BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF044N08

Length=634
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP32393.1|  hypothetical protein JCGZ_13318                         239   1e-71   Jatropha curcas
ref|XP_009407665.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       234   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008784904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       234   2e-69   Phoenix dactylifera
gb|KJB64775.1|  hypothetical protein B456_010G064200                    228   4e-67   Gossypium raimondii
ref|XP_004159415.1|  PREDICTED: nitrate transporter 1.4-like            223   6e-65   
gb|KJB07736.1|  hypothetical protein B456_001G041900                    221   6e-65   Gossypium raimondii
ref|XP_008457678.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            221   7e-65   Cucumis melo [Oriental melon]
ref|XP_010049998.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    221   7e-65   Eucalyptus grandis [rose gum]
ref|XP_004139418.1|  PREDICTED: nitrate transporter 1.4-like            222   1e-64   
gb|AFR11354.1|  nitrate transporter                                     220   3e-64   Cucumis sativus [cucumbers]
gb|KGN60671.1|  hypothetical protein Csa_2G006170                       219   6e-64   
ref|XP_010254379.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    219   6e-64   Nelumbo nucifera [Indian lotus]
ref|XP_002524480.1|  oligopeptide transporter, putative                 218   1e-63   Ricinus communis
ref|XP_002281975.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    218   1e-63   Vitis vinifera
ref|XP_003609313.1|  Nitrate transporter                                218   2e-63   Medicago truncatula
ref|XP_009591623.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    215   2e-62   Nicotiana tomentosiformis
ref|XP_009781779.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       214   3e-62   Nicotiana sylvestris
ref|XP_007013426.1|  Major facilitator superfamily protein isoform 2    214   3e-62   
ref|XP_009608737.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    214   4e-62   Nicotiana tomentosiformis
ref|XP_008444009.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       214   5e-62   Cucumis melo [Oriental melon]
gb|AGA60121.1|  nitrate transporter NRT1.4B                             213   7e-62   Cucumis sativus [cucumbers]
ref|XP_010656420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    213   1e-61   Vitis vinifera
ref|XP_011093557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       213   1e-61   Sesamum indicum [beniseed]
ref|XP_004150978.1|  PREDICTED: nitrate transporter 1.4-like            213   1e-61   
ref|XP_010254380.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    213   1e-61   Nelumbo nucifera [Indian lotus]
ref|XP_007154995.1|  hypothetical protein PHAVU_003G164000g             213   2e-61   Phaseolus vulgaris [French bean]
ref|XP_004508509.1|  PREDICTED: nitrate transporter 1.4-like            212   2e-61   Cicer arietinum [garbanzo]
ref|XP_006600752.1|  PREDICTED: nitrate transporter 1.4-like            211   4e-61   Glycine max [soybeans]
gb|KHN47160.1|  Nitrate transporter 1.4                                 211   4e-61   Glycine soja [wild soybean]
ref|XP_011458172.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            211   4e-61   Fragaria vesca subsp. vesca
ref|XP_010533169.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            211   5e-61   Tarenaya hassleriana [spider flower]
ref|XP_008792048.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    211   6e-61   Phoenix dactylifera
gb|KJB82816.1|  hypothetical protein B456_013G215400                    210   1e-60   Gossypium raimondii
ref|XP_009778211.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       210   2e-60   Nicotiana sylvestris
ref|XP_010541927.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            209   4e-60   Tarenaya hassleriana [spider flower]
ref|XP_006837800.1|  hypothetical protein AMTR_s00104p00113760          209   5e-60   
emb|CDX71495.1|  BnaC04g17300D                                          209   5e-60   
ref|XP_004230062.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       208   7e-60   Solanum lycopersicum
gb|KDO61703.1|  hypothetical protein CISIN_1g008020mg                   208   8e-60   Citrus sinensis [apfelsine]
ref|XP_006483348.1|  PREDICTED: nitrate transporter 1.4-like isof...    208   8e-60   Citrus sinensis [apfelsine]
ref|XP_007011886.1|  Major facilitator superfamily protein, putat...    209   1e-59   
emb|CDY45207.1|  BnaA07g12830D                                          207   1e-59   Brassica napus [oilseed rape]
ref|XP_006475801.1|  PREDICTED: nitrate transporter 1.4-like isof...    204   1e-59   
ref|XP_008792049.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    207   2e-59   
ref|XP_002880817.1|  nitrate transporter                                207   2e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_006356754.1|  PREDICTED: nitrate transporter 1.4-like            207   2e-59   Solanum tuberosum [potatoes]
gb|KHN15097.1|  Nitrate transporter 1.4                                 207   3e-59   Glycine soja [wild soybean]
ref|XP_007204809.1|  hypothetical protein PRUPE_ppa021603mg             206   4e-59   
gb|KHG05036.1|  Nitrate transporter 1.4 -like protein                   206   4e-59   Gossypium arboreum [tree cotton]
