010556569.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    241   5e-74   Tarenaya hassleriana [spider flower]
emb|CDX74353.1|  BnaA03g26940D                                          241   6e-74   
ref|XP_004306744.1|  PREDICTED: CAAX prenyl protease 1 homolog          241   7e-74   Fragaria vesca subsp. vesca
ref|XP_010112964.1|  CAAX prenyl protease 1-like protein                241   9e-74   
emb|CDX91888.1|  BnaC03g31900D                                          240   1e-73   
ref|XP_009134527.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    240   1e-73   Brassica rapa
ref|XP_009134526.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    241   2e-73   Brassica rapa
ref|XP_009393943.1|  PREDICTED: CAAX prenyl protease 1 homolog          239   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008346138.1|  PREDICTED: CAAX prenyl protease 1 homolog          238   7e-73   
ref|XP_004306743.1|  PREDICTED: CAAX prenyl protease 1 homolog          238   7e-73   Fragaria vesca subsp. vesca
ref|XP_009349805.1|  PREDICTED: CAAX prenyl protease 1 homolog          238   9e-73   Pyrus x bretschneideri [bai li]
ref|XP_003624056.1|  CAAX prenyl protease-like protein                  236   3e-72   Medicago truncatula
gb|KFK30712.1|  hypothetical protein AALP_AA6G017800                    236   5e-72   Arabis alpina [alpine rockcress]
ref|XP_010427521.1|  PREDICTED: CAAX prenyl protease 1 homolog          235   7e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010456236.1|  PREDICTED: CAAX prenyl protease 1 homolog          235   8e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010422802.1|  PREDICTED: CAAX prenyl protease 1 homolog          235   9e-72   Camelina sativa [gold-of-pleasure]
ref|NP_567212.1|  CAAX prenyl protease 1 homolog                        234   3e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAK39514.1|AF353722_1  CaaX processing zinc-metallo endoprotease     234   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286757.1|  hypothetical protein CARUB_v10003198mg             234   4e-71   Capsella rubella
ref|XP_002874990.1|  ATSTE24                                            233   4e-71   Arabidopsis lyrata subsp. lyrata
ref|XP_006647687.1|  PREDICTED: CAAX prenyl protease 1 homolog          232   2e-70   Oryza brachyantha
ref|XP_002454476.1|  hypothetical protein SORBIDRAFT_04g031850          231   4e-70   Sorghum bicolor [broomcorn]
gb|EEC73787.1|  hypothetical protein OsI_08473                          230   9e-70   Oryza sativa Indica Group [Indian rice]
ref|XP_004492786.1|  PREDICTED: CAAX prenyl protease 1 homolog          230   9e-70   
ref|NP_001047739.1|  Os02g0680400                                       230   1e-69   
gb|AAL07084.1|  putative CAAX prenyl protease                           229   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828772.1|  hypothetical protein AMTR_s00001p00094700          229   2e-69   Amborella trichopoda
ref|XP_004953446.1|  PREDICTED: CAAX prenyl protease 1 homolog          228   5e-69   Setaria italica
ref|NP_001131195.1|  uncharacterized protein LOC100192503               226   3e-68   Zea mays [maize]
gb|AFW63375.1|  CAAX prenyl protease 1                                  229   2e-67   
gb|KCW78104.1|  hypothetical protein EUGRSUZ_D02317                     222   6e-67   Eucalyptus grandis [rose gum]
ref|XP_003570103.1|  PREDICTED: CAAX prenyl protease 1 homolog          220   5e-66   Brachypodium distachyon [annual false brome]
ref|XP_004308344.1|  PREDICTED: CAAX prenyl protease 1 homolog          218   2e-65   Fragaria vesca subsp. vesca
ref|XP_008643874.1|  PREDICTED: CAAX prenyl protease 1 isoform X2       218   3e-65   
ref|XP_008643873.1|  PREDICTED: CAAX prenyl protease 1 isoform X1       218   4e-65   Zea mays [maize]
emb|CAB80941.1|  putative CAAX prenyl protease                          218   1e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AIC32889.1|  STE24                                                   215   4e-64   Puccinellia tenuiflora
gb|KDP28583.1|  hypothetical protein JCGZ_14354                         215   5e-64   Jatropha curcas
emb|CAL26913.1|  CAAX peptidase                                         208   2e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001152504.1|  CAAX prenyl protease 1                             204   6e-60   Zea mays [maize]
gb|KHN29321.1|  CAAX prenyl protease 1 like                             196   5e-57   Glycine soja [wild soybean]
ref|XP_001780822.1|  predicted protein                                  196   1e-56   
ref|XP_001783632.1|  predicted protein                                  195   2e-56   
ref|XP_002961362.1|  hypothetical protein SELMODRAFT_266600             184   6e-52   Selaginella moellendorffii
gb|KEH18809.1|  CAAX prenyl protease-like protein                       182   2e-51   Medicago truncatula
ref|XP_003622452.1|  CAAX prenyl protease-like protein                  139   4e-37   
gb|EMT24778.1|  CAAX prenyl protease 1-like protein                     127   3e-31   
gb|KHF98917.1|  E3 ubiquitin-protein ligase RHF2A -like protein         120   6e-29   Gossypium arboreum [tree cotton]
emb|CDH48818.1|  prenyl protease                                        114   3e-26   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001623710.1|  predicted protein                                  114   3e-26   Nematostella vectensis
gb|ETO80780.1|  hypothetical protein F444_04815                         113   5e-26   Phytophthora parasitica P1976
gb|ETL45293.1|  hypothetical protein L916_04606                         113   5e-26   Phytophthora parasitica
ref|XP_008902128.1|  hypothetical protein PPTG_09033                    113   5e-26   Phytophthora parasitica INRA-310
gb|ETL98448.1|  hypothetical protein L917_04490                         113   6e-26   Phytophthora parasitica
gb|ETK91894.1|  hypothetical protein L915_04651                         113   7e-26   Phytophthora parasitica
emb|CEG66514.1|  hypothetical protein RMATCC62417_03079                 112   7e-26   Rhizopus microsporus
emb|CDS07769.1|  hypothetical protein LRAMOSA01718                      112   9e-26   Lichtheimia ramosa
emb|CEJ00851.1|  hypothetical protein RMCBS344292_14897                 112   2e-25   Rhizopus microsporus
ref|XP_004226161.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    111   3e-25   Ciona intestinalis [sea vase]
gb|EPB83925.1|  hypothetical protein HMPREF1544_09315                   111   3e-25   Mucor circinelloides f. circinelloides 1006PhL
emb|CEP19164.1|  hypothetical protein                                   110   5e-25   Parasitella parasitica
gb|ETI52023.1|  hypothetical protein F443_04763                         110   6e-25   Phytophthora parasitica P1569
ref|XP_002900396.1|  CAAX prenyl protease 1                             110   1e-24   Phytophthora infestans T30-4
dbj|GAN04268.1|  metallopeptidase                                       109   2e-24   Mucor ambiguus
gb|ELU11443.1|  hypothetical protein CAPTEDRAFT_171238                  108   2e-24   Capitella teleta
ref|XP_009532258.1|  hypothetical protein PHYSODRAFT_250864             107   7e-24   Phytophthora sojae
gb|ESA09906.1|  hypothetical protein GLOINDRAFT_80760                   107   8e-24   
gb|KFM64976.1|  CAAX prenyl protease 1-like protein                     105   5e-23   Stegodyphus mimosarum
gb|KFH71808.1|  hypothetical protein MVEG_02102                         104   7e-23   Mortierella verticillata NRRL 6337
ref|XP_002945691.1|  hypothetical protein VOLCADRAFT_78672              103   2e-22   Volvox carteri f. nagariensis
emb|CDW75638.1|  caax prenyl protease 1 homolog                         102   3e-22   Stylonychia lemnae
ref|XP_002154940.2|  PREDICTED: CAAX prenyl protease 1 homolog          102   3e-22   Hydra vulgaris
gb|EIE81350.1|  hypothetical protein RO3G_06055                         102   3e-22   Rhizopus delemar RA 99-880
ref|XP_006681887.1|  hypothetical protein BATDEDRAFT_17759              102   6e-22   Batrachochytrium dendrobatidis JAM81
emb|CBJ27157.1|  CaaX prenyl protease Ste24                             101   1e-21   Ectocarpus siliculosus
ref|XP_010593554.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    100   1e-21   Loxodonta africana [African bush elephant]
ref|XP_008861314.1|  hypothetical protein H310_00342                    101   1e-21   Aphanomyces invadans
ref|XP_539577.3|  PREDICTED: CAAX prenyl protease 1 homolog             101   1e-21   Canis lupus familiaris [dogs]
ref|XP_006824576.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    101   2e-21   Saccoglossus kowalevskii
ref|XP_004371951.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   2e-21   Trichechus manatus latirostris
ref|XP_008149410.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   2e-21   Eptesicus fuscus
ref|XP_003415368.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    100   2e-21   Loxodonta africana [African bush elephant]
ref|XP_007536149.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   2e-21   Erinaceus europaeus [common hedgehog]
ref|XP_006098203.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   2e-21   Myotis lucifugus
ref|XP_005868719.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   2e-21   Myotis brandtii
gb|KFZ20107.1|  hypothetical protein V502_03363                         100   2e-21   Pseudogymnoascus sp. VKM F-4520 (FW-2644)
ref|XP_006215922.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   3e-21   Vicugna pacos
ref|XP_006188105.1|  PREDICTED: CAAX prenyl protease 1 homolog          100   3e-21   Camelus ferus
gb|KFY59517.1|  hypothetical protein V496_05652                         100   3e-21   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_010995251.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    100   3e-21   Camelus dromedarius [camel]
emb|CCO33594.1|  STE24 endopeptidase                                  97.4    3e-21   Rhizoctonia solani AG-1 IB
ref|XP_008999216.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.8    3e-21   Callithrix jacchus [common marmoset]
gb|EJY68063.1|  Zn-dependent protease with chaperone function           102   3e-21   Oxytricha trifallax
gb|KFX89268.1|  hypothetical protein V490_07139                         100   3e-21   Pseudogymnoascus sp. VKM F-3557
ref|XP_010958108.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...    100   4e-21   Camelus bactrianus [camel]
ref|XP_004450692.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.0    4e-21   
ref|XP_003799067.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.8    4e-21   
gb|AAK48913.1|  Afc1 protein                                          99.4    4e-21   Physarum polycephalum
ref|XP_002750699.1|  PREDICTED: CAAX prenyl protease 1 homolog is...    100   5e-21   Callithrix jacchus [common marmoset]
gb|KFY38041.1|  hypothetical protein V494_04536                         100   5e-21   Pseudogymnoascus sp. VKM F-4513 (FW-928)
ref|XP_010345848.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.4    5e-21   Saimiri boliviensis boliviensis
ref|XP_004025583.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    6e-21   
ref|XP_010352520.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.0    6e-21   Rhinopithecus roxellana
ref|XP_007977466.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.0    6e-21   Chlorocebus sabaeus
ref|XP_011233459.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.0    6e-21   
ref|XP_005543897.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.0    7e-21   Macaca fascicularis [crab eating macaque]
ref|XP_004415415.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.4    7e-21   
ref|XP_010861023.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.4    7e-21   Bison bison bison
gb|ELR54320.1|  CAAX prenyl protease 1-like protein                   99.4    7e-21   Bos mutus
gb|EUC55856.1|  CAAX prenyl protease                                  99.0    7e-21   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_005898693.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.4    7e-21   Bos mutus
ref|NP_001179857.1|  CAAX prenyl protease 1 homolog                   99.4    7e-21   Bos taurus [bovine]
ref|XP_006867649.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.4    8e-21   Chrysochloris asiatica
ref|XP_004001889.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.4    8e-21   Ovis aries [domestic sheep]
ref|XP_003937059.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.4    8e-21   Saimiri boliviensis boliviensis
ref|XP_003962545.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    8e-21   Takifugu rubripes [tiger puffer]
ref|XP_006737576.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.4    8e-21   Leptonychotes weddellii
ref|XP_006061988.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.4    8e-21   Bubalus bubalis [domestic water buffalo]
gb|KFY87676.1|  hypothetical protein V500_06835                         100   9e-21   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
ref|XP_009059971.1|  hypothetical protein LOTGIDRAFT_209825           99.0    9e-21   Lottia gigantea
gb|KFY09356.1|  hypothetical protein V492_05514                         100   9e-21   Pseudogymnoascus sp. VKM F-4246
ref|XP_003989947.2|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    9e-21   
ref|XP_010352519.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.0    1e-20   Rhinopithecus roxellana
ref|XP_513352.2|  PREDICTED: CAAX prenyl protease 1 homolog           99.0    1e-20   Pan troglodytes
ref|XP_003273371.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    1e-20   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_007077458.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    1e-20   Panthera tigris altaica
ref|XP_002927608.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.0    1e-20   Ailuropoda melanoleuca
ref|XP_007453816.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    1e-20   Lipotes vexillifer [baiji]
ref|XP_004450691.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.0    1e-20   Dasypus novemcinctus
ref|NP_001244375.1|  CAAX prenyl protease 1 homolog                   99.0    1e-20   Macaca mulatta [rhesus macaque]
ref|XP_007977465.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  99.0    1e-20   Chlorocebus sabaeus
ref|XP_004426071.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    1e-20   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_003815473.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    1e-20   Pan paniscus [bonobo]
ref|NP_001126457.1|  CAAX prenyl protease 1 homolog                   99.0    1e-20   Pongo abelii [orang utan]
gb|KFZ02509.1|  hypothetical protein V501_09542                         100   1e-20   Pseudogymnoascus sp. VKM F-4519 (FW-2642)
gb|KFY76197.1|  hypothetical protein V499_04041                         100   1e-20   Pseudogymnoascus sp. VKM F-103
ref|XP_005970531.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    1e-20   Pantholops hodgsonii [Tibetan antelope]
gb|KEP46996.1|  CAAX prenyl protease                                  99.0    1e-20   Rhizoctonia solani 123E
ref|XP_006165004.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  99.0    1e-20   
ref|XP_007950886.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    1e-20   Orycteropus afer afer
ref|XP_004316653.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    1e-20   Tursiops truncatus [Atlantic bottle-nosed dolphin]
ref|XP_004266443.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    1e-20   Orcinus orca [Orca]
ref|XP_006758037.1|  PREDICTED: CAAX prenyl protease 1 homolog        98.6    1e-20   Myotis davidii
emb|CAH92474.1|  hypothetical protein                                 99.0    1e-20   Pongo abelii [orang utan]
gb|KDN36071.1|  hypothetical protein RSAG8_11093                      98.6    1e-20   Rhizoctonia solani AG-8 WAC10335
emb|CEL61202.1|  STE24 endopeptidase                                  98.2    2e-20   Rhizoctonia solani AG-1 IB
ref|XP_008710233.1|  PREDICTED: CAAX prenyl protease 1 homolog        99.0    2e-20   Ursus maritimus [white bear]
ref|XP_008522391.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  97.8    2e-20   Equus przewalskii [Przewalski horse]
gb|ELR10214.1|  STE24 endopeptidase                                   98.6    2e-20   Pseudogymnoascus destructans 20631-21
ref|XP_008589088.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  97.8    2e-20   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004740738.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  97.8    2e-20   Mustela putorius furo [black ferret]
ref|NP_005848.2|  CAAX prenyl protease 1 homolog                      98.2    2e-20   Homo sapiens [man]
dbj|BAA33727.1|  Ste24p                                               98.2    2e-20   Homo sapiens [man]
ref|XP_006798596.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.8    2e-20   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005925764.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.8    2e-20   Haplochromis burtoni
ref|XP_004540520.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.8    2e-20   Maylandia zebra
ref|XP_003453270.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.8    3e-20   Oreochromis niloticus
ref|XP_007164766.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.8    3e-20   Balaenoptera acutorostrata scammoni
ref|XP_007114324.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.4    3e-20   
ref|XP_008589087.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  97.8    3e-20   Galeopterus variegatus [Malayan flying lemur]
ref|XP_002715233.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.8    3e-20   
ref|NP_001288163.1|  zinc metallopeptidase STE24                      97.8    3e-20   Equus caballus [domestic horse]
ref|XP_004910060.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.8    3e-20   
ref|XP_004851105.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  97.4    3e-20   Heterocephalus glaber [naked mole rat]
ref|XP_004740737.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  97.4    3e-20   Mustela putorius furo [black ferret]
ref|XP_004591591.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.4    3e-20   Ochotona princeps [southern American pika]
ref|XP_005317922.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.4    3e-20   Ictidomys tridecemlineatus
ref|XP_008283596.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.4    3e-20   Stegastes partitus
ref|XP_011376276.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.4    4e-20   Pteropus vampyrus
gb|KFY19341.1|  hypothetical protein V493_08005                       97.1    4e-20   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_008832497.1|  PREDICTED: CAAX prenyl protease 1 homolog        96.3    4e-20   Nannospalax galili
gb|EJY66600.1|  CAAX prenyl protease-like protein                     97.4    4e-20   Oxytricha trifallax
ref|XP_004082296.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.1    4e-20   Oryzias latipes [Japanese rice fish]
ref|XP_011415720.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.1    4e-20   Crassostrea gigas
ref|XP_006904034.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  97.1    4e-20   
ref|XP_006886567.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.1    5e-20   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004614273.1|  PREDICTED: CAAX prenyl protease 1 homolog        97.1    5e-20   Sorex araneus [Eurasian shrew]
ref|XP_004678903.1|  PREDICTED: CAAX prenyl protease 1 homolog        96.3    9e-20   Condylura cristata
ref|XP_010733223.1|  PREDICTED: CAAX prenyl protease 1 homolog        96.3    9e-20   
gb|AIC62085.1|  ZMPSTE24                                              96.3    9e-20   synthetic construct
ref|XP_004851106.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  95.5    1e-19   Heterocephalus glaber [naked mole rat]
gb|AAH37283.1|  Zinc metallopeptidase (STE24 homolog, S. cerevisiae)  96.3    1e-19   Homo sapiens [man]
ref|XP_007244663.1|  PREDICTED: CAAX prenyl protease 1 homolog        96.3    1e-19   Astyanax mexicanus [blind cave fish]
ref|XP_005848523.1|  hypothetical protein CHLNCDRAFT_22375            94.7    1e-19   Chlorella variabilis
ref|XP_003050604.1|  predicted protein                                97.8    1e-19   [Nectria] haematococca mpVI 77-13-4
gb|KFY04966.1|  hypothetical protein V491_09229                       97.1    1e-19   Pseudogymnoascus sp. VKM F-3775
pdb|2YPT|A  Chain A, Crystal Structure Of The Human Nuclear Membr...  96.3    1e-19   Homo sapiens [man]
pdb|4AW6|A  Chain A, Crystal Structure Of The Human Nuclear Membr...  96.3    1e-19   Homo sapiens [man]
ref|XP_010624213.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  95.9    1e-19   Fukomys damarensis [Damara mole rat]
ref|XP_004665222.1|  PREDICTED: CAAX prenyl protease 1 homolog        95.5    1e-19   Jaculus jaculus
ref|XP_004705331.1|  PREDICTED: CAAX prenyl protease 1 homolog        95.1    1e-19   Echinops telfairi [lesser hedgehog tenrec]
gb|ELK19500.1|  CAAX prenyl protease 1 like protein                   94.7    1e-19   Pteropus alecto
ref|XP_003501864.1|  PREDICTED: CAAX prenyl protease 1 homolog        95.9    1e-19   Cricetulus griseus [Chinese hamsters]
gb|ESZ94952.1|  putative CAAX prenyl protease 1                       95.1    2e-19   Sclerotinia borealis F-4128
ref|XP_003462326.1|  PREDICTED: CAAX prenyl protease 1 homolog        95.5    2e-19   Cavia porcellus [guinea pig]
ref|XP_006995844.1|  PREDICTED: CAAX prenyl protease 1 homolog        95.1    2e-19   Peromyscus maniculatus bairdii
ref|XP_009028164.1|  hypothetical protein HELRODRAFT_193946           96.7    3e-19   Helobdella robusta
ref|XP_005410609.1|  PREDICTED: CAAX prenyl protease 1 homolog        94.7    3e-19   Chinchilla lanigera
emb|CCG83629.1|  CaaX prenyl protease Ste24                           94.4    3e-19   Taphrina deformans PYCC 5710
ref|XP_010624212.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  94.0    4e-19   Fukomys damarensis [Damara mole rat]
ref|XP_007492914.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  94.0    4e-19   Monodelphis domestica
ref|XP_008080326.1|  hypothetical protein GLAREA_07447                94.4    4e-19   Glarea lozoyensis ATCC 20868
gb|KIY44638.1|  hypothetical protein FISHEDRAFT_61693                 94.4    5e-19   Fistulina hepatica ATCC 64428
dbj|GAA32070.1|  STE24 endopeptidase                                  94.4    5e-19   Clonorchis sinensis [oriental liver fluke]
ref|XP_005353368.1|  PREDICTED: CAAX prenyl protease 1 homolog        94.4    5e-19   
gb|KFH61944.1|  hypothetical protein MVEG_12278                       94.0    5e-19   Mortierella verticillata NRRL 6337
ref|XP_008307531.1|  PREDICTED: CAAX prenyl protease 1 homolog        94.0    5e-19   
ref|XP_010877922.1|  PREDICTED: CAAX prenyl protease 1 homolog        94.0    6e-19   Esox lucius
ref|XP_009168050.1|  hypothetical protein T265_13631                  94.0    6e-19   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_007492913.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  94.0    6e-19   Monodelphis domestica
emb|CDQ71667.1|  unnamed protein product                              94.0    6e-19   Oncorhynchus mykiss
ref|XP_001381205.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  94.0    6e-19   Monodelphis domestica
emb|CAK04159.1|  novel protein (zgc:55655)                            94.0    6e-19   Danio rerio [leopard danio]
ref|NP_956186.1|  CAAX prenyl protease 1 homolog                      94.0    7e-19   Danio rerio [leopard danio]
gb|AAI65348.1|  Zmpste24 protein                                      93.6    7e-19   Danio rerio [leopard danio]
ref|NP_001087923.1|  zinc metallopeptidase STE24                      93.6    8e-19   Xenopus laevis [clawed frog]
ref|XP_005100140.1|  PREDICTED: CAAX prenyl protease 1 homolog        94.0    8e-19   Aplysia californica
ref|XP_001593172.1|  hypothetical protein SS1G_06094                  93.6    8e-19   Sclerotinia sclerotiorum 1980 UF-70
gb|KIJ40265.1|  hypothetical protein M422DRAFT_32316                  93.6    8e-19   Sphaerobolus stellatus SS14
ref|XP_007269077.1|  hypothetical protein FOMMEDRAFT_22167            93.6    9e-19   Fomitiporia mediterranea MF3/22
emb|CAD31792.1|  farnesylated-proteins converting enzyme-1            93.6    9e-19   Mus musculus [mouse]
ref|XP_004646026.1|  PREDICTED: CAAX prenyl protease 1 homolog        93.6    1e-18   Octodon degus
ref|NP_766288.1|  CAAX prenyl protease 1 homolog                      93.6    1e-18   Mus musculus [mouse]
ref|NP_001017255.1|  zinc metallopeptidase STE24                      93.2    1e-18   Xenopus tropicalis [western clawed frog]
emb|CAQ86908.1|  CAAX prenyl protease                                 90.1    1e-18   Acremonium chrysogenum
gb|KDQ52534.1|  hypothetical protein JAAARDRAFT_198172                92.8    2e-18   Jaapia argillacea MUCL 33604
emb|CEJ80463.1|  hypothetical protein VHEMI00644                      92.4    2e-18   Torrubiella hemipterigena
ref|XP_008063694.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  92.8    2e-18   Carlito syrichta
ref|XP_006631345.1|  PREDICTED: CAAX prenyl protease 1 homolog        92.8    2e-18   Lepisosteus oculatus
ref|XP_002194902.2|  PREDICTED: CAAX prenyl protease 1 homolog        92.4    2e-18   
ref|XP_006113336.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  92.0    2e-18   
ref|XP_006456595.1|  hypothetical protein AGABI2DRAFT_188490          92.4    2e-18   
ref|XP_007333006.1|  hypothetical protein AGABI1DRAFT_78691           92.4    2e-18   
ref|XP_005083884.1|  PREDICTED: CAAX prenyl protease 1 homolog        92.4    2e-18   
ref|NP_001101444.1|  CAAX prenyl protease 1 homolog                   92.4    2e-18   
ref|NP_001133548.1|  CAAX prenyl protease 1 homolog                   92.4    2e-18   
gb|ELU39083.1|  metalloendopeptidase                                  94.0    2e-18   
ref|XP_001559859.1|  hypothetical protein BC1G_01418                  92.0    2e-18   
ref|XP_007430032.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  92.0    2e-18   
gb|KIY67067.1|  metalloendopeptidase                                  92.4    3e-18   
ref|XP_006113334.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  92.0    3e-18   
gb|AAK38172.1|  Zmpste24                                              92.0    3e-18   
ref|XP_010593553.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  91.3    3e-18   
ref|XP_005529940.1|  PREDICTED: CAAX prenyl protease 1 homolog        92.0    3e-18   
ref|XP_007430031.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  92.0    3e-18   
ref|XP_005058383.1|  PREDICTED: CAAX prenyl protease 1 homolog        92.0    3e-18   
gb|EFB13524.1|  hypothetical protein PANDA_017398                     91.7    3e-18   
ref|XP_003891707.2|  PREDICTED: CAAX prenyl protease 1 homolog        91.7    4e-18   
ref|XP_005801358.1|  PREDICTED: CAAX prenyl protease 1 homolog        91.7    4e-18   
emb|CCT67513.1|  probable zinc metallo-protease                       91.7    4e-18   
ref|XP_007320476.1|  hypothetical protein SERLADRAFT_472109           91.7    4e-18   
ref|XP_003225003.1|  PREDICTED: CAAX prenyl protease 1 homolog        91.7    4e-18   
ref|XP_009254473.1|  hypothetical protein FPSE_03079                  91.7    4e-18   
ref|XP_008611054.1|  hypothetical protein SDRG_07015                  91.3    4e-18   
emb|CCD77520.1|  farnesylated-protein converting enzyme 1 (M48 fa...  91.7    4e-18   
ref|XP_010861024.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  91.7    4e-18   
gb|EGC45621.1|  CaaX prenyl protease                                  91.3    5e-18   
gb|EEH10632.1|  CaaX prenyl protease                                  91.3    5e-18   
ref|XP_008172699.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  90.1    6e-18   
ref|XP_007386309.1|  metalloendopeptidase                             91.3    6e-18   
gb|KIN03786.1|  hypothetical protein OIDMADRAFT_158613                90.9    6e-18   
ref|XP_011324509.1|  hypothetical protein FGSG_12839                  90.9    7e-18   
ref|XP_008044250.1|  hypothetical protein TRAVEDRAFT_61072            90.9    7e-18   
emb|CDQ57992.1|  unnamed protein product                              90.9    7e-18   
gb|KGQ04223.1|  CAAX prenyl protease 1                                90.9    8e-18   
ref|XP_010345849.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  90.1    8e-18   
gb|EXM07215.1|  STE24 endopeptidase                                   90.9    8e-18   
gb|EWZ02551.1|  STE24 endopeptidase                                   90.9    8e-18   
gb|EXL53967.1|  STE24 endopeptidase                                   90.9    8e-18   
gb|EWG42807.1|  STE24 endopeptidase                                   90.9    8e-18   
gb|KHJ35024.1|  putative peptidase family m48                         90.5    9e-18   
ref|XP_007574196.1|  PREDICTED: CAAX prenyl protease 1 homolog        90.9    9e-18   
ref|XP_009822214.1|  hypothetical protein, variant                    89.4    1e-17   
ref|XP_003649011.1|  hypothetical protein THITE_2107126               90.5    1e-17   
emb|CDO69752.1|  hypothetical protein BN946_scf184697.g24             90.5    1e-17   
ref|XP_010574592.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  90.5    1e-17   
ref|XP_005309436.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  90.1    1e-17   
gb|KFH43653.1|  CAAX prenyl protease-like protein                     90.1    1e-17   
gb|EER44696.1|  CaaX prenyl protease                                  90.1    1e-17   
ref|XP_417720.1|  PREDICTED: CAAX prenyl protease 1 homolog           90.1    1e-17   
ref|XP_009822213.1|  hypothetical protein H257_00958                  90.1    1e-17   
gb|EGU84979.1|  hypothetical protein FOXB_04560                       90.1    1e-17   
gb|EZF34879.1|  hypothetical protein H101_01566                       88.2    2e-17   
ref|XP_008398126.1|  PREDICTED: CAAX prenyl protease 1 homolog        89.7    2e-17   
ref|XP_002627156.1|  CaaX prenyl protease                             89.4    2e-17   
ref|XP_010285888.1|  PREDICTED: CAAX prenyl protease 1 homolog        86.3    2e-17   
ref|XP_006673104.1|  CaaX prenyl protease                             89.4    2e-17   
gb|KGB37699.1|  CAAX prenyl protease 1-like protein                   89.7    2e-17   
gb|KDO33073.1|  hypothetical protein SPRG_01888                       89.4    2e-17   
ref|XP_009321843.1|  PREDICTED: CAAX prenyl protease 1 homolog        86.7    2e-17   
ref|XP_010166308.1|  PREDICTED: CAAX prenyl protease 1 homolog        87.8    2e-17   
ref|XP_004348317.1|  CAAX prenyl protease 1                           89.7    3e-17   
gb|KIL91310.1|  hypothetical protein FAVG1_04924                      89.4    3e-17   
ref|XP_008589089.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  89.0    3e-17   
gb|KFZ58292.1|  CAAX prenyl protease 1                                87.4    3e-17   
ref|XP_001540370.1|  CaaX prenyl protease                             89.4    3e-17   
gb|ETE70091.1|  CAAX prenyl protease 1-like protein                   88.6    3e-17   
ref|XP_010721555.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.5    3e-17   
ref|XP_008468578.1|  PREDICTED: uncharacterized protein C10orf118...  90.1    3e-17   
ref|XP_010305494.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.9    3e-17   
gb|KIN99244.1|  hypothetical protein M404DRAFT_819658                 89.0    4e-17   
ref|XP_007917686.1|  putative caax prenyl protease 1 protein          89.0    4e-17   
ref|XP_002584079.1|  hypothetical protein UREG_04768                  89.0    4e-17   
gb|KIK20177.1|  hypothetical protein PISMIDRAFT_596986                89.0    4e-17   
ref|XP_005029094.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  89.0    4e-17   
gb|KIM87869.1|  hypothetical protein PILCRDRAFT_814576                89.0    4e-17   
gb|EOA94667.1|  CAAX prenyl protease 1-like protein                   89.0    4e-17   
ref|XP_007283748.1|  prenyl protease                                  88.6    5e-17   
gb|KIL00173.1|  hypothetical protein PAXRUDRAFT_130487                88.6    5e-17   
gb|EFQ29725.1|  peptidase family M48                                  88.6    5e-17   
gb|EGD96703.1|  CaaX prenyl protease                                  88.2    5e-17   
ref|XP_003765468.1|  PREDICTED: CAAX prenyl protease 1 homolog        89.4    5e-17   
gb|KIL62048.1|  hypothetical protein M378DRAFT_81777                  88.6    5e-17   
gb|KFW75388.1|  CAAX prenyl protease 1                                87.8    6e-17   
ref|XP_003067440.1|  CAAX prenyl protease, putative                   88.2    6e-17   
ref|XP_784397.3|  PREDICTED: CAAX prenyl protease 1 homolog           88.2    6e-17   
gb|EGE06070.1|  CAAX prenyl protease                                  88.2    6e-17   
ref|XP_008929891.1|  PREDICTED: CAAX prenyl protease 1 homolog        87.8    6e-17   
gb|KIJ19598.1|  hypothetical protein PAXINDRAFT_166705                88.2    7e-17   
ref|XP_003661486.1|  hypothetical protein MYCTH_2300946               88.2    7e-17   
emb|CAX20735.1|  putative CAAX prenyl protease                        88.2    7e-17   
ref|XP_009866258.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.1    7e-17   
gb|KDQ22820.1|  hypothetical protein PLEOSDRAFT_1069043               88.2    7e-17   
emb|CCE28602.1|  probable zinc metallo-protease                       87.8    8e-17   
gb|KFO58257.1|  CAAX prenyl protease 1                                87.4    8e-17   
ref|XP_009701667.1|  PREDICTED: CAAX prenyl protease 1 homolog        87.4    9e-17   
ref|XP_008630820.1|  PREDICTED: CAAX prenyl protease 1 homolog        87.8    9e-17   
gb|KFP66604.1|  CAAX prenyl protease 1                                87.4    9e-17   
ref|XP_010411361.1|  PREDICTED: CAAX prenyl protease 1 homolog        87.8    1e-16   
ref|XP_001239931.1|  hypothetical protein CIMG_09552                  87.4    1e-16   
ref|XP_005492450.1|  PREDICTED: CAAX prenyl protease 1 homolog        87.4    1e-16   
ref|XP_007834407.1|  hypothetical protein PFICI_07635                 87.4    1e-16   
gb|EWM26686.1|  caax prenyl protease 1                                87.8    1e-16   
ref|XP_005139561.1|  PREDICTED: CAAX prenyl protease 1 homolog        87.0    1e-16   
gb|ETS60648.1|  hypothetical protein PaG_04544                        87.8    1e-16   
ref|XP_006696845.1|  ribosomal protein L34-like protein               87.8    2e-16   
gb|KGL99640.1|  CAAX prenyl protease 1                                86.3    2e-16   
ref|XP_008601147.1|  peptidase family M48                             86.7    2e-16   
gb|KFV03217.1|  CAAX prenyl protease 1                                86.3    2e-16   
ref|XP_010086478.1|  PREDICTED: CAAX prenyl protease 1 homolog        86.3    2e-16   
ref|XP_009891312.1|  PREDICTED: CAAX prenyl protease 1 homolog        86.3    2e-16   
ref|XP_001229027.1|  hypothetical protein CHGG_02511                  85.1    2e-16   
gb|KDR22915.1|  CAAX prenyl protease 1-like protein                   86.3    2e-16   
gb|KFO89161.1|  CAAX prenyl protease 1                                86.3    3e-16   
ref|XP_010133525.1|  PREDICTED: CAAX prenyl protease 1 homolog        86.3    3e-16   
gb|KFQ39196.1|  CAAX prenyl protease 1                                86.3    3e-16   
ref|XP_010187899.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.9    3e-16   
ref|XP_005428744.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.9    3e-16   
gb|KFV87620.1|  CAAX prenyl protease 1                                85.9    3e-16   
gb|KGO76072.1|  Peptidase M48                                         86.3    3e-16   
gb|KDN48443.1|  hypothetical protein K437DRAFT_255552                 86.7    3e-16   
emb|CCF47842.1|  peptidase family M48                                 86.3    3e-16   
ref|XP_006269945.1|  PREDICTED: CAAX prenyl protease 1 homolog        86.3    3e-16   
ref|XP_003236858.1|  CaaX prenyl protease                             86.3    3e-16   
gb|KFP02851.1|  CAAX prenyl protease 1                                85.9    3e-16   
gb|KFV07913.1|  CAAX prenyl protease 1                                85.9    3e-16   
ref|XP_010574593.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  85.5    4e-16   
gb|KFP94249.1|  CAAX prenyl protease 1                                85.9    4e-16   
gb|EKV19760.1|  CaaX prenyl protease Ste24                            85.9    4e-16   
ref|XP_009095809.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.5    4e-16   
ref|XP_009575599.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.5    4e-16   
ref|XP_003032250.1|  hypothetical protein SCHCODRAFT_76708            85.9    4e-16   
gb|KFV92102.1|  CAAX prenyl protease 1                                85.5    4e-16   
gb|KIJ91753.1|  hypothetical protein K443DRAFT_471063                 85.9    4e-16   
emb|CDS32581.1|  farnesylated protein converting enzyme 1             87.0    4e-16   
gb|KFR09506.1|  CAAX prenyl protease 1                                85.5    4e-16   
gb|KFM12524.1|  CAAX prenyl protease 1                                85.5    4e-16   
ref|XP_010017682.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.5    4e-16   
gb|KFQ91415.1|  CAAX prenyl protease 1                                85.5    4e-16   
gb|KFQ43267.1|  CAAX prenyl protease 1                                85.5    4e-16   
gb|KIJ62466.1|  hypothetical protein HYDPIDRAFT_30427                 85.9    4e-16   
ref|XP_009931337.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.9    4e-16   
ref|XP_010207607.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.5    4e-16   
ref|XP_009074890.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.5    5e-16   
ref|XP_003023010.1|  hypothetical protein TRV_02831                   86.3    5e-16   
gb|KFV40539.1|  CAAX prenyl protease 1                                85.5    5e-16   
gb|KFP82009.1|  CAAX prenyl protease 1                                85.5    5e-16   
ref|XP_002842311.1|  hypothetical protein                             85.5    5e-16   
ref|XP_009969340.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.5    5e-16   
gb|KFP21746.1|  CAAX prenyl protease 1                                85.5    5e-16   
ref|XP_009466806.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.9    5e-16   
ref|XP_007868390.1|  hypothetical protein GLOTRDRAFT_140021           85.9    5e-16   
gb|AAZ80484.1|  membrane-associated metalloproteinase                 85.9    5e-16   
ref|XP_007788183.1|  putative caax prenyl protease 1 protein          84.7    5e-16   
gb|KIK36204.1|  hypothetical protein CY34DRAFT_811473                 85.5    5e-16   
ref|XP_003012809.1|  hypothetical protein ARB_01060                   86.3    5e-16   
gb|KFP23371.1|  CAAX prenyl protease 1                                85.5    5e-16   
ref|XP_010759714.1|  hypothetical protein PADG_04087                  85.5    5e-16   
ref|XP_005309437.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  85.1    5e-16   
ref|XP_008494648.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.9    5e-16   
gb|EHJ67350.1|  prenyl-dependent CAAX metalloprotease                 85.5    5e-16   
emb|CCX14243.1|  Similar to CAAX prenyl protease 1; acc. no. P47154   85.1    6e-16   
ref|XP_007595308.1|  peptidase family M48                             85.5    6e-16   
ref|XP_001911737.1|  hypothetical protein                             85.5    6e-16   
ref|XP_002796885.1|  CAAX prenyl protease                             85.5    6e-16   
ref|XP_009685465.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  84.7    6e-16   
ref|XP_460632.1|  DEHA2F06248p                                        85.1    6e-16   
ref|XP_003172087.1|  CAAX prenyl protease 1                           85.5    6e-16   
gb|KII84839.1|  hypothetical protein PLICRDRAFT_45641                 85.5    6e-16   
gb|AAX78522.1|  CaaX prenyl protease                                  85.1    6e-16   
ref|XP_009644178.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.5    7e-16   
ref|XP_005437030.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.5    7e-16   
ref|XP_007066142.1|  PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl ...  84.7    7e-16   
ref|XP_010217187.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.1    7e-16   
gb|KGL80196.1|  CAAX prenyl protease 1                                84.7    7e-16   
ref|XP_009909817.1|  PREDICTED: CAAX prenyl protease 1 homolog        84.7    8e-16   
ref|XP_005235139.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.5    8e-16   
gb|KFV63659.1|  CAAX prenyl protease 1                                84.7    8e-16   
ref|XP_005029095.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  84.7    8e-16   
ref|XP_009917537.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  84.3    8e-16   
gb|EFX04750.1|  prenyl protease ste24                                 85.9    8e-16   
gb|KGO40189.1|  Peptidase M48                                         85.1    8e-16   
gb|ENH68811.1|  CAAX prenyl protease 1                                84.7    8e-16   
ref|XP_009284932.1|  PREDICTED: CAAX prenyl protease 1 homolog        85.1    8e-16   
emb|CCA73227.1|  probable zinc metallo-protease                       85.1    9e-16   
gb|KID96212.1|  Peptidase M48                                         84.7    1e-15   
ref|XP_007787411.1|  hypothetical protein EPUS_00192                  84.7    1e-15   
gb|KFU93569.1|  CAAX prenyl protease 1                                84.3    1e-15   
ref|XP_010788908.1|  PREDICTED: CAAX prenyl protease 1 homolog        84.7    1e-15   
gb|KEZ39101.1|  CAAX prenyl protease 1                                84.3    1e-15   
ref|XP_003709694.1|  CAAX prenyl protease 1                           84.3    1e-15   
ref|XP_010001210.1|  PREDICTED: CAAX prenyl protease 1 homolog        84.3    1e-15   
ref|XP_001885842.1|  predicted protein                                84.3    2e-15   
gb|EPS96954.1|  hypothetical protein FOMPIDRAFT_1150347               84.3    2e-15   
ref|XP_007399987.1|  hypothetical protein PHACADRAFT_32121            84.0    2e-15   
gb|ENH82556.1|  prenyl protease ste24                                 84.0    2e-15   
ref|XP_003685564.1|  hypothetical protein TPHA_0E00340                84.0    2e-15   
emb|CCE44422.1|  hypothetical protein CPAR2_402230                    84.0    2e-15   
gb|ELQ35873.1|  CAAX prenyl protease 1                                84.3    2e-15   
ref|XP_002565802.1|  Pc22g18990                                       84.0    2e-15   
dbj|GAC72239.1|  metalloprotease                                      84.3    2e-15   
gb|KDR72916.1|  hypothetical protein GALMADRAFT_252262                84.0    2e-15   
gb|ERT02053.1|  hypothetical protein HMPREF1624_00350                 84.0    2e-15   
gb|KHN95623.1|  Peptidase M48                                         84.0    2e-15   
gb|EYE94778.1|  CaaX prenyl protease Ste24                            83.6    2e-15   
gb|KIM44315.1|  hypothetical protein M413DRAFT_17987                  83.6    2e-15   
gb|KID79414.1|  Peptidase M48                                         83.6    3e-15   
ref|XP_006503082.1|  PREDICTED: CAAX prenyl protease 1 homolog is...  83.6    3e-15   
gb|KID91898.1|  Peptidase M48                                         83.6    3e-15   
ref|XP_007822354.1|  metallopeptidase                                 83.6    3e-15   
ref|XP_002377095.1|  CaaX prenyl protease Ste24                       82.8    3e-15   
gb|KIK64206.1|  hypothetical protein GYMLUDRAFT_221506                83.6    3e-15   
ref|XP_007295712.1|  peptidase family M48                             83.2    3e-15   
ref|XP_006033777.1|  PREDICTED: CAAX prenyl protease 1 homolog        83.2    3e-15   
emb|CCL98879.1|  predicted protein                                    84.3    3e-15   
dbj|GAC98932.1|  CaaX prenyl protease Ste24                           83.6    4e-15   
gb|KIP07880.1|  hypothetical protein PHLGIDRAFT_19080                 82.8    4e-15   
gb|KDQ12633.1|  hypothetical protein BOTBODRAFT_34349                 82.8    4e-15   
ref|XP_001838304.1|  metalloendopeptidase                             82.8    5e-15   
ref|XP_002112567.1|  hypothetical protein TRIADDRAFT_25296            82.8    5e-15   



>ref|XP_002277525.1| PREDICTED: CAAX prenyl protease 1 homolog [Vitis vinifera]
 emb|CBI40422.3| unnamed protein product [Vitis vinifera]
Length=424

 Score =   259 bits (661),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/149 (89%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMILMYIFETYLD+RQHAALKLPTLP+ L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDLRQHAALKLPTLPRTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHE VTILMDSAIL+FG+LPWFWKKSGDFLV +GLN E EILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHECVTILMDSAILFFGVLPWFWKKSGDFLVVVGLNAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_011093122.1| PREDICTED: CAAX prenyl protease 1 homolog [Sesamum indicum]
Length=424

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMIL+Y+FETYLD+RQH ALKLPTLP+PLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILVYLFETYLDLRQHTALKLPTLPRPLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHE VTI+MD AILYFGILPWFWK+SG+FLV+ GLN E EILHTLAFLAGVMFWSQ
Sbjct  61   HFHFVHELVTIVMDCAILYFGILPWFWKRSGEFLVYAGLNAENEILHTLAFLAGVMFWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>gb|ACU19312.1| unknown [Glycine max]
Length=202

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHRALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTI+ DS ILYFG+LPWFWKKSGDF+   G N E EILHTLAFLAG+M WSQ
Sbjct  61   HFHFVHEFVTIVTDSTILYFGVLPWFWKKSGDFMTIAGFNAENEILHTLAFLAGLMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTPWLFF  149



>gb|KJB41394.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=362

 Score =   252 bits (643),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTIL+DSAIL+FGILPWFWKKSG FL  +GLN E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFLPLVGLNEENEILHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_004229884.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum lycopersicum]
Length=424