ref|NP_850084.1|  nitrate transporter 1.4                               206   4e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103552.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            206   5e-59   Brassica rapa
ref|XP_006347704.1|  PREDICTED: nitrate transporter 1.4-like            206   5e-59   Solanum tuberosum [potatoes]
gb|AAM20651.1|  putative nitrate transporter                            206   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408724.1|  hypothetical protein EUTSA_v10001943mg             205   9e-59   Eutrema salsugineum [saltwater cress]
emb|CDP10398.1|  unnamed protein product                                205   9e-59   Coffea canephora [robusta coffee]
ref|XP_010914872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       205   1e-58   Elaeis guineensis
ref|XP_006475796.1|  PREDICTED: nitrate transporter 1.4-like isof...    205   1e-58   Citrus sinensis [apfelsine]
ref|XP_010417814.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       205   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010510873.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    204   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010473052.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       204   1e-58   Camelina sativa [gold-of-pleasure]
emb|CDY30787.1|  BnaC07g16870D                                          205   2e-58   Brassica napus [oilseed rape]
ref|XP_010510874.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2 isof...    204   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010093242.1|  Nitrate transporter 1.4                            204   2e-58   
ref|XP_006450986.1|  hypothetical protein CICLE_v10007850mg             204   2e-58   Citrus clementina [clementine]
gb|EYU29790.1|  hypothetical protein MIMGU_mgv1a003653mg                204   2e-58   Erythranthe guttata [common monkey flower]
gb|AAB95302.1|  putative nitrate transporter                            204   3e-58   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32490.1|  hypothetical protein AALP_AA6G249500                    203   4e-58   Arabis alpina [alpine rockcress]
ref|XP_007013425.1|  Major facilitator superfamily protein isoform 1    203   6e-58   
ref|XP_010925226.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       203   6e-58   
ref|XP_010688014.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            201   3e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009368838.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       199   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_004243154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       199   1e-56   
ref|XP_009403461.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       199   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008337300.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       199   2e-56   
ref|XP_008352261.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       199   2e-56   
ref|XP_010049997.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       198   3e-56   Eucalyptus grandis [rose gum]
ref|XP_006361731.1|  PREDICTED: nitrate transporter 1.4-like            197   2e-55   
ref|XP_010093703.1|  Nitrate transporter 1.1                            185   5e-54   
ref|XP_009397479.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       192   7e-54   
gb|KCW82843.1|  hypothetical protein EUGRSUZ_C04214                     192   8e-54   Eucalyptus grandis [rose gum]
ref|XP_006293915.1|  hypothetical protein CARUB_v10022906mg             191   1e-53   
ref|XP_004245323.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    191   2e-53   Solanum lycopersicum
ref|XP_007013427.1|  Major facilitator superfamily protein, putative    190   5e-53   
gb|EMT23542.1|  Nitrate/chlorate transporter                            189   2e-52   
emb|CDY69100.1|  BnaCnng61860D                                          177   4e-50   Brassica napus [oilseed rape]
emb|CDY30051.1|  BnaC05g09690D                                          177   5e-50   Brassica napus [oilseed rape]
dbj|BAJ90833.1|  predicted protein                                      181   7e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004968920.1|  PREDICTED: nitrate transporter 1.4-like isof...    181   1e-49   Setaria italica
ref|XP_006841166.1|  hypothetical protein AMTR_s00086p00160300          180   1e-49   
ref|XP_011093558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       180   2e-49   Sesamum indicum [beniseed]
gb|KFK43476.1|  hypothetical protein AALP_AA1G129900                    180   3e-49   Arabis alpina [alpine rockcress]
gb|KDO61483.1|  hypothetical protein CISIN_1g007736mg                   179   3e-49   Citrus sinensis [apfelsine]
ref|XP_006440344.1|  hypothetical protein CICLE_v10019412mg             179   3e-49   Citrus clementina [clementine]
ref|XP_003549905.1|  PREDICTED: nitrate transporter 1.1-like            179   5e-49   Glycine max [soybeans]
ref|XP_010676153.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       179   5e-49   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN09796.1|  Nitrate transporter 1.1                                 179   5e-49   Glycine soja [wild soybean]
emb|CDY21035.1|  BnaA08g24900D                                          179   5e-49   Brassica napus [oilseed rape]
ref|XP_006307075.1|  hypothetical protein CARUB_v10008661mg             179   5e-49   Capsella rubella
ref|XP_002282012.3|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            179   6e-49   