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+EAVVGFMILMYIFE+YLD+RQHAA KLPTLPKPLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYLEAVVGFMILMYIFESYLDVRQHAAHKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HEFVTI+MDS+ILYF ILPWFWK+SG+FLVFLGLN E EI HTL+FLAGVM WSQ
Sbjct  61   YFHFIHEFVTIIMDSSILYFRILPWFWKRSGEFLVFLGLNAENEIFHTLSFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WL+F
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTVWLYF  149



>ref|XP_006444969.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
 gb|ESR58209.1| hypothetical protein CICLE_v10020054mg [Citrus clementina]
Length=463

 Score =   254 bits (650),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +1

Query  112  RSLSVSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS  291
            RS ++S      N+AM FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVIS
Sbjct  25   RSSNISADSTNSNAAMVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVIS  84

Query  292  QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEI  471
            QEKFEKSR YS+DKS FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ E EI
Sbjct  85   QEKFEKSRGYSLDKSHFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEI  144

Query  472  LHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            LHTL+FLAGVM WSQ+TDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  145  LHTLSFLAGVMLWSQLTDLPFSLYSTFVIEARHGFNKQTIWLFF  188



>ref|XP_004133850.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
 gb|KGN56492.1| hypothetical protein Csa_3G121680 [Cucumis sativus]
Length=424

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY FETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYTFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTI+MDSAIL+FG+LPWFWKKSG+F+VF+GLN E EILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTIVMDSAILFFGVLPWFWKKSGEFVVFVGLNAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            +TDLPFSLYSTFVIE+RHGFNK T+WLFF
Sbjct  121  VTDLPFSLYSTFVIESRHGFNKQTIWLFF  149



>ref|XP_008438005.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis melo]
Length=424

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTI+MDSAIL+FG+LPWFWKKSG+F+V +GLN E EILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTIVMDSAILFFGVLPWFWKKSGEFVVLVGLNAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            +TDLPFSLYSTFVIE+RHGFNK T+WLFF
Sbjct  121  VTDLPFSLYSTFVIESRHGFNKQTIWLFF  149



>ref|XP_004155836.1| PREDICTED: CAAX prenyl protease 1 homolog [Cucumis sativus]
Length=424

 Score =   253 bits (646),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY FETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYTFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTI+MDSAIL+FG+LPWFWKKSG+F+VF+GLN E EILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTIVMDSAILFFGVLPWFWKKSGEFVVFVGLNAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            +TDLPFSLYSTFVIE+RHGFNK T+WLFF
Sbjct  121  VTDLPFSLYSTFVIESRHGFNKETIWLFF  149



>gb|KJB41393.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=391

 Score =   252 bits (643),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTIL+DSAIL+FGILPWFWKKSG FL  +GLN E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFLPLVGLNEENEILHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_006339615.1| PREDICTED: CAAX prenyl protease 1 homolog [Solanum tuberosum]
Length=424

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 141/149 (95%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+EAVVGFMILMY+FE+YLD+RQHAA KLPTLPKPLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYLEAVVGFMILMYLFESYLDVRQHAAHKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HEFVTILMDS+ILYF ILPWFWK+SG+FLV+LGLN E EI HTL+FLAGVM WSQ
Sbjct  61   YFHFIHEFVTILMDSSILYFRILPWFWKRSGEFLVYLGLNAENEIFHTLSFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WL+F
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTVWLYF  149



>gb|KDO86290.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=274

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEILHTLSFLAGVMLWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            +TDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  LTDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>gb|KHG15702.1| CAAX prenyl protease 1 -like protein [Gossypium arboreum]
Length=424

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTIL+DSAIL+FGILPWFWKKSG FL  +GLN E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFLPLIGLNEENEILHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>gb|KJB41392.1| hypothetical protein B456_007G102500 [Gossypium raimondii]
Length=424

 Score =   251 bits (642),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY+FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MEFPYMEAVVGFMILMYLFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTIL+DSAIL+FGILPWFWKKSG FL  +GLN E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILIDSAILFFGILPWFWKKSGTFLPLVGLNEENEILHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>gb|KDO86289.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=304

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEILHTLSFLAGVMLWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            +TDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  LTDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_009762715.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Nicotiana 
sylvestris]
Length=403

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+E+VVGFMILMYIFETYLD+RQHAALKLPTLPKPL GVI QEKF+KS+AYS+DKS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVICQEKFKKSQAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
            +FHFVHEFVTILMDSA+LYF ILPWFWK SGDFL++LGLN E EI HTLAFLAGVM WSQ
Sbjct  61   NFHFVHEFVTILMDSAVLYFRILPWFWKISGDFLIYLGLNAENEIFHTLAFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIE+RHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTVWLFF  149



>gb|EYU35101.1| hypothetical protein MIMGU_mgv1a006971mg [Erythranthe guttata]
Length=424

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/149 (87%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVG MIL+YIFE YLD RQHAALKLPTLPKPLVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGVMILVYIFECYLDKRQHAALKLPTLPKPLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
            +FHFVHE VT+LMDS ILYFGILPWFWK+SG+FL   G N E EILHTLAFLAGVMFWSQ
Sbjct  61   NFHFVHELVTVLMDSVILYFGILPWFWKRSGEFLGSAGFNAENEILHTLAFLAGVMFWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTVWLFF  149



>ref|XP_003534542.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHRALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTI+ DS ILYFG+LPWFWKKSGDF+   G N E EILHTLAFLAG+M WSQ
Sbjct  61   HFHFVHEFVTIVTDSTILYFGVLPWFWKKSGDFMTIAGFNAENEILHTLAFLAGLMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTPWLFF  149



>ref|XP_009773920.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana sylvestris]
Length=424

 Score =   249 bits (637),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+EAV+GFMILMYIFETYLD+RQHAA KLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYLEAVLGFMILMYIFETYLDVRQHAAHKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HEFVTILMDS+ILYF ILPWFWK SG+ LV+LGLN E EI HTL+FLAGVM WSQ
Sbjct  61   YFHFIHEFVTILMDSSILYFRILPWFWKISGESLVYLGLNAENEIFHTLSFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTVWLFF  149



>ref|XP_009762714.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Nicotiana 
sylvestris]
Length=424

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+E+VVGFMILMYIFETYLD+RQHAALKLPTLPKPL GVI QEKF+KS+AYS+DKS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVICQEKFKKSQAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
            +FHFVHEFVTILMDSA+LYF ILPWFWK SGDFL++LGLN E EI HTLAFLAGVM WSQ
Sbjct  61   NFHFVHEFVTILMDSAVLYFRILPWFWKISGDFLIYLGLNAENEIFHTLAFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIE+RHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTVWLFF  149



>ref|XP_007051723.1| Peptidase family M48 family protein [Theobroma cacao]
 gb|EOX95880.1| Peptidase family M48 family protein [Theobroma cacao]
Length=435

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAF YMEAVV FMILMY FETYLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFLYMEAVVCFMILMYFFETYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWKKSG+FL  +GLN E EILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKKSGNFLPLVGLNAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_007139795.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
 gb|ESW11789.1| hypothetical protein PHAVU_008G059300g [Phaseolus vulgaris]
Length=424

 Score =   249 bits (635),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDMRQHKALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
            +FHF+HEFVTI+ DS ILYFG+LPWFWKKSG+++  +GLN E EILHTLAFLAG+M WSQ
Sbjct  61   NFHFIHEFVTIVSDSTILYFGVLPWFWKKSGEYVTTVGLNPENEILHTLAFLAGLMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTPWLFF  149



>ref|XP_010919128.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   249 bits (635),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/149 (84%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+GFMILMYIFETYLDIRQHAALKLP+LPKPL GV+SQEKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYIFETYLDIRQHAALKLPSLPKPLEGVVSQEKFERSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHE VTILMD+AILY GILPWFWKKSGD + ++GLN E EI+HTL+FLAGVM WSQ
Sbjct  61   QFHFVHEAVTILMDTAILYLGILPWFWKKSGDLVAYMGLNAENEIIHTLSFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>gb|KHM99334.1| CAAX prenyl protease 1 like [Glycine soja]
Length=424

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMILMYIFETYLD+RQH+ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTI++DS ILYFG+LPWFWK SGDF+    LN E EILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTIVIDSTILYFGVLPWFWKISGDFMTIASLNAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTPWLFF  149



>ref|XP_003552415.1| PREDICTED: CAAX prenyl protease 1 homolog [Glycine max]
Length=424

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMILMYIFETYLD+RQH+ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFETYLDVRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTI++DS ILYFG+LPWFWK SGDF+    LN E EILHTLAFLAGVM WSQ
Sbjct  61   HFHFVHEFVTIVIDSTILYFGVLPWFWKISGDFMTIASLNAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTPWLFF  149



>ref|XP_008810111.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   248 bits (634),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+GFMILMYI ETYLDIRQHAALKLP+LPKPL GV+SQEKFEKSRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYILETYLDIRQHAALKLPSLPKPLEGVVSQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHE VTILMD+AILYFG+LPWFWKKSGDF+ ++GLN E EI+HTL+FLAGVM WSQ
Sbjct  61   HFHFVHEAVTILMDTAILYFGVLPWFWKKSGDFVAYMGLNAENEIIHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFV+E RHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVVETRHGFNKQTIWLFF  149



>gb|KDO86288.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=367

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEILHTLSFLAGVMLWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            +TDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  LTDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>gb|KDO86287.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=399

 Score =   248 bits (632),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEILHTLSFLAGVMLWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            +TDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  LTDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_009628878.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   248 bits (634),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 129/149 (87%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+E+VVGFMILMYIFETYLD+RQHAALKLPTLPKPL GVISQEKF+KS+AYS+DKS
Sbjct  1    MAFPYLESVVGFMILMYIFETYLDLRQHAALKLPTLPKPLEGVISQEKFKKSQAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
            +FHFVHEFVTILMDSAILYF ILPWFWK S DFL++LGLN E EI HTLAFLAGVM WSQ
Sbjct  61   NFHFVHEFVTILMDSAILYFRILPWFWKISRDFLIYLGLNAENEIFHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIE+RHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTVWLFF  149



>ref|XP_007218054.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19253.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=351

 Score =   246 bits (628),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFP++EAV+GFMILMYIFETYLD+RQH ALKLPTLPK L GVI QEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVIGQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HEFVTILMDSAIL+F +LPWFWK+SGDF+  +GLN E EILHTLAFL GVM WSQ
Sbjct  61   HFHFIHEFVTILMDSAILFFRVLPWFWKRSGDFVTLVGLNAENEILHTLAFLGGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFV+EARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVVEARHGFNKQTIWLFF  149



>emb|CDP08773.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   248 bits (633),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFP+MEAVV FMILMY+FE+YLD+RQHAALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFMEAVVCFMILMYLFESYLDLRQHAALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
            +FHFVHEF TILMDSAIL+FGILPWFWKKSG+FLV  GL+ E EI HTLAFLAGV FWSQ
Sbjct  61   NFHFVHEFFTILMDSAILFFGILPWFWKKSGEFLVLAGLDAENEIFHTLAFLAGVTFWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_006491174.1| PREDICTED: CAAX prenyl protease 1 homolog [Citrus sinensis]
 gb|KDO86285.1| hypothetical protein CISIN_1g014430mg [Citrus sinensis]
Length=424

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPYMEAVVGFMILMY FETYLD+RQHAALKLP LPK L GVISQEKFEKSR YS+DKS
Sbjct  1    MVFPYMEAVVGFMILMYFFETYLDLRQHAALKLPKLPKTLEGVISQEKFEKSRGYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL F ILPWFWKKSG+FLV +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILLFRILPWFWKKSGNFLVLVGLDAENEILHTLSFLAGVMLWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            +TDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  LTDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_010053753.1| PREDICTED: CAAX prenyl protease 1 homolog [Eucalyptus grandis]
 gb|KCW78103.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=423

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMILM+ FETYLD+RQHAA KLPTLPKPL GVI QEKF+KSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMHFFETYLDLRQHAAYKLPTLPKPLEGVIGQEKFQKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HEFV+ILMDSAIL FGILPWFWKKSG+FLV  GLN E EILHTL+FLAGVM WSQ
Sbjct  61   RFHFLHEFVSILMDSAILLFGILPWFWKKSGEFLVLAGLNAENEILHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTVWLFF  149



>ref|XP_009615410.1| PREDICTED: CAAX prenyl protease 1 homolog [Nicotiana tomentosiformis]
Length=424

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+EAV+GFMILMYIFETYLD+RQHAA KLPTLPK LVGVISQEKF+KSRAYS+DKS
Sbjct  1    MAFPYLEAVLGFMILMYIFETYLDVRQHAAHKLPTLPKTLVGVISQEKFKKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HEFVTILMDS+ILYF ILPWFWK SG+ L++LGLNTE EI HTL+FLAGVM WSQ
Sbjct  61   YFHFIHEFVTILMDSSILYFRILPWFWKISGESLLYLGLNTENEIFHTLSFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIE RHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIETRHGFNKQTVWLFF  149



>ref|XP_002511907.1| caax prenyl protease ste24, putative [Ricinus communis]
 gb|EEF50576.1| caax prenyl protease ste24, putative [Ricinus communis]
Length=424

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 139/149 (93%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAV+GFM+LMYIFE+YLD+RQH ALKLPTLPK L GVISQEKF+KSRAYS+DKS
Sbjct  1    MAFPYMEAVLGFMVLMYIFESYLDMRQHCALKLPTLPKTLEGVISQEKFKKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             F+FVHEFVTIL+DSAILYFGILPW WK+SG+FL+ +GLN E EILHTLAFLAGVM WSQ
Sbjct  61   HFNFVHEFVTILLDSAILYFGILPWSWKESGNFLLLVGLNAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_008232992.1| PREDICTED: CAAX prenyl protease 1 homolog [Prunus mume]
Length=424

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFP++EAV+GFMILMYIFETYLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HEFVTILMDSAIL+F +LPWFWK+SGDF+   GLN E EILHTLAFL GVM WSQ
Sbjct  61   HFHFIHEFVTILMDSAILFFRVLPWFWKRSGDFVTLAGLNAENEILHTLAFLGGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFV+EARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVVEARHGFNKQTIWLFF  149



>ref|XP_002320821.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE99136.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   246 bits (628),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 127/149 (85%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMIL+Y FETYLD+RQ AALKLP LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILVYFFETYLDLRQRAALKLPILPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             F+FVHEFVTIL+DSAIL++GILPWFWKKSG F+V  G N E EILHTLAFLAGVM WSQ
Sbjct  61   HFNFVHEFVTILLDSAILFYGILPWFWKKSGSFVVLAGFNEENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_007218053.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
 gb|EMJ19252.1| hypothetical protein PRUPE_ppa006168mg [Prunus persica]
Length=424

 Score =   246 bits (628),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFP++EAV+GFMILMYIFETYLD+RQH ALKLPTLPK L GVI QEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMILMYIFETYLDLRQHTALKLPTLPKTLEGVIGQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HEFVTILMDSAIL+F +LPWFWK+SGDF+  +GLN E EILHTLAFL GVM WSQ
Sbjct  61   HFHFIHEFVTILMDSAILFFRVLPWFWKRSGDFVTLVGLNAENEILHTLAFLGGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFV+EARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVVEARHGFNKQTIWLFF  149



>ref|XP_011036976.1| PREDICTED: CAAX prenyl protease 1 homolog [Populus euphratica]
Length=424

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/149 (86%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMIL+Y FETYLD+RQ AALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILVYFFETYLDLRQLAALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             F+FVHEFVTIL+DSAIL++GILPWFWKKSG F+V  G N E EILHTLAFLAGVM WSQ
Sbjct  61   HFNFVHEFVTILLDSAILFYGILPWFWKKSGSFVVLAGFNEENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_010261328.1| PREDICTED: CAAX prenyl protease 1 homolog [Nelumbo nucifera]
Length=424

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYME+VVGFMILMYIFETYLDIRQH +LKLP LPKPL GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMESVVGFMILMYIFETYLDIRQHRSLKLPNLPKPLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HE VTILMD+AIL+FGILPWFWK+S +FL++  LN E EILHTLAFL+GVM WSQ
Sbjct  61   HFHFIHEAVTILMDTAILFFGILPWFWKRSAEFLIYTNLNPENEILHTLAFLSGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIE+RHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWLFF  149



>ref|XP_006396278.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
 gb|ESQ37731.1| hypothetical protein EUTSA_v10028603mg [Eutrema salsugineum]
Length=494

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = +1

Query  151  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSID  330
            +AMA PYME VVGFMI+MYIFETYLD+RQHAA KLPTLPK LVGVISQEKFEKSRAYS+D
Sbjct  69   AAMAIPYMETVVGFMIVMYIFETYLDLRQHAAHKLPTLPKTLVGVISQEKFEKSRAYSLD  128

Query  331  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFW  510
            KS FHFVHEFVTILMDSAIL+FGILPWFWK SG FL  +GL+ E EILHTL+FLAGVM W
Sbjct  129  KSYFHFVHEFVTILMDSAILFFGILPWFWKLSGGFLPMVGLDPENEILHTLSFLAGVMTW  188

Query  511  SQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            SQITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  189  SQITDLPFSLYSTFVIESRHGFNKQTIWMF  218



>ref|XP_008805562.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805563.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
 ref|XP_008805564.1| PREDICTED: CAAX prenyl protease 1 homolog [Phoenix dactylifera]
Length=425

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+GFMILMYI ETYLDIRQHAALKLP+LPKPL GV+ QEKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYILETYLDIRQHAALKLPSLPKPLEGVVGQEKFERSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHE V+ILMD+AILYFGILPWFWKK+GD + ++GLN E EI+HTL+FLAGVM WSQ
Sbjct  61   HFHFVHEAVSILMDTAILYFGILPWFWKKTGDLVAYMGLNAENEIIHTLSFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>emb|CDY07191.1| BnaCnng02060D [Brassica napus]
Length=424

 Score =   244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFMI+MYIFETYLD+RQH+ALKLP+LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSA+L+FGILPWFWK SG FL  +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAMLFFGILPWFWKLSGGFLSMVGLDPENEILHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIE+RHGFNK T+W+FF
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMFF  149



>ref|XP_010933964.1| PREDICTED: CAAX prenyl protease 1 homolog [Elaeis guineensis]
Length=425

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+GFMILMYIFETYLDIRQHAALKLP LPKPL GV+SQEKFEKSRAYS+DKS
Sbjct  1    MALPYLEAVLGFMILMYIFETYLDIRQHAALKLPRLPKPLEGVVSQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHE VTILMD+AILYFGILPWFWK SG+ + ++ LN E EI+HTL+FLAGVM WSQ
Sbjct  61   HFHFVHEAVTILMDTAILYFGILPWFWKISGNLVAYMDLNAENEIIHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_010544403.1| PREDICTED: CAAX prenyl protease 1 homolog [Tarenaya hassleriana]
Length=424

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYME VVGFMI+MYIFETYLD+RQHAALKLPTLPK LVG+I QEKFEKSRAYS+DKS
Sbjct  1    MAFPYMETVVGFMIMMYIFETYLDLRQHAALKLPTLPKTLVGLIGQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFV  +VTILMDSAIL+FGILPWFWKKSGDFL  +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   YFHFVQGYVTILMDSAILFFGILPWFWKKSGDFLPSVGLDPENEILHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T+WL+
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLY  148



>ref|XP_002302601.1| CAAX protease family protein [Populus trichocarpa]
 gb|EEE81874.1| CAAX protease family protein [Populus trichocarpa]
Length=424

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/149 (85%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMILMY FETYLD+RQHAALKLP+LPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYFFETYLDLRQHAALKLPSLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             F+FVHEFVTIL+DSAIL++ ILPWFWKKSG FLV +GL+ E EI +TLAFLAGVM WSQ
Sbjct  61   YFNFVHEFVTILLDSAILFYAILPWFWKKSGSFLVLVGLDEENEIFNTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTTWLFF  149



>ref|XP_010669929.1| PREDICTED: CAAX prenyl protease 1 homolog [Beta vulgaris subsp. 
vulgaris]
Length=425

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPY+EAVVGFMILMY FETYLD+RQHAA KLPTLPKPL+GVISQEKFEKSRAYS+DKS
Sbjct  1    MTFPYLEAVVGFMILMYFFETYLDLRQHAAHKLPTLPKPLLGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTI++DS ILYFG+LPWFWKK+GDFLV  G + E EILHTLAFLAGVM WSQ
Sbjct  61   GFHFVHEFVTIVLDSGILYFGLLPWFWKKAGDFLVHAGFDAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T+ LF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTILLF  148



>ref|XP_009111448.1| PREDICTED: CAAX prenyl protease 1 homolog [Brassica rapa]
Length=424

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFMI+MYIFETYLD+RQH+ALKLP+LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSA+L+FGILPWFWK SG FL  +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAMLFFGILPWFWKLSGGFLPMVGLDPENEILHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIETRHGFNKQTIWMF  148



>ref|XP_009400731.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 135/149 (91%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+EAV+GFMI MY FETYLDIRQHAALKL  LPKPL GVISQEKFE++RAYSIDKS
Sbjct  1    MAFPYLEAVLGFMIFMYFFETYLDIRQHAALKLTNLPKPLEGVISQEKFERARAYSIDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HE VTILMD+AILYFGILPWFWK SG+ + +LGL+ E EI+HTL+FLAGVM WSQ
Sbjct  61   GFHFIHEAVTILMDTAILYFGILPWFWKVSGNLVAYLGLDAENEIMHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTVWLFF  149



>emb|CDY48517.1| BnaA09g00060D [Brassica napus]
Length=424

 Score =   241 bits (616),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFMI+MYIFETYLD+RQH+ALKLP+LPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDMRQHSALKLPSLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSA+L+FG+LPWFWK SG FL  +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAMLFFGVLPWFWKLSGGFLPMVGLDPENEILHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIETRHGFNKQTIWMF  148



>ref|XP_010556569.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010556570.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Tarenaya 
hassleriana]
Length=424

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYME VVGFMI+MYI E YLD+RQH+ALKLPTLPK L+GVISQEKFEKSRAYS++KS
Sbjct  1    MAFPYMETVVGFMIMMYILEMYLDLRQHSALKLPTLPKTLIGVISQEKFEKSRAYSLEKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFV+EFVTILMDSAIL+FGILPWFWK SGDFL  +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   YFHFVYEFVTILMDSAILFFGILPWFWKISGDFLPLVGLDPENEILHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T+WLF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLF  148



>emb|CDX74353.1| BnaA03g26940D [Brassica napus]
Length=424

 Score =   241 bits (614),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFMI+MY+FETYLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG FL  +GL+ E EILHTL+FLAG+M WSQ
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKISGGFLPIVGLDPENEILHTLSFLAGLMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_004306744.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=426

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  160  AFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSD  339
            +FP++E+V+GFMILMY FETYLD RQH+ALKLPTLPK L GVISQEKFEKSRAYS++KS 
Sbjct  4    SFPFLESVIGFMILMYFFETYLDTRQHSALKLPTLPKTLEGVISQEKFEKSRAYSLEKSH  63

Query  340  FHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQI  519
            FHFVHEFVTILMDSAIL+F +LPWFWKKSGDF+V  GLN E EILHTLAFLAGV  WSQI
Sbjct  64   FHFVHEFVTILMDSAILFFRVLPWFWKKSGDFVVLAGLNAENEILHTLAFLAGVTIWSQI  123

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            TDLPFSLYSTFV+EARHGFNK T+WLFF
Sbjct  124  TDLPFSLYSTFVVEARHGFNKQTIWLFF  151



>ref|XP_010112964.1| CAAX prenyl protease 1-like protein [Morus notabilis]
 gb|EXC35123.1| CAAX prenyl protease 1-like protein [Morus notabilis]
Length=436

 Score =   241 bits (614),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +1

Query  124  VSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKF  303
            +  +L L +  ++     A  GFMILMY FETYLD+RQHAALKLPTLPK LVGVISQEKF
Sbjct  2    LPCFLLLFDGTLSGTPTHANTGFMILMYFFETYLDLRQHAALKLPTLPKTLVGVISQEKF  61

Query  304  EKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTL  483
            EKSRAYS+DKS FHFVHEFV+ILMDS+IL+FG+LPWFWKKSGDFLV +GLN E EILHTL
Sbjct  62   EKSRAYSLDKSHFHFVHEFVSILMDSSILFFGVLPWFWKKSGDFLVLVGLNAENEILHTL  121

Query  484  AFLAGVMFWSQITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            AFLAGVM WSQITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  122  AFLAGVMIWSQITDLPFSLYSTFVIEARHGFNKQTIWLFF  161



>emb|CDX91888.1| BnaC03g31900D [Brassica napus]
Length=424

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFM++MY+FETYLD+RQH ALKLPTLPK LVGVISQ+KFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMVVMYVFETYLDLRQHTALKLPTLPKTLVGVISQDKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG FL  +GL+ E EILHTL+FLAGVM WSQ
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKISGAFLPMVGLDPENEILHTLSFLAGVMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_009134527.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Brassica 
rapa]
Length=424

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFMI+MY+FETYLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG FL  +GL+ E EI+HTL+FLAG+M WSQ
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKISGGFLPMVGLDPENEIMHTLSFLAGLMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_009134526.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Brassica 
rapa]
Length=455

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFMI+MY+FETYLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYVFETYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG FL  +GL+ E EI+HTL+FLAG+M WSQ
Sbjct  61   HFHFVHEFVTILMDSAILFFGILPWFWKISGGFLPMVGLDPENEIMHTLSFLAGLMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_009393943.1| PREDICTED: CAAX prenyl protease 1 homolog [Musa acuminata subsp. 
malaccensis]
Length=425

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+EAV+GFMI MY+FETYLDIRQHAALKLP LPKPL GVIS+EKFEK+RAYSIDKS
Sbjct  1    MAFPYLEAVLGFMIFMYLFETYLDIRQHAALKLPNLPKPLEGVISREKFEKARAYSIDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HE VTILMD+AILYFG+LPWFWK SG+ + +LGL+ E EI+HTL+FLAGVM WSQ
Sbjct  61   YFHFIHEAVTILMDTAILYFGLLPWFWKLSGNLVAYLGLDAENEIIHTLSFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFVIEARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLFF  149



>ref|XP_008346138.1| PREDICTED: CAAX prenyl protease 1 homolog [Malus domestica]
Length=424

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFP++EAV+GFMI +Y FETYLD+RQHAA KLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMISLYFFETYLDLRQHAAHKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+F +LPWFWK+S DF+   GLN E EI HTLAFL GVM WSQ
Sbjct  61   RFHFVHEFVTILMDSAILFFRVLPWFWKRSADFVALAGLNAENEIWHTLAFLGGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFV+EARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVVEARHGFNKQTIWLFF  149



>ref|XP_004306743.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=424

 Score =   238 bits (607),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFP++EAV+GFMILMY FETYLD+RQHAALKLPTLP+ L GVISQEKFEKSRAY +++S
Sbjct  1    MAFPFLEAVIGFMILMYNFETYLDLRQHAALKLPTLPRTLEGVISQEKFEKSRAYCLERS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
            +FHFVH+FVT+LMD+AIL++ ILPWFWKKSGDF+V  GLN E EI HTL+FLAGVM W Q
Sbjct  61   NFHFVHDFVTLLMDTAILFYRILPWFWKKSGDFVVLAGLNAENEIRHTLSFLAGVMIWEQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T+WLF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLF  148



>ref|XP_009349805.1| PREDICTED: CAAX prenyl protease 1 homolog [Pyrus x bretschneideri]
Length=424

 Score =   238 bits (606),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFP++EAV+GFMI +Y FETYLD+RQHAA KLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPFLEAVIGFMISLYFFETYLDLRQHAAHKLPTLPKTLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+F +LPWFWK+S DF+   GLN E EI HTLAFL GVM WSQ
Sbjct  61   RFHFVHEFVTILMDSAILFFRVLPWFWKRSADFVALAGLNAENEIWHTLAFLGGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            ITDLPFSLYSTFV+EARHGFNK T+WLFF
Sbjct  121  ITDLPFSLYSTFVVEARHGFNKQTIWLFF  149



>ref|XP_003624056.1| CAAX prenyl protease-like protein [Medicago truncatula]
 gb|AES80274.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=426

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 129/149 (87%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPYMEAVVGFMILMYIFE+YLD+RQH ALKLPTLPK L GVISQEKFEKSRAYS+DKS
Sbjct  1    MAFPYMEAVVGFMILMYIFESYLDLRQHKALKLPTLPKSLEGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVH  VTI+ DS ILYF +LPWFWKKSGDF+   GLN E EI HTL FLAG+M WSQ
Sbjct  61   HFHFVHALVTIITDSTILYFKVLPWFWKKSGDFVTLAGLNAENEIFHTLGFLAGLMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
             TDLPFSLYSTFVIE+RHGFNK T WLFF
Sbjct  121  TTDLPFSLYSTFVIESRHGFNKQTPWLFF  149



>gb|KFK30712.1| hypothetical protein AALP_AA6G017800 [Arabis alpina]
Length=424

 Score =   236 bits (601),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFMI+MYIFE+YLD+RQH ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFESYLDLRQHTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK  G  L  LGL+ E EILHTL+FLAGV  WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKMCGGVLPMLGLDPENEILHTLSFLAGVTAWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_010427521.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ E EILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKISGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_010456236.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   235 bits (600),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ E EILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKISGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_010422802.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelina sativa]
Length=424

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPYMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ E EILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKISGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|NP_567212.1| CAAX prenyl protease 1 homolog [Arabidopsis thaliana]
 sp|Q8RX88.1|FACE1_ARATH RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=AtFACE-1; Short=FACE-1; 
AltName: Full=Prenyl protein-specific endoprotease 
1; AltName: Full=Zinc metalloproteinase Ste24 homolog; Short=AtSTE24 
[Arabidopsis thaliana]
 gb|AAL90896.1| AT4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AAP21163.1| At4g01320/F2N1_21 [Arabidopsis thaliana]
 gb|AEE82008.1| peptidase family M48 family protein [Arabidopsis thaliana]
Length=424

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ E EILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKMSGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>gb|AAK39514.1|AF353722_1 CaaX processing zinc-metallo endoprotease [Arabidopsis thaliana]
Length=424

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ E EILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKMSGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_006286757.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
 gb|EOA19655.1| hypothetical protein CARUB_v10003198mg [Capsella rubella]
Length=424

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ E EILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKISGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_002874990.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51249.1| ATSTE24 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ E EILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFGILPWFWKISGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_006647687.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryza brachyantha]
Length=425

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HE VTILMD+ ILY+ +LPWFWKKSG+    +GLN E EI+HTLAFLAGVM WSQ
Sbjct  61   KFHFIHEAVTILMDTTILYYRVLPWFWKKSGELATNVGLNAENEIIHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEA+HGFNK T+WLF
Sbjct  121  ITDLPFSLYSTFVIEAKHGFNKQTIWLF  148



>ref|XP_002454476.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
 gb|EES07452.1| hypothetical protein SORBIDRAFT_04g031850 [Sorghum bicolor]
Length=425

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHE VTILMD+ ILY+ +LPWFWKKSG+ +  +GLN E EI+HTLAFLAG M WSQ
Sbjct  61   YFHFVHEAVTILMDTTILYYRVLPWFWKKSGELVTNVGLNAENEIIHTLAFLAGAMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T+WLF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLF  148



>gb|EEC73787.1| hypothetical protein OsI_08473 [Oryza sativa Indica Group]
Length=425

 Score =   230 bits (586),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FMILMYIFETYLDIRQH ALK PTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKEPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HE VTILMD+ ILY+ +LPW WKKSG+     GLN E EILHTLAFLAGVM WSQ
Sbjct  61   KFHFIHEAVTILMDTTILYYRVLPWVWKKSGELATNAGLNAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEA+HGFNK T+WLF
Sbjct  121  ITDLPFSLYSTFVIEAKHGFNKQTIWLF  148



>ref|XP_004492786.1| PREDICTED: CAAX prenyl protease 1 homolog [Cicer arietinum]
Length=432

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +1

Query  169  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  348
            YMEAVVGFMILMYIFETYLD+RQH ALKLPTLPK L GVI+QEKFEKSRAYS+DKS FHF
Sbjct  11   YMEAVVGFMILMYIFETYLDLRQHVALKLPTLPKSLKGVINQEKFEKSRAYSLDKSHFHF  70

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDL  528
            +H FVTI+ DS ILYF +LPWFWKKSGDF    GLN E EILHTLAFLAG+M WSQ TDL
Sbjct  71   IHAFVTIVTDSTILYFRVLPWFWKKSGDFATLAGLNAENEILHTLAFLAGLMIWSQTTDL  130

Query  529  PFSLYSTFVIEARHGFNKXTMWLFF  603
            PFSLYSTFVIE RHGFNK T WLFF
Sbjct  131  PFSLYSTFVIEDRHGFNKQTPWLFF  155



>ref|NP_001047739.1| Os02g0680400 [Oryza sativa Japonica Group]
 sp|Q6EPN8.1|FACE1_ORYSJ RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=FACE-1; AltName: 
Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc 
metalloproteinase Ste24 homolog [Oryza sativa Japonica 
Group]
 dbj|BAD29382.1| putative Ste24p [Oryza sativa Japonica Group]
 dbj|BAF09653.1| Os02g0680400 [Oryza sativa Japonica Group]
 gb|EEE57578.1| hypothetical protein OsJ_07930 [Oryza sativa Japonica Group]
Length=425

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+HE VTILMD+ ILY+ +LPW WKKSG+     GLN E EILHTLAFLAGVM WSQ
Sbjct  61   KFHFIHEAVTILMDTTILYYRVLPWVWKKSGELATNAGLNAENEILHTLAFLAGVMIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEA+HGFNK T+WLF
Sbjct  121  ITDLPFSLYSTFVIEAKHGFNKQTIWLF  148



>gb|AAL07084.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=424

 Score =   229 bits (585),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAYS+DKS
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMDSAIL+F ILPWFWK SG  L  LGL+ E EILHTL+FLAGVM WSQ
Sbjct  61   YFHFVHEFVTILMDSAILFFWILPWFWKMSGAVLPRLGLDPENEILHTLSFLAGVMTWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  ITDLPFSLYSTFVIESRHGFNKQTIWMF  148



>ref|XP_006828772.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
 gb|ERM96188.1| hypothetical protein AMTR_s00001p00094700 [Amborella trichopoda]
Length=424

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PYME+VVGFM+LMYIFETYLD+RQHAALKLPTLP+PL GV+SQ+KFEKS+AYS+DKS
Sbjct  1    MALPYMESVVGFMVLMYIFETYLDLRQHAALKLPTLPRPLHGVVSQDKFEKSQAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHF+H  VTI+MD +IL FG+LPWFW+KS   LV++GLN E EI+HTLAFLAGVM WSQ
Sbjct  61   HFHFIHGVVTIVMDVSILLFGVLPWFWQKSEAVLVYMGLNPENEIVHTLAFLAGVMLWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            IT+LPFSLYSTFVIE RHGFNK T+WLFF
Sbjct  121  ITELPFSLYSTFVIEERHGFNKQTIWLFF  149



>ref|XP_004953446.1| PREDICTED: CAAX prenyl protease 1 homolog [Setaria italica]
Length=425

 Score =   228 bits (581),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FMILMYIFETYLDIRQH ALKLPTLPKPL+GVIS EKF++SR YS+DKS
Sbjct  1    MALPYLEAVLCFMILMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFKRSRDYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHE VTILMD+ ILY+ +LPWFWKKSG+ +  +GLN E EI+HTLAFLAG M WSQ
Sbjct  61   HFHFVHEAVTILMDTTILYYRVLPWFWKKSGELITNVGLNAENEIIHTLAFLAGAMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T+WLF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLF  148



>ref|NP_001131195.1| uncharacterized protein LOC100192503 [Zea mays]
 gb|ACF79503.1| unknown [Zea mays]
 gb|ACG28474.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FMI MYIFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMIFMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHE VTILMD+ ILY+ +LPWFWKKSG+ +  +GL+ E EI+HTLAFLAG M WSQ
Sbjct  61   YFHFVHEAVTILMDTTILYYRVLPWFWKKSGELVTSVGLSAENEIIHTLAFLAGSMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T+WLF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLF  148



>gb|AFW63375.1| CAAX prenyl protease 1 [Zea mays]
Length=628

 Score =   229 bits (584),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FMI MYIFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  204  MALPYLEAVLCFMIFMYIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  263

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHE VTILMD+ ILY+ +LPWFWKKSG+ +  +GL+ E EI+HTLAFLAG M WSQ
Sbjct  264  YFHFVHEAVTILMDTTILYYRVLPWFWKKSGELVTSVGLSAENEIIHTLAFLAGSMVWSQ  323

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T+WLF
Sbjct  324  ITDLPFSLYSTFVIEARHGFNKQTIWLF  351



>gb|KCW78104.1| hypothetical protein EUGRSUZ_D02317 [Eucalyptus grandis]
Length=411

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  193  MILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEFVTIL  372
            MILM+ FETYLD+RQHAA KLPTLPKPL GVI QEKF+KSRAYS+DKS FHF+HEFV+IL
Sbjct  1    MILMHFFETYLDLRQHAAYKLPTLPKPLEGVIGQEKFQKSRAYSLDKSRFHFLHEFVSIL  60

Query  373  MDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTF  552
            MDSAIL FGILPWFWKKSG+FLV  GLN E EILHTL+FLAGVM WSQITDLPFSLYSTF
Sbjct  61   MDSAILLFGILPWFWKKSGEFLVLAGLNAENEILHTLSFLAGVMIWSQITDLPFSLYSTF  120

Query  553  VIEARHGFNKXTMWLFF  603
            VIEARHGFNK T+WLFF
Sbjct  121  VIEARHGFNKQTVWLFF  137



>ref|XP_003570103.1| PREDICTED: CAAX prenyl protease 1 homolog [Brachypodium distachyon]
Length=425

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FMIL+YIFETYL+IRQH ALKLPTLPKPLVGVIS EKFE+SRAYS+DKS
Sbjct  1    MALPYLEAVLCFMILLYIFETYLNIRQHRALKLPTLPKPLVGVISGEKFERSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
            +F+FV E VTI  D  ILY+ +LPWFWKKSG+    +GLN E EI+HTLAFLAGVM WSQ
Sbjct  61   NFNFVREAVTITSDIIILYYKVLPWFWKKSGELATNIGLNAENEIIHTLAFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T+WLF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTIWLF  148



>ref|XP_004308344.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
 ref|XP_011468984.1| PREDICTED: CAAX prenyl protease 1 homolog [Fragaria vesca subsp. 
vesca]
Length=425

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFP+++ VVG MILMYIFETYLD+RQH+ALKLPTLPK L GVISQEKFEKSRAY +++S
Sbjct  1    MAFPFLDVVVGSMILMYIFETYLDLRQHSALKLPTLPKTLEGVISQEKFEKSRAYRLERS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFV E V ILMD AIL+F +LPWFWKKSG F+  +GLN E EILHTLAFLAGV+ W +
Sbjct  61   HFHFVCELVRILMDLAILFFKVLPWFWKKSGHFVALVGLNEENEILHTLAFLAGVLIWLE  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            IT LPFSLYS FVIEARHGFNK T+WLFF
Sbjct  121  ITSLPFSLYSIFVIEARHGFNKRTIWLFF  149



>ref|XP_008643874.1| PREDICTED: CAAX prenyl protease 1 isoform X2 [Zea mays]
Length=425

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA  Y+EAV+ FMILM+IFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALSYLEAVLCFMILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMD+ ILY+  +PWFWKKSG+ +  +GLN E EI+HTLAFLAG M WS+
Sbjct  61   YFHFVHEFVTILMDTTILYYRSVPWFWKKSGELVTNVGLNAENEIIHTLAFLAGAMVWSK  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDL FS+YSTFVIEARHGFNK T+WLF
Sbjct  121  ITDLSFSIYSTFVIEARHGFNKQTIWLF  148



>ref|XP_008643873.1| PREDICTED: CAAX prenyl protease 1 isoform X1 [Zea mays]
 gb|ACN31462.1| unknown [Zea mays]
 gb|AFW72802.1| CAAX prenyl protease 1 [Zea mays]
Length=437

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA  Y+EAV+ FMILM+IFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS
Sbjct  1    MALSYLEAVLCFMILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFVHEFVTILMD+ ILY+  +PWFWKKSG+ +  +GLN E EI+HTLAFLAG M WS+
Sbjct  61   YFHFVHEFVTILMDTTILYYRSVPWFWKKSGELVTNVGLNAENEIIHTLAFLAGAMVWSK  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDL FS+YSTFVIEARHGFNK T+WLF
Sbjct  121  ITDLSFSIYSTFVIEARHGFNKQTIWLF  148



>emb|CAB80941.1| putative CAAX prenyl protease [Arabidopsis thaliana]
Length=459

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 130/155 (84%), Gaps = 7/155 (5%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA P+ME VVGFMI+MYIFETYLD+RQ  ALKLPTLPK LVGVISQEKFEKSRAY    +
Sbjct  1    MAIPFMETVVGFMIVMYIFETYLDLRQLTALKLPTLPKTLVGVISQEKFEKSRAYRDIIT  60

Query  337  D-------FHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLA  495
            +       FHFVHEFVTILMDSAIL+FGILPWFWK SG  L  LGL+ E EILHTL+FLA
Sbjct  61   ENFNICSYFHFVHEFVTILMDSAILFFGILPWFWKMSGAVLPRLGLDPENEILHTLSFLA  120

Query  496  GVMFWSQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            GVM WSQITDLPFSLYSTFVIE+RHGFNK T+W+F
Sbjct  121  GVMTWSQITDLPFSLYSTFVIESRHGFNKQTIWMF  155



>gb|AIC32889.1| STE24 [Puccinellia tenuiflora]
Length=424

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FMIL YIFETYL+IRQH ALKLPTLPK L GVIS EKFEK+RAYS+DKS
Sbjct  1    MALPYLEAVLCFMILNYIFETYLNIRQHRALKLPTLPKSLAGVISGEKFEKARAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
            +F+FV E VTI+ D  ILY+ +LPWFWKKSG+    +GLN E EI+HTLAFLAGVM WSQ
Sbjct  61   NFNFVREGVTIVFDITILYYKVLPWFWKKSGELATNVGLNAENEIIHTLAFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIE RHGFNK T+WLF
Sbjct  121  ITDLPFSLYSTFVIETRHGFNKQTIWLF  148



>gb|KDP28583.1| hypothetical protein JCGZ_14354 [Jatropha curcas]
Length=423

 Score =   215 bits (548),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            M FPY+EAV+  MIL+YIFETYL +R+HA LKLPTLPK L GV+SQEKFEKSRAYS+DKS
Sbjct  1    MEFPYLEAVLVVMILIYIFETYLALREHATLKLPTLPKALEGVVSQEKFEKSRAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             F FVH FVT L DSAILYF ILPWFWKKSG+FL+ LGLNTE EILHTLAFLAGVM WSQ
Sbjct  61   RFGFVHGFVTTLTDSAILYFRILPWFWKKSGNFLLLLGLNTENEILHTLAFLAGVMMWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            +T+LPFSLYSTFVIEARHGFNK T+ LFF
Sbjct  121  VTELPFSLYSTFVIEARHGFNKQTIGLFF  149



>emb|CAL26913.1| CAAX peptidase [Hordeum vulgare subsp. vulgare]
Length=425

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FMIL YIFETYL+IRQH ALKLPTLPK L  VIS EKFE++RAYS+DKS
Sbjct  1    MALPYLEAVLCFMILNYIFETYLNIRQHRALKLPTLPKSLAKVISHEKFEQARAYSLDKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
            +F+FV E +TI+ D  ILY+ +LPW WK SG  +  +GLN E EI+HTLAFLAGVM WSQ
Sbjct  61   NFNFVREAITIVCDIIILYYKVLPWLWKNSGVLVTNVGLNAENEIIHTLAFLAGVMVWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T WLF
Sbjct  121  ITDLPFSLYSTFVIEARHGFNKQTFWLF  148



>ref|NP_001152504.1| CAAX prenyl protease 1 [Zea mays]
 gb|ACG47950.1| CAAX prenyl protease 1 [Zea mays]
Length=425

 Score =   204 bits (520),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +1

Query  193  MILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEFVTIL  372
            MILM+IFETYLDIRQH ALKLPTLPKPL+GVIS EKFE+SRAYS+DKS FHFVHEFVTIL
Sbjct  1    MILMFIFETYLDIRQHRALKLPTLPKPLLGVISDEKFERSRAYSLDKSYFHFVHEFVTIL  60

Query  373  MDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTF  552
            MD+ ILY+  +PWFWKKSG+ +  +GLN E EI+HTLAFLAG M WS+ITDL FS+YSTF
Sbjct  61   MDTTILYYRSVPWFWKKSGELVTNVGLNAENEIIHTLAFLAGAMVWSKITDLSFSIYSTF  120