emb|CDY31242.1|  BnaC08g15370D                                          179   6e-49   Brassica napus [oilseed rape]
emb|CDY26539.1|  BnaA09g47380D                                          179   6e-49   Brassica napus [oilseed rape]
ref|XP_007155635.1|  hypothetical protein PHAVU_003G218500g             179   7e-49   Phaseolus vulgaris [French bean]
ref|XP_006477230.1|  PREDICTED: nitrate transporter 1.1-like            179   7e-49   Citrus sinensis [apfelsine]
ref|XP_009110669.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            179   7e-49   Brassica rapa
ref|NP_563899.1|  nitrate transporter 1.1                               179   7e-49   Arabidopsis thaliana [mouse-ear cress]
pdb|4OH3|A  Chain A, Crystal Structure Of A Nitrate Transporter         179   7e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011033950.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       178   8e-49   Populus euphratica
gb|AAA80582.1|  RCH2 protein                                            178   9e-49   Brassica napus [oilseed rape]
ref|XP_010493752.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       178   9e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010458634.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            178   9e-49   Camelina sativa [gold-of-pleasure]
emb|CBI28188.3|  unnamed protein product                                178   9e-49   Vitis vinifera
ref|XP_002889915.1|  NRT1.1                                             178   1e-48   Arabidopsis lyrata subsp. lyrata
gb|KHG28852.1|  Uncharacterized protein F383_16009                      177   1e-48   Gossypium arboreum [tree cotton]
ref|XP_010476167.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       178   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_007157339.1|  hypothetical protein PHAVU_002G061900g             178   1e-48   Phaseolus vulgaris [French bean]
ref|XP_010053448.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            178   1e-48   Eucalyptus grandis [rose gum]
ref|XP_002529778.1|  oligopeptide transporter, putative                 178   1e-48   Ricinus communis
emb|CAD32549.1|  dicarboxylate transporter                              177   2e-48   Alnus glutinosa
ref|XP_003517427.1|  PREDICTED: nitrate transporter 1.1-like            177   2e-48   Glycine max [soybeans]
ref|XP_010919516.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    177   2e-48   Elaeis guineensis
emb|CDY15967.1|  BnaC08g41560D                                          176   4e-48   Brassica napus [oilseed rape]
ref|XP_009118113.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       176   4e-48   Brassica rapa
ref|XP_010264234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       176   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_006475798.1|  PREDICTED: nitrate transporter 1.4-like isof...    176   5e-48   Citrus sinensis [apfelsine]
gb|AEA35415.1|  nitrate transporter                                     176   5e-48   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006417264.1|  hypothetical protein EUTSA_v10007157mg             176   6e-48   Eutrema salsugineum [saltwater cress]
ref|XP_008448872.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       176   6e-48   Cucumis melo [Oriental melon]
ref|NP_001275529.1|  nitrate transporter 1.1-like                       176   7e-48   Cucumis sativus [cucumbers]
ref|XP_010933692.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       176   9e-48   Elaeis guineensis
gb|EYU29794.1|  hypothetical protein MIMGU_mgv1a003534mg                175   1e-47   Erythranthe guttata [common monkey flower]
ref|XP_002303512.2|  nitrate transporter family protein                 175   1e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010919515.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    174   1e-47   Elaeis guineensis
ref|XP_004511669.1|  PREDICTED: nitrate transporter 1.1-like isof...    175   1e-47   
ref|XP_008675518.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like       175   2e-47   Zea mays [maize]
ref|XP_009382411.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       174   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010670639.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    174   2e-47   
gb|ACJ85583.1|  unknown                                                 170   2e-47   Medicago truncatula
ref|XP_008796822.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       174   3e-47   Phoenix dactylifera
ref|XP_004516839.1|  PREDICTED: nitrate transporter 1.1-like            174   3e-47   Cicer arietinum [garbanzo]
ref|XP_003608752.1|  Nitrate transporter                                174   3e-47   Medicago truncatula
emb|CBI31901.3|  unnamed protein product                                174   3e-47   Vitis vinifera
ref|XP_002266951.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            174   3e-47   Vitis vinifera
emb|CAN71417.1|  hypothetical protein VITISV_004658                     174   3e-47   Vitis vinifera
ref|XP_010258991.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       174   3e-47   Nelumbo nucifera [Indian lotus]
ref|NP_001169613.1|  uncharacterized protein LOC100383494               174   4e-47   Zea mays [maize]
ref|XP_009411557.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       174   4e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010553465.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       174   4e-47   Tarenaya hassleriana [spider flower]