Query  553  VIEARHGFNKXTMWLF  600
            VIEARHGFNK T+WLF
Sbjct  121  VIEARHGFNKQTIWLF  136



>gb|KHN29321.1| CAAX prenyl protease 1 like [Glycine soja]
Length=375

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +1

Query  280  GVISQEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNT  459
            GVISQEKFEKSRAYS+DKS FHFVHEFVTI+ DS ILYFG+LPWFWKKSGDF+   G N 
Sbjct  31   GVISQEKFEKSRAYSLDKSHFHFVHEFVTIVTDSTILYFGVLPWFWKKSGDFMTIAGFNA  90

Query  460  EXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            E EILHTLAFLAG+M WSQITDLPFSLYSTFVIEARHGFNK T WLFF
Sbjct  91   ENEILHTLAFLAGLMIWSQITDLPFSLYSTFVIEARHGFNKQTPWLFF  138



>ref|XP_001780822.1| predicted protein [Physcomitrella patens]
 gb|EDQ54379.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +1

Query  148  NSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSI  327
             S   FPY+EAVVGFM+ MY+FETYLD+RQHAALKLPTLP PLVG++S EKFEK++AYS+
Sbjct  2    ESPAPFPYLEAVVGFMVFMYLFETYLDMRQHAALKLPTLPAPLVGIVSMEKFEKAQAYSL  61

Query  328  DKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMF  507
            +KS FHFVH  V I+ +SA L  G+LPW W KSG  +  LG +   EILHTLAFLA +  
Sbjct  62   EKSRFHFVHAAVGIVEESATLLLGLLPWTWDKSGSLVGKLGFDQSSEILHTLAFLAVITL  121

Query  508  WSQITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            WSQ+ +LPFSLYSTFVIEARHGFNK T+ LFF
Sbjct  122  WSQVLELPFSLYSTFVIEARHGFNKQTLLLFF  153



>ref|XP_001783632.1| predicted protein [Physcomitrella patens]
 gb|EDQ51527.1| predicted protein [Physcomitrella patens]
Length=428

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = +1

Query  148  NSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSI  327
             ++  FPY+EAVVGFM+ MY+ ETYLDIRQH ALKL  LP PL G++SQEKFEK++AYS+
Sbjct  2    EASAPFPYLEAVVGFMLFMYMLETYLDIRQHGALKLSNLPAPLKGIVSQEKFEKAQAYSL  61

Query  328  DKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMF  507
            DKS FHFVH  V I+ +SAIL  G+LPW W KSG  +  LG + + EIL TL+FLA    
Sbjct  62   DKSRFHFVHAAVNIVEESAILLLGLLPWAWDKSGSLVGKLGFDEKSEILQTLSFLAVTTL  121

Query  508  WSQITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            WSQI +LPFSLYSTFVIEARHGFNK T+WLF 
Sbjct  122  WSQILELPFSLYSTFVIEARHGFNKQTIWLFL  153



>ref|XP_002961362.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
 gb|EFJ36622.1| hypothetical protein SELMODRAFT_266600 [Selaginella moellendorffii]
Length=424

 Score =   184 bits (466),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+E+VVGFMI MY  E+YL +RQ+ ALKLPTLP  L GV+SQEKFEKSRAY+I+KS
Sbjct  1    MAFPYLESVVGFMIFMYFVESYLHLRQYRALKLPTLPPTLEGVVSQEKFEKSRAYTIEKS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             F F+H   TI+ +  +L   ILPW W KSGD  V LG + + EI  TLAFL     WSQ
Sbjct  61   RFQFIHSVWTIVEECCMLLLKILPWIWMKSGDLAVRLGFDPQNEIAQTLAFLVLTTIWSQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            IT+LPF+LYSTFVIE RHGFNK T+WLFF
Sbjct  121  ITELPFALYSTFVIEERHGFNKQTIWLFF  149



>gb|KEH18809.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=436

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MAFPY+EAV+GF ILMY FETYL++RQ  A KL TLPK L GVIS++ F+K+R+YS+D S
Sbjct  1    MAFPYLEAVIGFKILMYFFETYLEVRQLRANKLTTLPKTLEGVISEDTFQKTRSYSLDHS  60

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
             FHFV +FVTI+ DSAIL+FG++PWFWKKS DF+  +GLN + EILH++AFLAG M   Q
Sbjct  61   RFHFVCQFVTIVRDSAILFFGVMPWFWKKSEDFMTLIGLNADNEILHSIAFLAGCMILLQ  120

Query  517  ITDLPFSLYSTFVIEARHGFNKXT  588
            IT LP SLY  FV+EA H  NK T
Sbjct  121  ITKLPLSLYFLFVLEAHHDCNKST  144



>ref|XP_003622452.1| CAAX prenyl protease-like protein [Medicago truncatula]
Length=195

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 95/125 (76%), Gaps = 4/125 (3%)
 Frame = +1

Query  160  AFPYMEAVV----GFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSI  327
              P  +AV+    GF ILMY FETYL++RQ  A KL TLPK L GVIS++ F+K+R+YS+
Sbjct  53   GLPQPKAVLVANDGFKILMYFFETYLEVRQLRANKLTTLPKTLEGVISEDTFQKTRSYSL  112

Query  328  DKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMF  507
            D S FHFV +FVTI+ DSAIL+FG++PWFWKKS DF+  +GLN + EILH++AFLAG M 
Sbjct  113  DHSRFHFVCQFVTIVRDSAILFFGVMPWFWKKSEDFMTLIGLNADNEILHSIAFLAGCMI  172

Query  508  WSQIT  522
              Q++
Sbjct  173  LLQVS  177



>gb|EMT24778.1| CAAX prenyl protease 1-like protein [Aegilops tauschii]
Length=355

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 81/148 (55%), Gaps = 46/148 (31%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKS  336
            MA PY+EAV+ FM L YIFETYL+IRQH A             +      KS A      
Sbjct  1    MALPYLEAVLCFMTLNYIFETYLNIRQHRA-------------LKLPTLPKSLA------  41

Query  337  DFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQ  516
                                       KKSG  +  +GLN E EI+HTLAFLAGVM WSQ
Sbjct  42   ---------------------------KKSGVLVTNVGLNAENEIIHTLAFLAGVMVWSQ  74

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            ITDLPFSLYSTFVIEARHGFNK T WLF
Sbjct  75   ITDLPFSLYSTFVIEARHGFNKQTFWLF  102



>gb|KHF98917.1| E3 ubiquitin-protein ligase RHF2A -like protein [Gossypium arboreum]
Length=362

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 78/119 (66%), Gaps = 27/119 (23%)
 Frame = +1

Query  226  DIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGIL  405
            D+RQHA LKLPTLPK L  VISQEKFEKSRAYS+DK                        
Sbjct  5    DLRQHATLKLPTLPKTLEAVISQEKFEKSRAYSLDK------------------------  40

Query  406  PWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNK  582
                 KSG FL  LGL  E EILHTL+FLAG M WSQITDLPFSLYSTFVIEARHGFNK
Sbjct  41   ---RLKSGTFLPLLGLIEENEILHTLSFLAGAMIWSQITDLPFSLYSTFVIEARHGFNK  96



>emb|CDH48818.1| prenyl protease [Lichtheimia corymbifera JMRC:FSU:9682]
Length=447

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 87/146 (60%), Gaps = 1/146 (1%)
 Frame = +1

Query  169  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  348
            Y + V+GF   +Y FE YL+ RQH    +   P+ L  ++++  F KS++Y+++KS F F
Sbjct  16   YKDYVLGFSCAVYAFEQYLNYRQHCRYLMRERPQDLADIVNETDFSKSQSYNLEKSRFAF  75

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQITD  525
            V      L     L++ +LPW W  SG  L  + G  +E EIL ++ F+    F S  T 
Sbjct  76   VENAYKQLEILLQLHYDVLPWLWDFSGRLLSQYAGYGSEYEILQSMVFMTVYSFISTATS  135

Query  526  LPFSLYSTFVIEARHGFNKXTMWLFF  603
            LPFSLYSTFVIE RHGFNK T+ LFF
Sbjct  136  LPFSLYSTFVIEQRHGFNKQTLGLFF  161



>ref|XP_001623710.1| predicted protein [Nematostella vectensis]
 gb|EDO31610.1| predicted protein [Nematostella vectensis]
Length=450

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 87/142 (61%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  354
            AV  F+ L+Y++E+YL  RQH   K        +  V+ ++ FEK+R Y +D+S + F H
Sbjct  7    AVFVFLWLVYLWESYLSYRQHKLFKETEDIPVELKDVLEKDTFEKARKYQLDRSTYGFYH  66

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  S IL  G +P+ W  SG+ +   G  TE EI H+++FL   + +S ITDLP+
Sbjct  67   GIYSQIETSVILLLGGIPFLWNISGNLIAKFGFTTEYEITHSMSFLICAVIFSTITDLPW  126

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLYSTFVIE RHGFNK T+  F
Sbjct  127  SLYSTFVIEERHGFNKQTLGFF  148



>gb|ETO80780.1| hypothetical protein F444_04815 [Phytophthora parasitica P1976]
Length=484

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 90/187 (48%), Gaps = 36/187 (19%)
 Frame = +1

Query  151  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  291
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIKGLGSYRMKKDEKE  79

Query  292  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  402
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  403  LPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNK  582
            LP+ W  SG  L+ LGL+ + EI   L  L        +  +PF LYSTFV+EARHGFNK
Sbjct  140  LPFMWTMSGKALLSLGLDADNEIYRALMLLTLTTIRDTLVGIPFGLYSTFVVEARHGFNK  199

Query  583  XTMWLFF  603
             T+ LFF
Sbjct  200  QTLGLFF  206



>gb|ETL45293.1| hypothetical protein L916_04606 [Phytophthora parasitica]
Length=484

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 90/187 (48%), Gaps = 36/187 (19%)
 Frame = +1

Query  151  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  291
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIEGLGSYRMKKDEKE  79

Query  292  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  402
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  403  LPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNK  582
            LP+ W  SG  L+ LGL+ + EI   L  L        +  +PF LYSTFV+EARHGFNK
Sbjct  140  LPFMWTMSGKALLSLGLDADNEIYRALMLLTLTTIRDTLVGIPFGLYSTFVVEARHGFNK  199

Query  583  XTMWLFF  603
             T+ LFF
Sbjct  200  QTLGLFF  206



>ref|XP_008902128.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
 gb|ETN12113.1| hypothetical protein PPTG_09033 [Phytophthora parasitica INRA-310]
Length=484

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 90/187 (48%), Gaps = 36/187 (19%)
 Frame = +1

Query  151  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  291
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIEGLGSYRMKKDEKE  79

Query  292  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  402
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  403  LPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNK  582
            LP+ W  SG  L+ LGL+ + EI   L  L        +  +PF LYSTFV+EARHGFNK
Sbjct  140  LPFMWTMSGKALLSLGLDADNEIYRALMLLTLTTIRDTLVGIPFGLYSTFVVEARHGFNK  199

Query  583  XTMWLFF  603
             T+ LFF
Sbjct  200  QTLGLFF  206



>gb|ETL98448.1| hypothetical protein L917_04490 [Phytophthora parasitica]
 gb|ETM51609.1| hypothetical protein L914_04599 [Phytophthora parasitica]
 gb|ETP49699.1| hypothetical protein F442_04842 [Phytophthora parasitica P10297]
Length=484

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 90/187 (48%), Gaps = 36/187 (19%)
 Frame = +1

Query  151  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  291
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIEGLGSYRMKKDEKE  79

Query  292  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  402
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  403  LPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNK  582
            LP+ W  SG  L+ LGL+ + EI   L  L        +  +PF LYSTFV+EARHGFNK
Sbjct  140  LPFMWTMSGKALLSLGLDADNEIYRALMLLTLTTIRDTLVGIPFGLYSTFVVEARHGFNK  199

Query  583  XTMWLFF  603
             T+ LFF
Sbjct  200  QTLGLFF  206



>gb|ETK91894.1| hypothetical protein L915_04651 [Phytophthora parasitica]
 gb|ETP21822.1| hypothetical protein F441_04764 [Phytophthora parasitica CJ01A1]
Length=484

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 90/187 (48%), Gaps = 36/187 (19%)
 Frame = +1

Query  151  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  291
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIEGLGSYRMKKDEKE  79

Query  292  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  402
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  403  LPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNK  582
            LP+ W  SG  L+ LGL+ + EI   L  L        +  +PF LYSTFV+EARHGFNK
Sbjct  140  LPFMWTVSGKALLSLGLDADNEIYRALMLLTLTTIRDTLVGIPFGLYSTFVVEARHGFNK  199

Query  583  XTMWLFF  603
             T+ LFF
Sbjct  200  QTLGLFF  206



>emb|CEG66514.1| hypothetical protein RMATCC62417_03079 [Rhizopus microsporus]
Length=440

 Score =   112 bits (281),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 90/146 (62%), Gaps = 1/146 (1%)
 Frame = +1

Query  169  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  348
            Y + V+ F  ++Y FE YL+ RQH    +   P  L  ++++E F+KS+AY++DKS F F
Sbjct  11   YKQFVIVFSCIVYAFEQYLNYRQHCRYLMRHRPDELADIVTEEDFKKSQAYNLDKSRFSF  70

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTEXEILHTLAFLAGVMFWSQITD  525
            +  F   +    +L++  LP  W  SGD L  + G +T+ EILH++ FL     +S +T 
Sbjct  71   IESFYKQIETVLMLHYDALPKMWNFSGDLLYKISGYSTDYEILHSIVFLIIFTIFSTVTT  130

Query  526  LPFSLYSTFVIEARHGFNKXTMWLFF  603
             PF+ YSTFV+E +HGFNK T+ LFF
Sbjct  131  TPFNYYSTFVVEQKHGFNKQTVRLFF  156



>emb|CDS07769.1| hypothetical protein LRAMOSA01718 [Absidia idahoensis var. thermophila]
Length=447

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 86/146 (59%), Gaps = 1/146 (1%)
 Frame = +1

Query  169  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  348
            Y + V+GF   +Y FE YL+ RQH    +   P  L  ++++  F KS++Y+++KS F F
Sbjct  16   YKDYVLGFSCAVYAFEQYLNYRQHRRYLMRERPHDLADIVNETDFSKSQSYNLEKSRFAF  75

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQITD  525
            V      L     L++ +LPW W  SG  L  + G  +E EIL ++ F+    F S  T 
Sbjct  76   VENAYKQLEILLQLHYDVLPWLWDFSGRLLSQYAGYGSEYEILQSMVFMTVYSFISTATS  135

Query  526  LPFSLYSTFVIEARHGFNKXTMWLFF  603
            LPFSLYSTFVIE RHGFNK T+ LFF
Sbjct  136  LPFSLYSTFVIEQRHGFNKQTLGLFF  161



>emb|CEJ00851.1| hypothetical protein RMCBS344292_14897 [Rhizopus microsporus]
Length=440

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 90/146 (62%), Gaps = 1/146 (1%)
 Frame = +1

Query  169  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  348
            Y + V+ F  ++Y FE YL+ RQH    +   P  L  ++++E F+KS+AY++DKS F F
Sbjct  11   YKQFVIVFSCIVYAFEQYLNYRQHCRYLMRHRPDELADIVTEEDFKKSQAYNLDKSRFGF  70

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTEXEILHTLAFLAGVMFWSQITD  525
            +  F   +    +L++  LP  W  SGD L  + G +T+ EILH++ FL     +S +T 
Sbjct  71   IESFYKQVETVLMLHYDALPKMWNFSGDLLYKISGYSTDYEILHSIVFLIIFTIFSTVTT  130

Query  526  LPFSLYSTFVIEARHGFNKXTMWLFF  603
             PF+ YSTFV+E +HGFNK T+ LFF
Sbjct  131  TPFNYYSTFVVEQKHGFNKQTVKLFF  156



>ref|XP_004226161.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Ciona intestinalis]
Length=469

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 3/144 (2%)
 Frame = +1

Query  175  EAVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFV  351
            E+V+GF  ++Y++E+YL  RQH+           +  VI Q  F+KSR Y++DKS + F 
Sbjct  4    ESVLGFSWIVYLWESYLSKRQHSIYVNVQSVPKELTSVIDQSTFDKSRRYALDKSTYGFW  63

Query  352  HEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAF-LAGVMFWSQITDL  528
            +   + +  +AIL+ G LP+ W  SG  L  LG N+E EILH+L F L G +F   +T+L
Sbjct  64   NGLYSQIESTAILWLGGLPFLWAASGVVLEKLGYNSEHEILHSLVFTLLGSLF-GLVTEL  122

Query  529  PFSLYSTFVIEARHGFNKXTMWLF  600
            P+SLY TFV+E RHGFNK T+  F
Sbjct  123  PWSLYFTFVVEERHGFNKMTLGFF  146



>gb|EPB83925.1| hypothetical protein HMPREF1544_09315 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=442

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 89/146 (61%), Gaps = 1/146 (1%)
 Frame = +1

Query  169  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  348
            Y + V+GF +++Y+FE YL+ RQ+    +P  P  L  ++++E F+K++ Y+ DKS F F
Sbjct  13   YKQFVLGFTVIVYVFEQYLNYRQYTRYLMPKRPSELADIVTEEDFKKAQLYNYDKSRFAF  72

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTEXEILHTLAFLAGVMFWSQITD  525
            V     ++    IL+F  LP  W  +GD L  + G   E EIL +L F+      S +T 
Sbjct  73   VENLYKLIETMLILHFDGLPKIWDTAGDILFKVSGYGAEYEILQSLVFITLFTLISTVTS  132

Query  526  LPFSLYSTFVIEARHGFNKXTMWLFF  603
            +PFSLYSTFV+E RHGFN  T+ L+F
Sbjct  133  MPFSLYSTFVVEQRHGFNNQTIGLYF  158



>emb|CEP19164.1| hypothetical protein [Parasitella parasitica]
Length=442

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 89/146 (61%), Gaps = 1/146 (1%)
 Frame = +1

Query  169  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  348
            Y + V+ F  ++Y+FE YL+ RQH    +P  P  L  ++S++ F+K++AY+ +KS F F
Sbjct  13   YKQFVLAFSCIVYVFEQYLNYRQHTRYLMPKRPSELADIVSEDDFKKAQAYNYEKSRFAF  72

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTEXEILHTLAFLAGVMFWSQITD  525
            V      +    +LY+  LP  W  SG+ L+ + G  +E EIL +L FL      S +T 
Sbjct  73   VEGLYKQVETVLMLYYDALPKIWNASGEILLKVSGYGSEYEILQSLVFLTLFSLISTVTQ  132

Query  526  LPFSLYSTFVIEARHGFNKXTMWLFF  603
            +PFSLYSTFV+E RHGFN  T+ L+F
Sbjct  133  MPFSLYSTFVVEQRHGFNNQTLGLYF  158



>gb|ETI52023.1| hypothetical protein F443_04763 [Phytophthora parasitica P1569]
Length=484

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 89/187 (48%), Gaps = 36/187 (19%)
 Frame = +1

Query  151  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  291
            SA   PY    + FM ++Y+FETYLDIRQH  L     PKPL   I              
Sbjct  20   SASPVPYFLGALVFMTVVYLFETYLDIRQHRKLHDKRFPKPLAEAIEGLGSYRMKKDEKE  79

Query  292  -----------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGI  402
                                   Q KF+KSRAY +DKS F FVH     L  SA L  G 
Sbjct  80   SEDDKKEESETQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEASAFLLLGY  139

Query  403  LPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNK  582
            LP+ W  S   L+ LGL+ + EI   L  L        +  +PF LYSTFV+EARHGFNK
Sbjct  140  LPFMWTMSDKALLSLGLDADNEIYRALMLLTLTTIRDTLVGIPFGLYSTFVVEARHGFNK  199

Query  583  XTMWLFF  603
             T+ LFF
Sbjct  200  QTLGLFF  206



>ref|XP_002900396.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
 gb|EEY60189.1| CAAX prenyl protease 1 [Phytophthora infestans T30-4]
Length=485

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 89/188 (47%), Gaps = 37/188 (20%)
 Frame = +1

Query  151  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------------  291
            S    PY    + FM ++Y+ ETYLDIRQH  L     PKPL   I              
Sbjct  20   STSPVPYFLGALIFMTVVYLLETYLDIRQHRKLHDKQFPKPLTEAIEGLGSYNIKKKDEK  79

Query  292  ------------------------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFG  399
                                    Q KF+KSRAY +DKS F FVH     L   A L  G
Sbjct  80   EPEDDKREDADAQEEEETTLLAAIQAKFDKSRAYGLDKSTFGFVHGVYNQLEAIAFLLLG  139

Query  400  ILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFN  579
             LP+ W  SG  L+FLGL+ + EI   L  L      + +  +PF LYSTFV+EARHGFN
Sbjct  140  YLPFVWTMSGKALLFLGLDADNEIYRALMLLTLTTIRNTLVGIPFGLYSTFVVEARHGFN  199

Query  580  KXTMWLFF  603
            K T+ LFF
Sbjct  200  KQTLGLFF  207



>dbj|GAN04268.1| metallopeptidase [Mucor ambiguus]
Length=442

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 1/146 (1%)
 Frame = +1

Query  169  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  348
            Y + V GF I++Y+FE YL+ RQ+    +P  P  L  ++++E F+K++ Y+ DKS F F
Sbjct  13   YKQFVEGFTIIVYVFEQYLNYRQYTRYLMPKRPSELADIVTEEDFKKAQLYNYDKSRFSF  72

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTEXEILHTLAFLAGVMFWSQITD  525
            V     ++    +L++  LP  W  +GD L  + G   E EILH+L FL      S IT 
Sbjct  73   VVNLWKLVETVLMLHYDGLPKIWDAAGDILFKVAGYGAEYEILHSLVFLTLFTLISTITS  132

Query  526  LPFSLYSTFVIEARHGFNKXTMWLFF  603
             PFSLYSTFV+E RHGFN  T+ L+F
Sbjct  133  TPFSLYSTFVVEQRHGFNNQTLKLYF  158



>gb|ELU11443.1| hypothetical protein CAPTEDRAFT_171238 [Capitella teleta]
Length=459

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 89/145 (61%), Gaps = 2/145 (1%)
 Frame = +1

Query  175  EAVVGFMILMYIFETYLDIRQHA--AlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  348
             AV+ F+ ++Y++ETYL  RQ       +  +P  L GV+ +E FEK+R Y++D+S F F
Sbjct  12   NAVLAFLWVVYVWETYLSYRQRELYRSSVGKIPVELDGVLEEETFEKARLYNLDRSVFGF  71

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDL  528
                 + +  S IL FG +P+ W+ SG  +   GL+ E EI  ++ FL G + +S I  L
Sbjct  72   WSGLYSQITTSLILVFGGIPFLWRISGSLIAQFGLDAEYEITQSMVFLVGSVLYSTIDGL  131

Query  529  PFSLYSTFVIEARHGFNKXTMWLFF  603
            P+S+YSTFVIE  HGFNK T+  FF
Sbjct  132  PWSIYSTFVIEELHGFNKQTLGFFF  156



>ref|XP_009532258.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
 gb|EGZ11925.1| hypothetical protein PHYSODRAFT_250864 [Phytophthora sojae]
Length=468

 Score =   107 bits (267),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 93/183 (51%), Gaps = 23/183 (13%)
 Frame = +1

Query  124  VSLYLQLG--NSAMAFPYMEAVVGFMILMYIFETYLDIRQHAA------lklptlpkplV  279
            V L+ + G   SA   PY +  + FM L+++FETYLD+RQH         K        +
Sbjct  8    VPLFREPGWRPSASPVPYFQGALVFMTLVFLFETYLDLRQHRKLHDKQFPKPLAEAIEGL  67

Query  280  GVISQE---------------KFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWF  414
            G  SQ+               KF+KSRAY +DKS F FV      L  +  L  G LP+ 
Sbjct  68   GSYSQKEEEEEETTLLEATRTKFDKSRAYGLDKSTFGFVSGGYNQLEATVFLLLGYLPFA  127

Query  415  WKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNKXTMW  594
            W  SG  L+ LGL+ + EI   L  L        +  +PF LYSTFV+EARHGFNK T+ 
Sbjct  128  WTMSGKALLALGLDADNEIYRALMLLTLTTLRDTLVGIPFGLYSTFVVEARHGFNKQTLG  187

Query  595  LFF  603
            LFF
Sbjct  188  LFF  190



>gb|ESA09906.1| hypothetical protein GLOINDRAFT_80760 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX73371.1| Ste24p [Rhizophagus irregularis DAOM 197198w]
Length=430

 Score =   107 bits (266),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 86/152 (57%), Gaps = 1/152 (1%)
 Frame = +1

Query  151  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-QEKFEKSRAYSI  327
             A   PY E V+ F   +Y FE YL +RQ+  L+ P  PK L  +   +EKF K++ Y +
Sbjct  9    KAQDTPYKEFVLAFSWAVYTFEQYLSVRQYRKLREPHPPKSLQDIEEVREKFRKTQEYGL  68

Query  328  DKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMF  507
            DK+ F FV      +  + ++ F ILPW W  SG++L + G   + EI  +L F   +  
Sbjct  69   DKAKFEFVSALFGQIQSTCMIVFDILPWLWNLSGEWLAYAGYGPDHEITQSLIFTVILTL  128

Query  508  WSQITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
             S +  LP SLY TFVIE RHGFNK T+ LFF
Sbjct  129  LSYLISLPLSLYFTFVIEERHGFNKMTLGLFF  160



>gb|KFM64976.1| CAAX prenyl protease 1-like protein, partial [Stegodyphus mimosarum]
Length=465

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 81/141 (57%), Gaps = 1/141 (1%)
 Frame = +1

Query  172  MEAVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHF  348
            M A++ F  ++YI+E YL  RQH  ++  T   P + GV+ Q  + K+R Y++DKS F F
Sbjct  35   MTAIIAFTWVVYIWEAYLSYRQHVVMQKVTSVPPELAGVMDQTTYNKARLYNLDKSRFSF  94

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDL  528
            V      +  +A+L FG +P+ W  SG      G   E EI HT+ F       + I DL
Sbjct  95   VSSLYEQVFQTAVLVFGGIPFLWSASGKVTAHFGYGKEHEITHTVVFALLGAIVNTIIDL  154

Query  529  PFSLYSTFVIEARHGFNKXTM  591
            P+S+Y TFVIE RHGFNK T+
Sbjct  155  PWSIYLTFVIEERHGFNKQTL  175



>gb|KFH71808.1| hypothetical protein MVEG_02102 [Mortierella verticillata NRRL 
6337]
Length=451

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 1/149 (1%)
 Frame = +1

Query  160  AFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSD  339
             FPY   V+GFM+L++ +E YL +R ++ L+    PK L   ++ E+F+K++AY  DK+ 
Sbjct  24   PFPYKAFVLGFMLLVFYWEEYLRLRHYSNLRSKECPKALREHVTDEEFQKAQAYGRDKAT  83

Query  340  FHFVHEFVTILMDSAILYFGILPWFWKKSGDFL-VFLGLNTEXEILHTLAFLAGVMFWSQ  516
            F FV   V  +  + +L    LPW W  SG  +    G  ++ EI  ++ F A     S 
Sbjct  84   FGFVSNLVDQIQSALMLVLDFLPWLWGVSGRVMFAATGFGSDYEITQSIIFFAMFSVIST  143

Query  517  ITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            I  LP SLYSTFVIE RHGFNK T+ LFF
Sbjct  144  ILSLPSSLYSTFVIEERHGFNKQTLKLFF  172



>ref|XP_002945691.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
 gb|EFJ52686.1| hypothetical protein VOLCADRAFT_78672 [Volvox carteri f. nagariensis]
Length=460

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 92/158 (58%), Gaps = 13/158 (8%)
 Frame = +1

Query  166  PYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFH  345
            PY+   VGF + +Y+F TYLD+RQ  AL+ P+ P+ L G+ S E + K+RAY++DK  F 
Sbjct  19   PYLHLYVGFTVAVYLFHTYLDVRQLRALRRPSPPEALAGLFSPELYAKTRAYNLDKWSFS  78

Query  346  FVHEFVTILMDSAILYFGILPWFWKKSGDFL-------------VFLGLNTEXEILHTLA  486
            F H   + +   A++  G+LP+ W  SG+ L              +L   +  EI  T+ 
Sbjct  79   FAHSLYSTVETLALILAGVLPYVWVFSGNLLRTAAAHAGPGLWPAWLSTASGVEIAQTVL  138

Query  487  FLAGVMFWSQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            F+  +   + + +LP+ LYSTFVIE RHGFNK T+ L+
Sbjct  139  FVFLLFLGNLVIELPWGLYSTFVIEQRHGFNKQTLGLY  176



>emb|CDW75638.1| caax prenyl protease 1 homolog [Stylonychia lemnae]
Length=431

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 88/143 (62%), Gaps = 0/143 (0%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FPY+  V+ F + +Y+FE YL+ RQ+        PK +  +++Q++F+KS++++ DK +F
Sbjct  6    FPYLYCVITFELFVYLFELYLNWRQYKKFCENETPKEIEHLVTQKEFKKSQSHNKDKMEF  65

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQIT  522
              + +++ IL +     F +  W W  S +  + +GLN E + L TLAFL  +  +  ++
Sbjct  66   KMLQDYLGILANVVWQIFRLPVWLWAFSAEICIAVGLNPEDDSLRTLAFLGFLHIFDVLS  125

Query  523  DLPFSLYSTFVIEARHGFNKXTM  591
             LP+SLY TFVI  RHGFNK T+
Sbjct  126  SLPWSLYETFVISERHGFNKQTI  148



>ref|XP_002154940.2| PREDICTED: CAAX prenyl protease 1 homolog [Hydra vulgaris]
Length=385

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 79/150 (53%), Gaps = 1/150 (1%)
 Frame = +1

Query  157  MAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDK  333
            M  P    V+ FM + +++ETYL  RQH            +   + ++ FEKSR Y +D+
Sbjct  1    MVDPIFAGVLTFMWITFLWETYLSYRQHKVYLNTKDIPVELKDSLDKQTFEKSRLYQVDR  60

Query  334  SDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWS  513
            S F FV    + L  + IL FG LP+ W  SG     LG +   EI  +  FL     +S
Sbjct  61   SKFGFVSSIYSQLELTVILLFGGLPFLWAVSGSLNEALGFDATHEIKQSCVFLVLSTLFS  120

Query  514  QITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
             +T LP+ LYS FVIE RHGFNK T+  +F
Sbjct  121  TVTSLPWKLYSNFVIEERHGFNKQTLGFYF  150



>gb|EIE81350.1| hypothetical protein RO3G_06055 [Rhizopus delemar RA 99-880]
Length=442

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 88/146 (60%), Gaps = 1/146 (1%)
 Frame = +1

Query  169  YMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF  348
            Y + V+ F  ++Y FE YL+ RQ+    +   PK L  ++++  F+K++AY++DKS F F
Sbjct  13   YKQFVLYFSCIVYGFEQYLNYRQYRRYLMRDRPKELADIVTEADFKKAQAYNLDKSRFGF  72

Query  349  VHEFVTILMDSAILYFGILPWFWKKSGDFLVFL-GLNTEXEILHTLAFLAGVMFWSQITD  525
            +      L    +L +  LP+ W  SG  L  + G  T+ EILH+L FLA     S +T 
Sbjct  73   IEGAYKQLETLLMLQYDGLPFIWDLSGSILSKISGYGTDYEILHSLVFLALFTLISTVTS  132

Query  526  LPFSLYSTFVIEARHGFNKXTMWLFF  603
            +PF+LYSTFV+E RHGFN  T+ LFF
Sbjct  133  IPFNLYSTFVVEQRHGFNNQTLGLFF  158



>ref|XP_006681887.1| hypothetical protein BATDEDRAFT_17759 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77279.1| hypothetical protein BATDEDRAFT_17759 [Batrachochytrium dendrobatidis 
JAM81]
Length=438

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 88/150 (59%), Gaps = 5/150 (3%)
 Frame = +1

Query  166  PYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkpl-----VGVISQEKFEKSRAYSID  330
            P+ E V+ F  +++ +ETYL++RQH  L + T+P  +        +S + FEKSR YS D
Sbjct  15   PWKEYVLIFSFIVFFWETYLNVRQHKKLGIKTIPAQVHKAFEPHTLSIQDFEKSRHYSYD  74

Query  331  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFW  510
            KS ++F+    + L  + I  F +LPW W  +G+    LG   E EIL ++ F    +  
Sbjct  75   KSTYNFIATAYSQLETTLIFSFNLLPWVWTYAGNLRARLGYGVEAEILQSVIFAGVCVLA  134

Query  511  SQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            S + +LP SLY TFV+E +HGFNK T+ L+
Sbjct  135  STVINLPLSLYYTFVLEVKHGFNKQTLGLY  164



>emb|CBJ27157.1| CaaX prenyl protease Ste24 [Ectocarpus siliculosus]
Length=474

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 89/173 (51%), Gaps = 16/173 (9%)
 Frame = +1

Query  133  YLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVIS-------  291
            Y Q G      P++   VGF +L+Y+ ETYLD+RQH  LK  T P  L+ V+        
Sbjct  25   YRQEGAEKSDAPFLLFFVGFTLLVYLLETYLDLRQHRNLKAGTPPPTLLEVLKTVDEDNK  84

Query  292  --------QEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFL  447
                    + KF  S+AY +DKS FHF      +++       G +PW W  S   +   
Sbjct  85   GLEAVSKVESKFSASQAYGLDKSRFHFFDSTFDLVVGLTTNLLGWMPWLWDVSSGLVAKA  144

Query  448  GLNT-EXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            GL     +I  +L F+   M    +  LPFSLYSTFV+EA+HGFNK T+ LFF
Sbjct  145  GLGDWGGDIPTSLTFVVLTMVLQTLIGLPFSLYSTFVVEAKHGFNKQTLGLFF  197



>ref|XP_010593554.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X3 [Loxodonta 
africana]
Length=393

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = +1

Query  160  AFPYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYS  324
            A P  + + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y 
Sbjct  12   AMPAEKRIFGVVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQ  71

Query  325  IDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVM  504
            +DKS F F     + +  + IL FG +P+ W+ SG F  + G   E EI+ +L FL    
Sbjct  72   LDKSTFSFWSGLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEIIQSLVFLLLAT  131

Query  505  FWSQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
             +S +T LP+SLY+TFVIE +HGFN+ T+  F
Sbjct  132  LFSALTGLPWSLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_008861314.1| hypothetical protein H310_00342 [Aphanomyces invadans]
 gb|ETW09903.1| hypothetical protein H310_00342 [Aphanomyces invadans]
Length=472

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 88/180 (49%), Gaps = 28/180 (16%)
 Frame = +1

Query  145  GNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVI------------  288
            G  A A PY+E  + F+ +M++FETYLDIRQH  L   TLP  L   I            
Sbjct  10   GWRASAVPYLEGTILFICVMHVFETYLDIRQHRKLYETTLPDKLSRAIRHVDEQNIDKKH  69

Query  289  ----------------SQEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWK  420
                            +  KF+K R YS+DKS F FVH+   +    A+L  G +P+ W+
Sbjct  70   GGVQGKGHEVASLLEQTTAKFDKCRLYSLDKSRFKFVHDTFQVADGLAMLVLGYMPFMWQ  129

Query  421  KSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
                 L   G     EI+ +L F+        +  +PF LYSTFV+E RHGFNK T+ LF
Sbjct  130  YCRALLASFGYTPTNEIMVSLTFVILTGARDVVLSIPFDLYSTFVVEERHGFNKQTLGLF  189



>ref|XP_539577.3| PREDICTED: CAAX prenyl protease 1 homolog [Canis lupus familiaris]
Length=473

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  20   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  79

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G  TE EI  +L FL     +S +T LP+
Sbjct  80   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGTEYEITQSLVFLLLATLFSALTGLPW  139

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  140  SLYNTFVIEEKHGFNQQTLGFF  161



>ref|XP_006824576.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog, 
partial [Saccoglossus kowalevskii]
Length=483

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 3/146 (2%)
 Frame = +1

Query  172  MEAVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHF  348
            + AV+ F  L+Y++ETYL  RQ A  K  T     +  ++  E F+K+R Y ++KS+F F
Sbjct  8    LNAVLVFFWLVYVWETYLAYRQRAIYKTFTKVPAEIYTILDHETFDKARLYQLEKSNFGF  67

Query  349  -VHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITD  525
             V  F  I M + IL  G +P+ W  +G+   + G   E EI+ +L F+   M +S ITD
Sbjct  68   WVGLFSQIEM-TLILILGGIPFLWNAAGNCTAYFGYGPEYEIMQSLMFIFLSMIFSTITD  126

Query  526  LPFSLYSTFVIEARHGFNKXTMWLFF  603
            LP+SLYSTFVIE RHGFNK T+  + 
Sbjct  127  LPWSLYSTFVIEERHGFNKQTLGFYL  152



>ref|XP_004371951.1| PREDICTED: CAAX prenyl protease 1 homolog [Trichechus manatus 
latirostris]
Length=475

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = +1

Query  166  PYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSID  330
            P  E + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +D
Sbjct  14   PAEERIFGVVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLD  73

Query  331  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFW  510
            KS F F     + +  + IL FG +P+ W+ SG F  + G   E EI+ +L FL     +
Sbjct  74   KSTFSFWSGLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEIIQSLVFLLLATLF  133

Query  511  SQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            S +T LP+SLY+TFVIE +HGFN+ T+  F
Sbjct  134  SALTGLPWSLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_008149410.1| PREDICTED: CAAX prenyl protease 1 homolog [Eptesicus fuscus]
Length=473

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G +I  E FEKSR Y +DKS F F  
Sbjct  20   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPMELGQIIDSETFEKSRLYQLDKSTFSFWS  79

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  80   GLYSEMEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLMATLFSALTGLPW  139

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  140  SLYNTFVIEEKHGFNQQTLGFF  161



>ref|XP_003415368.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Loxodonta 
africana]
Length=475

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 87/152 (57%), Gaps = 5/152 (3%)
 Frame = +1

Query  160  AFPYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYS  324
            A P  + + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y 
Sbjct  12   AMPAEKRIFGVVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQ  71

Query  325  IDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVM  504
            +DKS F F     + +  + IL FG +P+ W+ SG F  + G   E EI+ +L FL    
Sbjct  72   LDKSTFSFWSGLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEIIQSLVFLLLAT  131

Query  505  FWSQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
             +S +T LP+SLY+TFVIE +HGFN+ T+  F
Sbjct  132  LFSALTGLPWSLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_007536149.1| PREDICTED: CAAX prenyl protease 1 homolog [Erinaceus europaeus]
Length=475

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ETYL  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETYLAQRQRRIYKTTTHVPMELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G  +E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYGGFGSEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_006098203.1| PREDICTED: CAAX prenyl protease 1 homolog [Myotis lucifugus]
Length=475

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G +I  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPMELGQIIDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLMATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_005868719.1| PREDICTED: CAAX prenyl protease 1 homolog [Myotis brandtii]
 gb|EPQ09249.1| CAAX prenyl protease 1 like protein [Myotis brandtii]
Length=475

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G +I  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPMELGQIIDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLMATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|KFZ20107.1| hypothetical protein V502_03363 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=458

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLQFAPTRFSGEISHSIVFVLTFIIIQQV  135

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  +F
Sbjct  136  LSLPTSIYSTFVLEEKFGFNKQTPKVF  162



>ref|XP_006215922.1| PREDICTED: CAAX prenyl protease 1 homolog [Vicugna pacos]
Length=475

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE RHGFN+ T+  F
Sbjct  142  SLYNTFVIEERHGFNQQTLGFF  163



>ref|XP_006188105.1| PREDICTED: CAAX prenyl protease 1 homolog [Camelus ferus]
Length=475

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE RHGFN+ T+  F
Sbjct  142  SLYNTFVIEERHGFNQQTLGFF  163



>gb|KFY59517.1| hypothetical protein V496_05652 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=458

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLWNLTGSWLLQFAPTRFSGEISHSIVFVLTFIIIQQV  135

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  LF
Sbjct  136  LSLPTSIYSTFVLEEKFGFNKQTPKLF  162



>ref|XP_010995251.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Camelus dromedarius]
Length=481

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE RHGFN+ T+  F
Sbjct  142  SLYNTFVIEERHGFNQQTLGFF  163



>emb|CCO33594.1| STE24 endopeptidase [Rhizoctonia solani AG-1 IB]
Length=211

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 0/140 (0%)
 Frame = +1

Query  181  VVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEF  360
            V+ F   ++ FETYL  RQ      P  P  L    + E F KS+ Y  DK+ F  + + 
Sbjct  31   VLAFSWGVWAFETYLIYRQFPNYSRPHPPAALKSHFTDEVFRKSQRYGKDKAKFGLISKL  90

Query  361  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSL  540
             + L+++A++ FG  PW WK SG  L   G   E EI+H++AF   + + + I  LP S+
Sbjct  91   YSQLLETALIVFGSFPWAWKISGSLLAKFGYGPEYEIVHSIAFGTVLFYLNTIPSLPVSI  150

Query  541  YSTFVIEARHGFNKXTMWLF  600
            Y+TFV+E +HGFNK T  LF
Sbjct  151  YNTFVLEEKHGFNKMTPGLF  170



>ref|XP_008999216.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Callithrix 
jacchus]
Length=427

 Score = 99.8 bits (247),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYVWETFLAQRQRRIYKTTTQVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|EJY68063.1| Zn-dependent protease with chaperone function [Oxytricha trifallax]
Length=1433

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 94/168 (56%), Gaps = 0/168 (0%)
 Frame = +1

Query  97    SVIDLRSLSVSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkpl  276
             S+I  + L +S       S   FPY+ AV+ F IL+Y+FE YL+ RQ+       +PK +
Sbjct  968   SIIQPQDLKISHPQVFDTSKQVFPYIYAVLAFEILVYLFEQYLNWRQYKKYCEKEMPKEI  1027

Query  277   VGVISQEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLN  456
               +++ E+FEKS+A++ DK +F F+  ++     +    F +  W W  S      +GL+
Sbjct  1028  TTIVTMEQFEKSQAHNKDKMEFEFLKNYLEQFESTLWQLFRMPVWLWGYSVQLCQLVGLD  1087

Query  457   TEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
              + +   TLA++  +     I  +P+S+YS FVI+ RHGFNK T+ +F
Sbjct  1088  PDDDSQRTLAYIGFIFVIELIKSIPWSMYSIFVIQERHGFNKQTIGIF  1135



>gb|KFX89268.1| hypothetical protein V490_07139 [Pseudogymnoascus pannorum VKM 
F-3557]
 gb|KFX89748.1| hypothetical protein O988_08517 [Pseudogymnoascus pannorum VKM 
F-3808]
 gb|KFY43474.1| hypothetical protein V495_03913 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY52182.1| hypothetical protein V497_08611 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=458

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  75

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   QI
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLQFAPTRFSGEISHSIVFVLTFIVIQQI  135

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  LF
Sbjct  136  LSLPTSIYSTFVLEEKFGFNKQTPKLF  162



>ref|XP_010958108.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Camelus bactrianus]
Length=483

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE RHGFN+ T+  F
Sbjct  142  SLYNTFVIEERHGFNQQTLGFF  163



>ref|XP_004450692.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 2 [Dasypus 
novemcinctus]
Length=366

 Score = 99.0 bits (245),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ETYL  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETYLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRISGWFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_003799067.1| PREDICTED: CAAX prenyl protease 1 homolog [Otolemur garnettii]
Length=446

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 84/142 (59%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G  +E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGSEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|AAK48913.1| Afc1 protein [Physarum polycephalum]
Length=419

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 88/143 (62%), Gaps = 3/143 (2%)
 Frame = +1

Query  181  VVGFMILMYIFETYLDIRQHA--AlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVH  354
            ++GF+   Y+ ETYLDIRQH    +K+         +I+QE+F KS+AY +DKS+F F H
Sbjct  3    ILGFVTFSYLLETYLDIRQHNNYKVKVLPEKIKKYNIITQEEFAKSQAYGLDKSNFGFFH  62

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
            +F   + +  +L  G+LP+ W  S   L   G   + E+LH+  F+  ++  S I  +PF
Sbjct  63   DFFDFVQNILVLVCGVLPYLWGVSAVPLRKFGYE-DSEVLHSCVFVVLLILLSSIISMPF  121

Query  535  SLYSTFVIEARHGFNKXTMWLFF  603
             LYSTFVIE RHGFNK T+ L+F
Sbjct  122  ELYSTFVIEERHGFNKQTLGLYF  144



>ref|XP_002750699.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Callithrix 
jacchus]
Length=475

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYVWETFLAQRQRRIYKTTTQVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|KFY38041.1| hypothetical protein V494_04536 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=527

 Score =   100 bits (249),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  85   FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  144

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ +       EI H++ F+   +   Q+
Sbjct  145  SFVSSLYGQIQNTAFIYYDILPKLWGLTGSWLLQYAPARFSGEISHSIVFVLTFIIIQQV  204

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  LF
Sbjct  205  LSLPTSIYSTFVLEEKFGFNKQTPKLF  231



>ref|XP_010345848.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Saimiri 
boliviensis boliviensis]
Length=427

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLVFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004025583.1| PREDICTED: CAAX prenyl protease 1 homolog [Gorilla gorilla gorilla]
Length=422

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_010352520.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Rhinopithecus 
roxellana]
Length=427

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_007977466.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Chlorocebus 
sabaeus]
Length=427

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_011233459.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Ailuropoda 
melanoleuca]
Length=427

 Score = 99.0 bits (245),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_005543897.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Macaca 
fascicularis]
Length=427

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004415415.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004415416.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 2 [Odobenus 
rosmarus divergens]
Length=475

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_010861023.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Bison bison 
bison]
Length=475

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLARRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRVSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|ELR54320.1| CAAX prenyl protease 1-like protein [Bos mutus]
Length=476

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRVSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|EUC55856.1| CAAX prenyl protease, partial [Rhizoctonia solani AG-3 Rhs1AP]
Length=452

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 77/140 (55%), Gaps = 0/140 (0%)
 Frame = +1

Query  181  VVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEF  360
            V+ F   ++ FETYL  RQ      P  P  L    + E F KS+ Y  DK+ F  V + 
Sbjct  31   VLAFSWGVWAFETYLTYRQFPNYSRPHPPTALKSHFTDEVFNKSQRYGKDKARFSLVSKL  90

Query  361  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSL  540
             + L+++ ++  G  PW WK SG  L   G   E EI H++AF   + + + I +LP S+
Sbjct  91   YSQLLETGMITLGAFPWAWKVSGSLLARFGYGPEYEITHSIAFGTVLFYLTTIPNLPLSI  150

Query  541  YSTFVIEARHGFNKXTMWLF  600
            YSTFV+E +HGFNK T  LF
Sbjct  151  YSTFVLEEKHGFNKMTPQLF  170



>ref|XP_005898693.1| PREDICTED: CAAX prenyl protease 1 homolog [Bos mutus]
Length=475

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRVSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|NP_001179857.1| CAAX prenyl protease 1 homolog [Bos taurus]
 tpg|DAA31098.1| TPA: zinc metallopeptidase [Bos taurus]
Length=475

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRVSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_006867649.1| PREDICTED: CAAX prenyl protease 1 homolog [Chrysochloris asiatica]
Length=475

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = +1

Query  166  PYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSID  330
            P  + + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +D
Sbjct  14   PAEKRIFGVVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLD  73

Query  331  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFW  510
            KS F F     + +  + IL FG +P+ W+ SG F  + G   E EI+ +L FL     +
Sbjct  74   KSTFSFWSGLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEIIQSLVFLLLATLF  133

Query  511  SQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            S +T LP+SLY+TFVIE +HGFN+ T+  F
Sbjct  134  SALTGLPWSLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004001889.1| PREDICTED: CAAX prenyl protease 1 homolog [Ovis aries]
 ref|XP_005678699.1| PREDICTED: CAAX prenyl protease 1 homolog [Capra hircus]
Length=475

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_003937059.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Saimiri 
boliviensis boliviensis]
Length=475

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLVFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_003962545.1| PREDICTED: CAAX prenyl protease 1 homolog [Takifugu rubripes]
Length=467

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+GF   +Y++E YL  RQ    +  T   P +G +I  E F+KSR Y +DKS+F F  
Sbjct  17   AVLGFSWTVYLWEAYLSYRQRKIYRTTTHVPPELGKIIDSETFQKSRLYQLDKSNFGFWS  76

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL  G +P+ W  +G      GL +E EI  +L FL     +S +T LP+
Sbjct  77   GLYSETEGTLILILGGIPFLWNIAGSVTARFGLGSEYEITQSLVFLTLATLFSAVTGLPW  136

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  137  SLYNTFVIEEKHGFNQQTIGFF  158



>ref|XP_006737576.1| PREDICTED: CAAX prenyl protease 1 homolog [Leptonychotes weddellii]
Length=475

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRVSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_006061988.1| PREDICTED: CAAX prenyl protease 1 homolog [Bubalus bubalis]
Length=475

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|KFY87676.1| hypothetical protein V500_06835 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=679

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  237  FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  296

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  297  SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLQFAPTRFSGEISHSIVFVLTFIIIQQV  356

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  +F
Sbjct  357  LSLPTSIYSTFVLEEKFGFNKQTPKVF  383



>ref|XP_009059971.1| hypothetical protein LOTGIDRAFT_209825 [Lottia gigantea]
 gb|ESO88920.1| hypothetical protein LOTGIDRAFT_209825 [Lottia gigantea]
Length=467

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 80/141 (57%), Gaps = 1/141 (1%)
 Frame = +1

Query  181  VVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVHE  357
            V+ F+ ++Y++ETYL  RQ    +  T     +  V+ QE FEK+R Y +DKS+F F   
Sbjct  12   VLVFLWVVYLWETYLSYRQRTIYRNATKVPKELENVLDQETFEKARLYQLDKSNFGFWSN  71

Query  358  FVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFS  537
              + +  + IL  G LPW W  +G  +      +E EI  ++ F      +S IT LP+S
Sbjct  72   IYSQIESTVILLIGGLPWLWSVAGRLMDRYNYGSEYEITQSIVFTLLATIFSTITSLPWS  131

Query  538  LYSTFVIEARHGFNKXTMWLF  600
            +YSTFVIE +HGFNK T+  F
Sbjct  132  IYSTFVIEEKHGFNKQTLGFF  152



>gb|KFY09356.1| hypothetical protein V492_05514 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=698

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  256  FPWKKLIVGFSLAQYLFESYLSVRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  315

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ +       EI H++ F+   +   Q+
Sbjct  316  SFVSSLYGQIQNTAFIYYDILPKLWGLTGSWLLQYAPTRFSGEISHSIVFVLTFIIIQQV  375

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  LF
Sbjct  376  LSLPTSIYSTFVLEEKFGFNKQTPKLF  402



>ref|XP_003989947.2| PREDICTED: CAAX prenyl protease 1 homolog [Felis catus]
Length=475

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_010352519.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Rhinopithecus 
roxellana]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_513352.2| PREDICTED: CAAX prenyl protease 1 homolog [Pan troglodytes]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_003273371.1| PREDICTED: CAAX prenyl protease 1 homolog [Nomascus leucogenys]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_007077458.1| PREDICTED: CAAX prenyl protease 1 homolog [Panthera tigris altaica]
Length=473

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_002927608.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Ailuropoda 
melanoleuca]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_007453816.1| PREDICTED: CAAX prenyl protease 1 homolog [Lipotes vexillifer]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLARRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004450691.1| PREDICTED: CAAX prenyl protease 1 homolog isoform 1 [Dasypus 
novemcinctus]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ETYL  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETYLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRISGWFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|NP_001244375.1| CAAX prenyl protease 1 homolog [Macaca mulatta]
 ref|XP_005543896.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Macaca 
fascicularis]
 gb|EHH14652.1| hypothetical protein EGK_00615 [Macaca mulatta]
 gb|EHH49811.1| hypothetical protein EGM_00534 [Macaca fascicularis]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_007977465.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Chlorocebus 
sabaeus]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004426071.1| PREDICTED: CAAX prenyl protease 1 homolog [Ceratotherium simum 
simum]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E E+  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGQFCGYAGFGPEYEVTQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_003815473.1| PREDICTED: CAAX prenyl protease 1 homolog [Pan paniscus]
Length=476

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|NP_001126457.1| CAAX prenyl protease 1 homolog [Pongo abelii]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|KFZ02509.1| hypothetical protein V501_09542 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=680

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  238  FPWKKLIVGFSLAQYLFESYLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  297

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  298  SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLRFAPTRFSGEISHSIVFVLTFIIIQQV  357

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  +F
Sbjct  358  LSLPTSIYSTFVLEEKFGFNKQTPKVF  384



>gb|KFY76197.1| hypothetical protein V499_04041 [Pseudogymnoascus pannorum VKM 
F-103]
Length=680

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE+YL +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  238  FPWKKLIVGFSLAQYLFESYLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  297

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  298  SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLRFAPTRFSGEISHSIVFVLTFIIIQQV  357

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  +F
Sbjct  358  LSLPTSIYSTFVLEEKFGFNKQTPKVF  384



>ref|XP_005970531.1| PREDICTED: CAAX prenyl protease 1 homolog [Pantholops hodgsonii]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|KEP46996.1| CAAX prenyl protease [Rhizoctonia solani 123E]
Length=483

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 77/140 (55%), Gaps = 0/140 (0%)
 Frame = +1

Query  181  VVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEF  360
            V+ F   ++ FETYL  RQ      P  P  L    + E F KS+ Y  DK+ F  V + 
Sbjct  31   VLAFSWGVWAFETYLTYRQFPNYSRPHPPTALKSHFTDEVFNKSQRYGKDKARFSLVSKL  90

Query  361  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSL  540
             + L+++ ++  G  PW WK SG  L   G   E EI H++AF   + + + I +LP S+
Sbjct  91   YSQLLETGMITLGAFPWAWKVSGSLLARFGYGPEYEITHSIAFGTVLFYLTTIPNLPLSI  150

Query  541  YSTFVIEARHGFNKXTMWLF  600
            YSTFV+E +HGFNK T  LF
Sbjct  151  YSTFVLEEKHGFNKMTPQLF  170



>ref|XP_006165004.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Tupaia chinensis]
Length=478

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKATTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W  SG F  + G   E EI+ +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWSLSGRFCGYAGFGPEYEIMQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_007950886.1| PREDICTED: CAAX prenyl protease 1 homolog [Orycteropus afer afer]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 86/150 (57%), Gaps = 5/150 (3%)
 Frame = +1

Query  166  PYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSID  330
            P  + + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +D
Sbjct  14   PAEKRIFGVVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLD  73

Query  331  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFW  510
            KS F F     + +  + IL FG +P+ W+ SG F  + G   E EI+ +L FL     +
Sbjct  74   KSTFSFWSGLYSEIEGTFILLFGGIPYLWRLSGRFCGYAGFGQEYEIIQSLVFLLLATLF  133

Query  511  SQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            S +T LP+SLY+TFVIE +HGFN+ T+  F
Sbjct  134  SALTGLPWSLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004316653.1| PREDICTED: CAAX prenyl protease 1 homolog [Tursiops truncatus]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLARRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004266443.1| PREDICTED: CAAX prenyl protease 1 homolog [Orcinus orca]
Length=475

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLARRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_006758037.1| PREDICTED: CAAX prenyl protease 1 homolog [Myotis davidii]
 gb|ELK34617.1| CAAX prenyl protease 1 like protein [Myotis davidii]
Length=475

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G +I  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPMELGQIIDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F    G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGSAGFGPEYEITQSLVFLLMATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>emb|CAH92474.1| hypothetical protein [Pongo abelii]
Length=493

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|KDN36071.1| hypothetical protein RSAG8_11093, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=483

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/140 (41%), Positives = 77/140 (55%), Gaps = 0/140 (0%)
 Frame = +1

Query  181  VVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEF  360
            V+ F   ++ FETYL  RQ      P  P  L    + E F KS+ Y  DK+ F  V + 
Sbjct  31   VLAFSWGVWAFETYLIARQFPNYNRPHPPTALKSHFTDEVFIKSQRYGKDKARFGLVSKL  90

Query  361  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSL  540
             + L+++ ++  G  PW WK SG  L   G   E EI H+LAF   + F + I +LP S+
Sbjct  91   YSQLLETGMITLGAFPWAWKASGSLLARFGYGPEYEIAHSLAFGTVLFFLTTIPNLPVSI  150

Query  541  YSTFVIEARHGFNKXTMWLF  600
            YSTFV+E +HGFNK T  LF
Sbjct  151  YSTFVLEEKHGFNKMTPQLF  170



>emb|CEL61202.1| STE24 endopeptidase [Rhizoctonia solani AG-1 IB]
Length=440

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 79/140 (56%), Gaps = 0/140 (0%)
 Frame = +1

Query  181  VVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHFVHEF  360
            V+ F   ++ FETYL  RQ      P  P  L    + E F KS+ Y  DK+ F  + + 
Sbjct  31   VLAFSWGVWAFETYLIYRQFPNYSRPHPPAALKSHFTDEVFRKSQRYGKDKAKFGLISKL  90

Query  361  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSL  540
             + L+++A++ FG  PW WK SG  L   G   E EI+H++AF   + + + I  LP S+
Sbjct  91   YSQLLETALIVFGSFPWAWKISGSLLAKFGYGPEYEIVHSIAFGTVLFYLNTIPSLPVSI  150

Query  541  YSTFVIEARHGFNKXTMWLF  600
            Y+TFV+E +HGFNK T  LF
Sbjct  151  YNTFVLEEKHGFNKMTPGLF  170



>ref|XP_008710233.1| PREDICTED: CAAX prenyl protease 1 homolog [Ursus maritimus]
Length=529

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_008522391.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Equus przewalskii]
Length=434

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S  T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSASTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|ELR10214.1| STE24 endopeptidase [Pseudogymnoascus destructans 20631-21]
Length=487

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 87/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE++L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  45   FPWKKLIVGFSLAQYLFESFLSLRQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  104

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  105  SFVSSLYGQVQNTAFIYYDILPKLWTLTGSWLIQFAPTRFSGEISHSIVFVLTFIIIQQV  164

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  +F
Sbjct  165  LSLPTSIYSTFVLEEKFGFNKQTPKVF  191



>ref|XP_008589088.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Galeopterus 
variegatus]
Length=427

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLVFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S  T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEHEITQSLVFLLLATLFSASTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004740738.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Mustela 
putorius furo]
 ref|XP_004783003.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Mustela 
putorius furo]
Length=427

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++E++L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWESFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|NP_005848.2| CAAX prenyl protease 1 homolog [Homo sapiens]
 sp|O75844.2|FACE1_HUMAN RecName: Full=CAAX prenyl protease 1 homolog; AltName: Full=Farnesylated 
proteins-converting enzyme 1; Short=FACE-1; AltName: 
Full=Prenyl protein-specific endoprotease 1; AltName: Full=Zinc 
metalloproteinase Ste24 homolog [Homo sapiens]
 gb|AAC68866.1| CAAX prenyl protease [Homo sapiens]
 emb|CAB46277.1| farnesylated-proteins converting enzyme 1 [Homo sapiens]
 gb|EAX07233.1| zinc metallopeptidase (STE24 homolog, yeast), isoform CRA_a [Homo 
sapiens]
 gb|EAX07234.1| zinc metallopeptidase (STE24 homolog, yeast), isoform CRA_a [Homo 
sapiens]
 dbj|BAG52049.1| unnamed protein product [Homo sapiens]
Length=475

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>dbj|BAA33727.1| Ste24p [Homo sapiens]
Length=475

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_006798596.1| PREDICTED: CAAX prenyl protease 1 homolog [Neolamprologus brichardi]
Length=467

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+GF   +Y++E YL  RQ    +  T     +G ++  E FEKSR Y +DKS+F F  
Sbjct  17   AVLGFSWTVYLWEAYLSYRQRRIYRTTTHVPQELGKIMDSETFEKSRLYQLDKSNFSFWS  76

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL  G +P+ W  +G      G   E EI  +L FL     +S IT LP+
Sbjct  77   GLYSETEGTLILLLGGIPFLWAVAGSVTARFGFGPEYEITQSLVFLTLATLFSAITGLPW  136

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  137  SLYNTFVIEEKHGFNQQTLGFF  158



>ref|XP_005925764.1| PREDICTED: CAAX prenyl protease 1 homolog [Haplochromis burtoni]
Length=467

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+GF   +Y++E YL  RQ    +  T     +G ++  E FEKSR Y +DKS+F F  
Sbjct  17   AVLGFSWTVYLWEAYLSYRQRRIYRTTTHVPQELGKIMDSETFEKSRLYQLDKSNFSFWS  76

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL  G +P+ W  +G      G   E EI  +L FL     +S IT LP+
Sbjct  77   GLYSETEGTLILLLGGIPFLWAVAGSVTARFGFGPEYEITQSLVFLTLATLFSAITGLPW  136

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  137  SLYNTFVIEEKHGFNQQTLGFF  158



>ref|XP_004540520.1| PREDICTED: CAAX prenyl protease 1 homolog [Maylandia zebra]
 ref|XP_005723927.1| PREDICTED: CAAX prenyl protease 1 homolog [Pundamilia nyererei]
Length=467

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+GF   +Y++E YL  RQ    +  T     +G ++  E FEKSR Y +DKS+F F  
Sbjct  17   AVLGFSWTVYLWEAYLSYRQRRIYRTTTHVPQELGKIMDSETFEKSRLYQLDKSNFSFWS  76

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL  G +P+ W  +G      G   E EI  +L FL     +S IT LP+
Sbjct  77   GLYSETEGTLILLLGGIPFLWAVAGSVTARFGFGPEYEITQSLVFLTLATLFSAITGLPW  136

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  137  SLYNTFVIEEKHGFNQQTLGFF  158



>ref|XP_003453270.1| PREDICTED: CAAX prenyl protease 1 homolog [Oreochromis niloticus]
Length=467

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+GF   +Y++E YL  RQ    +  T     +G ++  E FEKSR Y +DKS+F F  
Sbjct  17   AVLGFSWTVYLWEAYLSYRQRRIYRTTTHVPQELGKIMDSETFEKSRLYQLDKSNFSFWS  76

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL  G +P+ W  +G      G   E EI  +L FL     +S IT LP+
Sbjct  77   GLYSETEGTLILLLGGIPFLWAVAGSVTARFGFGPEYEITQSLVFLTLATLFSAITGLPW  136

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  137  SLYNTFVIEEKHGFNQQTLGFF  158



>ref|XP_007164766.1| PREDICTED: CAAX prenyl protease 1 homolog [Balaenoptera acutorostrata 
scammoni]
Length=475

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLSRRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F    G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGHAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_007114324.1| PREDICTED: CAAX prenyl protease 1 homolog [Physeter catodon]
Length=432

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLARRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+  + +F
Sbjct  142  SLYNTFVIEEKHGFNQQVVLIF  163



>ref|XP_008589087.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Galeopterus 
variegatus]
Length=475

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLVFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S  T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEHEITQSLVFLLLATLFSASTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_002715233.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryctolagus cuniculus]
Length=473

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 81/139 (58%), Gaps = 1/139 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  20   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  79

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ WK SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  80   GLYSEVEGTFILLFGGIPYLWKLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  139

Query  535  SLYSTFVIEARHGFNKXTM  591
            SLY+TFVIE +HGFN  T+
Sbjct  140  SLYNTFVIEEKHGFNHQTL  158



>ref|NP_001288163.1| zinc metallopeptidase STE24 [Equus caballus]
 ref|XP_008522390.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Equus przewalskii]
Length=475

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S  T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSASTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004910060.1| PREDICTED: CAAX prenyl protease 1 homolog [Heterocephalus glaber]
Length=474

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 83/139 (60%), Gaps = 1/139 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  ++G   E EI+H+L FL     +S +T LP+
Sbjct  82   GLYSEVEGTFILLFGGIPYLWRLSGRFCGYVGFGPEYEIIHSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTM  591
            SLY+TFVIE +HGFN  T+
Sbjct  142  SLYNTFVIEEKHGFNHQTL  160



>ref|XP_004851105.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Heterocephalus 
glaber]
Length=475

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 83/139 (60%), Gaps = 1/139 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  ++G   E EI+H+L FL     +S +T LP+
Sbjct  82   GLYSEVEGTFILLFGGIPYLWRLSGRFCGYVGFGPEYEIIHSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTM  591
            SLY+TFVIE +HGFN  T+
Sbjct  142  SLYNTFVIEEKHGFNHQTL  160



>ref|XP_004740737.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Mustela 
putorius furo]
 ref|XP_004783002.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Mustela 
putorius furo]
Length=475

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++E++L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWESFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004591591.1| PREDICTED: CAAX prenyl protease 1 homolog [Ochotona princeps]
Length=475

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 81/139 (58%), Gaps = 1/139 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ WK SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTFILLFGGIPYLWKLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTM  591
            SLY+TFVIE +HGFN  T+
Sbjct  142  SLYNTFVIEEKHGFNHQTL  160



>ref|XP_005317922.1| PREDICTED: CAAX prenyl protease 1 homolog [Ictidomys tridecemlineatus]
Length=475

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELGQIMDAETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN  T+  F
Sbjct  142  SLYNTFVIEEKHGFNHQTLEFF  163



>ref|XP_008283596.1| PREDICTED: CAAX prenyl protease 1 homolog [Stegastes partitus]
Length=467

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/142 (39%), Positives = 79/142 (56%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+GF   +Y++E YL  RQ    +  T     +G ++  E FEKSR Y +DKS+F F  
Sbjct  17   AVLGFSWTVYLWEAYLSYRQRRIYRSTTHVPQELGKIMDSETFEKSRLYQLDKSNFSFWS  76

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL  G +P+ W  +G      G + E EI  +L FL     +S IT LP+
Sbjct  77   GLYSETEGTLILLLGGIPFLWGVAGSVTARFGFSPEYEITQSLVFLTLATLFSAITGLPW  136

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TF+IE +HGFN+ T+  F
Sbjct  137  SLYNTFIIEEKHGFNQQTLGFF  158



>ref|XP_011376276.1| PREDICTED: CAAX prenyl protease 1 homolog [Pteropus vampyrus]
Length=475

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWAVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F    G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGSAGFGPEYEITQSLVFLLMATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>gb|KFY19341.1| hypothetical protein V493_08005 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=458

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 86/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE++L  RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFESFLSARQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAKF  75

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  76   SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLQFAPTRFSGEISHSIVFVLTFIMIQQV  135

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  +F
Sbjct  136  LSLPTSIYSTFVLEEKFGFNKQTPKVF  162



>ref|XP_008832497.1| PREDICTED: CAAX prenyl protease 1 homolog [Nannospalax galili]
Length=384

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 82/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F  ++Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWIVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F    G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEMEGTFILLFGGIPYLWRLSGRFCGSAGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN  T+  F
Sbjct  142  SLYNTFVIEEKHGFNHQTLEFF  163



>gb|EJY66600.1| CAAX prenyl protease-like protein [Oxytricha trifallax]
Length=484

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 90/165 (55%), Gaps = 0/165 (0%)
 Frame = +1

Query  97   SVIDLRSLSVSLYLQLGNSAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkpl  276
            S+I  + L +S       S   FPY+ AV+ F IL+Y+FE YL+ RQ+       +PK +
Sbjct  8    SIIQPQDLQISHPQIFDTSKQVFPYIYAVLAFEILVYLFEQYLNWRQYKKYCEKEMPKEI  67

Query  277  VGVISQEKFEKSRAYSIDKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLN  456
              +++ E+FEKS+A++ DK +F  +  ++     +    F +  W W  S      +GLN
Sbjct  68   TTIVTIEQFEKSQAHNKDKMEFELLKNYLEQFESTLWQLFRMPVWLWGYSVQLCELVGLN  127

Query  457  TEXEILHTLAFLAGVMFWSQITDLPFSLYSTFVIEARHGFNKXTM  591
             + +   TLA++  +       + P+++YS FVI+ RHGFNK T+
Sbjct  128  PDDDSQRTLAYMGFIFVIELFKNFPWTMYSIFVIQERHGFNKQTI  172



>ref|XP_004082296.1| PREDICTED: CAAX prenyl protease 1 homolog [Oryzias latipes]
Length=467

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 78/143 (55%), Gaps = 1/143 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++E YL  RQ    +  T     +G ++  E FEKSR Y +DKS+F F  
Sbjct  17   AVLAFSWTVYLWEAYLSYRQRRTYRSTTHVPQELGKIMDSETFEKSRLYQLDKSNFSFWS  76

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL  G +P+ W  +G      G   E EI  +L FL     +S +T LP+
Sbjct  77   GLYSETEGTLILLLGGIPFLWDIAGSLAARFGFTPEHEITQSLVFLTLATLFSALTGLPW  136

Query  535  SLYSTFVIEARHGFNKXTMWLFF  603
            SLY+TFVIE +HGFN+ T+  FF
Sbjct  137  SLYNTFVIEEKHGFNQQTLGFFF  159



>ref|XP_011415720.1| PREDICTED: CAAX prenyl protease 1 homolog [Crassostrea gigas]
 gb|EKC18431.1| CAAX prenyl protease 1-like protein [Crassostrea gigas]
Length=457

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 89/146 (61%), Gaps = 9/146 (6%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQ-HAAlklptlpkplVGVISQEKFEKSRAYSIDKSDFHF--  348
            +V+ F+ ++Y +E+YL  RQ + A  +  +PK L  V+ QE F K+R YS+DKS + F  
Sbjct  10   SVLVFLWIVYFWESYLSSRQRYLARTVEKVPKELEKVLDQETFTKARLYSLDKSTYGFWS  69

Query  349  --VHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQIT  522
               H+F T    + IL  G LP+ WK SG  +   G + + EIL ++ F+   M +S IT
Sbjct  70   GLYHQFET----TVILCVGALPFVWKLSGRIITHFGFSGDYEILQSITFILIFMLYSTIT  125

Query  523  DLPFSLYSTFVIEARHGFNKXTMWLF  600
             LP+SLY TFV+E +HGFNK T+  F
Sbjct  126  SLPWSLYETFVLEEKHGFNKQTLPFF  151



>ref|XP_006904034.1| PREDICTED: LOW QUALITY PROTEIN: CAAX prenyl protease 1 homolog 
[Pteropus alecto]
Length=475

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWAVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F    G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGSAGFGPEYEITQSLVFLLMATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_006886567.1| PREDICTED: CAAX prenyl protease 1 homolog [Elephantulus edwardii]
Length=474

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 85/150 (57%), Gaps = 5/150 (3%)
 Frame = +1

Query  166  PYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSID  330
            P  + + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +D
Sbjct  13   PAEKRIFGLVLLFSWTVYLWETFLAQRQRRIYKTTTHVPMELGQIMDSETFEKSRLYQLD  72

Query  331  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFW  510
            KS F F     + +  + IL FG +P+ W  SG F  + G   + EI+ +L FL     +
Sbjct  73   KSTFSFWSGLYSEIEGTLILLFGGIPYLWMLSGKFCGYAGFGPQYEIIQSLVFLLLATLF  132

Query  511  SQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            S +T LP+SLY+TFVIE +HGFN+ T+  F
Sbjct  133  SALTGLPWSLYNTFVIEEKHGFNQQTLGFF  162



>ref|XP_004614273.1| PREDICTED: CAAX prenyl protease 1 homolog [Sorex araneus]
Length=475

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRKIYKTTTHVPLELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
             F + +  + IL FG +P+ W+ SG F  + G  ++ EI  +L FL     +S +T LP+
Sbjct  82   GFYSEIEGTLILLFGGIPYLWRLSGRFCGYAGFGSDYEITQSLMFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004678903.1| PREDICTED: CAAX prenyl protease 1 homolog [Condylura cristata]
Length=475

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E F KSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPMELGQIMDAETFAKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  + G  +E EI  +L FL     +S  T LP+
Sbjct  82   GLYSEIEGTLILIFGGIPYLWRLSGQFCGYAGFGSEYEITQSLVFLLLATLFSAFTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_010733223.1| PREDICTED: CAAX prenyl protease 1 homolog [Larimichthys crocea]
Length=467

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 79/142 (56%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+GF   +Y++E YL  RQ    +  T     +G ++  + FEKSR Y +DKS+F F  
Sbjct  17   AVLGFSWTVYLWEAYLSYRQRRIYRSTTHVPQELGKIMDSDTFEKSRLYQLDKSNFSFWS  76

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL  G +P+ W  +G      G  +E EI  +L FL     +S +T LP+
Sbjct  77   GLYSETEGTLILLLGGIPFLWAVAGSVTSRFGFGSEYEITQSLVFLTLATLFSAVTGLPW  136

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLYSTF+IE +HGFN+ T+  F
Sbjct  137  SLYSTFIIEEKHGFNQQTIGFF  158



>gb|AIC62085.1| ZMPSTE24, partial [synthetic construct]
Length=475

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +  LP+
Sbjct  82   GLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALAGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_004851106.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Heterocephalus 
glaber]
Length=424

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 1/135 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  ++G   E EI+H+L FL     +S +T LP+
Sbjct  82   GLYSEVEGTFILLFGGIPYLWRLSGRFCGYVGFGPEYEIIHSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFN  579
            SLY+TFVIE +HGFN
Sbjct  142  SLYNTFVIEEKHGFN  156



>gb|AAH37283.1| Zinc metallopeptidase (STE24 homolog, S. cerevisiae) [Homo sapiens]
 gb|ABW03365.1| zinc metallopeptidase (STE24 homolog, S. cerevisiae) [synthetic 
construct]
 gb|ABW03708.1| zinc metallopeptidase (STE24 homolog, S. cerevisiae) [synthetic 
construct]
Length=475

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +  LP+
Sbjct  82   GLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALAGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_007244663.1| PREDICTED: CAAX prenyl protease 1 homolog [Astyanax mexicanus]
Length=470

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++E YL  RQ    +        +G ++  E FEKSR Y +DKS+F F  
Sbjct  17   AVLVFSWTVYLWEAYLAYRQRRIYRSTMHVPTELGKIMDSETFEKSRLYQLDKSNFGFWS  76

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL  G +P+ WK SG+     GL  E EI  +L FL     +S  T LP+
Sbjct  77   GLYSETEGTLILLLGGIPFLWKISGNLTARFGLGPEYEISQSLVFLMLATLFSAFTGLPW  136

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  137  SLYNTFVIEEKHGFNQQTLGFF  158



>ref|XP_005848523.1| hypothetical protein CHLNCDRAFT_22375, partial [Chlorella variabilis]
 gb|EFN56421.1| hypothetical protein CHLNCDRAFT_22375, partial [Chlorella variabilis]
Length=372

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 86/146 (59%), Gaps = 2/146 (1%)
 Frame = +1

Query  151  SAMAFPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSID  330
            S   FP++EAV  F   +++  TYLD RQ  AL+LP  P  +  + S+E+FEK RAY+ D
Sbjct  4    SGDGFPWLEAVAVFNTAVFLVHTYLDTRQQHALRLPAPPPVVAHLYSKEEFEKKRAYNQD  63

Query  331  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFW  510
            K  +  VH     ++++ +L  G LP  W+ +G  L   G +   EI  T+A++      
Sbjct  64   KLRYSMVHGQWDFVLNTGLLLAGFLPATWRLAGALLARWGWDG--EIPQTVAWVLIQACL  121

Query  511  SQITDLPFSLYSTFVIEARHGFNKXT  588
            S +  LP+S Y+TFV+EARHGFNK +
Sbjct  122  SLVLGLPWSAYATFVLEARHGFNKTS  147



>ref|XP_003050604.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU44891.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=868

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 85/147 (58%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + ++GF +  Y+FET+L +RQ+  L+    P  L   +SQE F+KS+AY   K+ F
Sbjct  420  FPWKKLIMGFSVGQYLFETFLTLRQYRVLQNTKPPVVLSKEVSQEVFDKSQAYGRAKAKF  479

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
              V+   + L + A ++F ILP  W  SGD L+ F       EI HT+ F+      SQI
Sbjct  480  EIVNGLYSQLQNIAFMHFDILPKLWSWSGDLLLKFAPARFTGEISHTIVFVLTFAAISQI  539

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+Y TFV+E + GFNK T  LF
Sbjct  540  LRLPASIYQTFVLEEKFGFNKQTPKLF  566



>gb|KFY04966.1| hypothetical protein V491_09229 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=678

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 86/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE++L  RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  236  FPWKKLIVGFSLAQYLFESFLSARQYQVLKNTRPPKVLANEVSQEVFDKSQAYGRAKAQF  295

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLV-FLGLNTEXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +Y+ ILP  W  +G +L+ F       EI H++ F+   +   Q+
Sbjct  296  SFVSSLYGQIQNTAFIYYDILPKLWTLTGSWLLQFAPARFSGEISHSIVFVLTFIIIQQV  355

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+YSTFV+E + GFNK T  +F
Sbjct  356  LSLPTSIYSTFVLEEKFGFNKQTPKVF  382



>pdb|2YPT|A Chain A, Crystal Structure Of The Human Nuclear Membrane Zinc 
Metalloprotease Zmpste24 Mutant (e336a) In Complex With A Synthetic 
Csim Tetrapeptide From The C-terminus Of Prelamin A
 pdb|2YPT|B Chain B, Crystal Structure Of The Human Nuclear Membrane Zinc 
Metalloprotease Zmpste24 Mutant (e336a) In Complex With A Synthetic 
Csim Tetrapeptide From The C-terminus Of Prelamin A
 pdb|2YPT|D Chain D, Crystal Structure Of The Human Nuclear Membrane Zinc 
Metalloprotease Zmpste24 Mutant (e336a) In Complex With A Synthetic 
Csim Tetrapeptide From The C-terminus Of Prelamin A
 pdb|2YPT|E Chain E, Crystal Structure Of The Human Nuclear Membrane Zinc 
Metalloprotease Zmpste24 Mutant (e336a) In Complex With A Synthetic 
Csim Tetrapeptide From The C-terminus Of Prelamin A
Length=482

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +  LP+
Sbjct  82   GLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALAGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>pdb|4AW6|A Chain A, Crystal Structure Of The Human Nuclear Membrane Zinc 
Metalloprotease Zmpste24 (face1)
 pdb|4AW6|B Chain B, Crystal Structure Of The Human Nuclear Membrane Zinc 
Metalloprotease Zmpste24 (face1)
 pdb|4AW6|D Chain D, Crystal Structure Of The Human Nuclear Membrane Zinc 
Metalloprotease Zmpste24 (face1)
 pdb|4AW6|E Chain E, Crystal Structure Of The Human Nuclear Membrane Zinc 
Metalloprotease Zmpste24 (face1)
Length=482

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               +    + IL FG +P+ W+ SG F  + G   E EI  +L FL     +S +  LP+
Sbjct  82   GLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALAGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN+ T+  F
Sbjct  142  SLYNTFVIEEKHGFNQQTLGFF  163



>ref|XP_010624213.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X2 [Fukomys 
damarensis]
 gb|KFO32523.1| CAAX prenyl protease 1 like protein [Fukomys damarensis]
Length=475

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 81/139 (58%), Gaps = 1/139 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W  SG F  ++G   E EI+H+L FL     +S +T LP+
Sbjct  82   GLYSEVEGTFILLFGGIPYLWSLSGRFCGYVGFGPEYEIIHSLMFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTM  591
            SLY+TFVIE +HGFN  T+
Sbjct  142  SLYNTFVIEEKHGFNHQTL  160



>ref|XP_004665222.1| PREDICTED: CAAX prenyl protease 1 homolog [Jaculus jaculus]
Length=432

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 1/142 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWAVYLWETFLAQRQRRIYKTTTRVPPELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL  G +P+ W+ SG F  + G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTFILLLGGIPYLWRVSGRFCGYAGFGAEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTMWLF  600
            SLY+TFVIE +HGFN  T+  F
Sbjct  142  SLYNTFVIEEKHGFNHQTLEFF  163



>ref|XP_004705331.1| PREDICTED: CAAX prenyl protease 1 homolog [Echinops telfairi]
Length=432

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 83/150 (55%), Gaps = 5/150 (3%)
 Frame = +1

Query  166  PYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSID  330
            P  + + G ++L    +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +D
Sbjct  14   PVEKRIFGVVLLFSWTVYLWETFLAQRQRRVYKTTTHVPLELGQIMDSETFEKSRLYQLD  73

Query  331  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFW  510
            KS F F     + +  + IL FG +P+ W  S  F  + G   E EI  +L FL     +
Sbjct  74   KSTFSFWSGLYSEIEGTLILLFGGIPYLWSLSARFCGYAGFGPEYEIFQSLVFLLLATLF  133

Query  511  SQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            S +T LP+SLY+TFVIE +HGFN+ T+  F
Sbjct  134  SALTGLPWSLYNTFVIEEKHGFNQQTLGFF  163



>gb|ELK19500.1| CAAX prenyl protease 1 like protein [Pteropus alecto]
Length=396

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 79/139 (57%), Gaps = 1/139 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplVG-VISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +G ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWAVYLWETFLAQRQRRIYKTTTHVPLELGQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F    G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEIEGTLILLFGGIPYLWRLSGRFCGSAGFGPEYEITQSLVFLLMATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTM  591
            SLY+TFVIE +HGFN+  +
Sbjct  142  SLYNTFVIEEKHGFNQQVL  160



>ref|XP_003501864.1| PREDICTED: CAAX prenyl protease 1 homolog [Cricetulus griseus]
 ref|XP_007618844.1| PREDICTED: CAAX prenyl protease 1 homolog [Cricetulus griseus]
 gb|EGV97096.1| CAAX prenyl protease 1-like [Cricetulus griseus]
 gb|ERE83120.1| putative CAAX prenyl protease 1 like protein [Cricetulus griseus]
Length=475

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 85/151 (56%), Gaps = 5/151 (3%)
 Frame = +1

Query  163  FPYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSI  327
            FP  + + G ++L    +Y++ET+L  RQ    K  T     +  ++  + FEKSR Y +
Sbjct  13   FPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTRVPAELEQIMDSDTFEKSRLYQL  72

Query  328  DKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMF  507
            DKS F F     +++  + IL FG +P+ W+ SG      G   E EI+H+L FL     
Sbjct  73   DKSTFSFWSGLYSVVESTLILLFGGIPYLWRLSGRVCDSAGFGPEYEIIHSLVFLLLATL  132

Query  508  WSQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            +S +T LP+S+Y+TFVIE +HGFN  T+  F
Sbjct  133  YSALTGLPWSMYNTFVIEEKHGFNHQTLEFF  163



>gb|ESZ94952.1| putative CAAX prenyl protease 1 [Sclerotinia borealis F-4157]
Length=462

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/147 (39%), Positives = 86/147 (59%), Gaps = 1/147 (1%)
 Frame = +1

Query  163  FPYMEAVVGFMILMYIFETYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSIDKSDF  342
            FP+ + +VGF +  Y+FE +L +RQ+  LK    PK L   +SQE F+KS+AY   K+ F
Sbjct  16   FPWKKLIVGFSLAQYLFEGFLSLRQYQVLKQTRPPKVLSNEVSQEVFDKSQAYGRAKAKF  75

Query  343  HFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNT-EXEILHTLAFLAGVMFWSQI  519
             FV      + ++A +YF +LP  W+ +G +L+ L       EI H++ F+   +   QI
Sbjct  76   GFVAGLYGQIQNTAFIYFDVLPKLWELTGSWLLQLAPARFSGEISHSIVFVLTFIIIQQI  135

Query  520  TDLPFSLYSTFVIEARHGFNKXTMWLF  600
              LP S+Y TFV+E + GFNK T  +F
Sbjct  136  LSLPTSIYQTFVLEEKFGFNKQTPQIF  162



>ref|XP_003462326.1| PREDICTED: CAAX prenyl protease 1 homolog [Cavia porcellus]
Length=475

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 82/139 (59%), Gaps = 1/139 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTRVPPELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  ++G   E EI+ +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTFILLFGGIPYLWRLSGRFCGYVGFGPEYEIIQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTM  591
            SLY+TFVIE +HGFN  T+
Sbjct  142  SLYNTFVIEEKHGFNHQTL  160



>ref|XP_006995844.1| PREDICTED: CAAX prenyl protease 1 homolog [Peromyscus maniculatus 
bairdii]
Length=475

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 86/151 (57%), Gaps = 5/151 (3%)
 Frame = +1

Query  163  FPYMEAVVGFMIL----MYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSI  327
            FP  + + G ++L    +Y++ET+L  RQ    K  T   P +  ++  + FEKSR Y +
Sbjct  13   FPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELEQIMDSDTFEKSRLYQL  72

Query  328  DKSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMF  507
            DKS F F     +++  + IL FG +P+ WK SG F    G   E EI+ +L FL     
Sbjct  73   DKSTFSFWSGLYSVVESTFILLFGGIPYLWKLSGRFCGSAGFGPEYEIIQSLVFLLLATL  132

Query  508  WSQITDLPFSLYSTFVIEARHGFNKXTMWLF  600
            +S +T LP+S+Y+TFVIE +HGFN  T+  F
Sbjct  133  YSALTGLPWSIYNTFVIEEKHGFNHQTLEFF  163



>ref|XP_009028164.1| hypothetical protein HELRODRAFT_193946 [Helobdella robusta]
 gb|ESN93745.1| hypothetical protein HELRODRAFT_193946 [Helobdella robusta]
Length=1187

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 51/133 (38%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = +1

Query  184  VGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVHEF  360
            + F+  M+I+E YL  RQ    K  T+   ++  ++  E FEK+R Y++DKS+F F    
Sbjct  32   LAFLWFMFIWELYLAYRQRKIFKNVTVRPKVIESIMDSESFEKARLYNLDKSNFAFWSGL  91

Query  361  VTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPFSL  540
             + +  + I++F +L + W  S + +V+ GLN + EI  +L F +    +S IT LP+SL
Sbjct  92   YSQIETTVIIWFFLLSYAWDWSENIVVYFGLNKDYEITQSLVFTSITSLYSLITSLPWSL  151

Query  541  YSTFVIEARHGFN  579
            YSTFV+E +HGFN
Sbjct  152  YSTFVLEQKHGFN  164



>ref|XP_005410609.1| PREDICTED: CAAX prenyl protease 1 homolog [Chinchilla lanigera]
Length=475

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 81/139 (58%), Gaps = 1/139 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T   P +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W+ SG F  ++G   E EI  +L FL     +S +T LP+
Sbjct  82   GLYSEVEGTFILLFGGIPYLWRLSGQFCGYIGFGPEYEITQSLVFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFNKXTM  591
            SLY+TFVIE +HGFN  T+
Sbjct  142  SLYNTFVIEEKHGFNHQTL  160



>emb|CCG83629.1| CaaX prenyl protease Ste24 [Taphrina deformans PYCC 5710]
Length=448

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 87/151 (58%), Gaps = 5/151 (3%)
 Frame = +1

Query  166  PYMEAVVGFMILMYIFE-----TYLDIRQHAAlklptlpkplVGVISQEKFEKSRAYSID  330
            P+   V+GF +  + FE      +L +RQ+  L+  T+PK L GVI Q+ F+KS+AY   
Sbjct  22   PWKNLVIGFTLAQFTFERLLIRQFLALRQYRKLQSKTIPKALAGVIDQDTFDKSQAYGRA  81

Query  331  KSDFHFVHEFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFW  510
            K+ F F      ++ + A+L F +LPW W  +G  +    +  +  IL+++ F+   +  
Sbjct  82   KAKFGFFTSVYGLVQNLAVLSFNVLPWMWYATGSLVPKFPVQVQGPILNSILFIFAFVNI  141

Query  511  SQITDLPFSLYSTFVIEARHGFNKXTMWLFF  603
            S + +LP SLYSTFV+E   GFNK T+ LFF
Sbjct  142  STVLNLPTSLYSTFVLEESFGFNKQTLRLFF  172



>ref|XP_010624212.1| PREDICTED: CAAX prenyl protease 1 homolog isoform X1 [Fukomys 
damarensis]
Length=424

 Score = 94.0 bits (232),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 79/135 (59%), Gaps = 1/135 (1%)
 Frame = +1

Query  178  AVVGFMILMYIFETYLDIRQHAAlklptlpkplV-GVISQEKFEKSRAYSIDKSDFHFVH  354
            AV+ F   +Y++ET+L  RQ    K  T     +  ++  E FEKSR Y +DKS F F  
Sbjct  22   AVLLFSWTVYLWETFLAQRQRRIYKTTTHVPLELEQIMDSETFEKSRLYQLDKSTFSFWS  81

Query  355  EFVTILMDSAILYFGILPWFWKKSGDFLVFLGLNTEXEILHTLAFLAGVMFWSQITDLPF  534
               + +  + IL FG +P+ W  SG F  ++G   E EI+H+L FL     +S +T LP+
Sbjct  82   GLYSEVEGTFILLFGGIPYLWSLSGRFCGYVGFGPEYEIIHSLMFLLLATLFSALTGLPW  141

Query  535  SLYSTFVIEARHGFN  579
            SLY+TFVIE +HGFN
Sbjct  142  SLYNTFVIEEKHGFN  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 802174409370