ref|XP_003611284.1|  Nitrate transporter                                174   4e-47   Medicago truncatula
emb|CDP09929.1|  unnamed protein product                                173   9e-47   Coffea canephora [robusta coffee]
gb|KJB20886.1|  hypothetical protein B456_003G170400                    172   1e-46   Gossypium raimondii
ref|XP_007039888.1|  Nitrate transporter 1.1 isoform 1                  172   1e-46   
ref|XP_009411558.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       172   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008238567.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            172   1e-46   Prunus mume [ume]
ref|XP_010676154.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       172   2e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW80908.1|  hypothetical protein ZEAMMB73_061861                    172   2e-46   
ref|XP_004298652.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3 isof...    172   3e-46   Fragaria vesca subsp. vesca
dbj|BAC81420.1|  nitrate transporter                                    171   3e-46   Prunus persica
dbj|BAD22820.1|  nitrate transporter                                    171   3e-46   Prunus persica
ref|XP_007210870.1|  hypothetical protein PRUPE_ppa003177mg             171   3e-46   Prunus persica
ref|XP_011081220.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       171   4e-46   Sesamum indicum [beniseed]
ref|XP_009333599.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       171   4e-46   Pyrus x bretschneideri [bai li]
gb|KJB20885.1|  hypothetical protein B456_003G170300                    171   6e-46   Gossypium raimondii
ref|XP_010670640.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    170   6e-46   
gb|KHG24776.1|  Uncharacterized protein F383_04224                      171   6e-46   Gossypium arboreum [tree cotton]
ref|XP_009333673.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       170   7e-46   Pyrus x bretschneideri [bai li]
ref|XP_003538742.1|  PREDICTED: nitrate transporter 1.1                 170   8e-46   Glycine max [soybeans]
gb|KHN34951.1|  Nitrate transporter 1.1                                 170   9e-46   Glycine soja [wild soybean]
ref|XP_006645998.1|  PREDICTED: nitrate transporter 1.4-like            169   1e-45   
gb|KHG00259.1|  Uncharacterized protein F383_18798                      169   2e-45   Gossypium arboreum [tree cotton]
ref|XP_003611286.1|  Nitrate transporter                                169   2e-45   Medicago truncatula
gb|KHG27943.1|  Uncharacterized protein F383_15837                      168   5e-45   Gossypium arboreum [tree cotton]
ref|XP_007039889.1|  Nitrate transporter 1.1 isoform 2                  168   5e-45   
gb|ABF93501.1|  Nitrate/chlorate transporter, putative, expressed       168   6e-45   Oryza sativa Japonica Group [Japonica rice]
gb|KJB25599.1|  hypothetical protein B456_004G199600                    167   6e-45   Gossypium raimondii
ref|XP_008358135.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       167   7e-45   Malus domestica [apple tree]
ref|XP_009411045.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       167   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004244572.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       166   2e-44   Solanum lycopersicum
ref|XP_008437115.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    166   2e-44   Cucumis melo [Oriental melon]
ref|XP_006650950.1|  PREDICTED: nitrate transporter 1.1-like            166   3e-44   
ref|XP_009407160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       166   4e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009376056.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       165   5e-44   Pyrus x bretschneideri [bai li]
gb|EYU18566.1|  hypothetical protein MIMGU_mgv1a020825mg                165   5e-44   Erythranthe guttata [common monkey flower]
ref|XP_010906609.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    165   5e-44   Elaeis guineensis
ref|XP_009382412.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       165   5e-44   
ref|XP_004147617.1|  PREDICTED: nitrate transporter 1.1-like            165   6e-44   Cucumis sativus [cucumbers]
gb|EYU30304.1|  hypothetical protein MIMGU_mgv1a003140mg                164   9e-44   Erythranthe guttata [common monkey flower]
ref|XP_004983703.1|  PREDICTED: nitrate transporter 1.1-like            164   1e-43   Setaria italica
ref|XP_009388204.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       164   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAC07206.1|  nitrate transporter                                    164   1e-43   Brassica napus [oilseed rape]
ref|XP_002443879.1|  hypothetical protein SORBIDRAFT_07g003690          164   1e-43   Sorghum bicolor [broomcorn]
ref|XP_008808741.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       164   1e-43   Phoenix dactylifera
ref|XP_003573480.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       164   2e-43   Brachypodium distachyon [annual false brome]
ref|XP_004983702.1|  PREDICTED: nitrate transporter 1.1-like            164   2e-43   Setaria italica
ref|XP_009800593.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like...    164   2e-43   Nicotiana sylvestris
emb|CAC00545.1|  putative low-affinity nitrate transporter              164   2e-43   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ACT66297.1|  truncated nitrate transporter                           154   2e-43   Fragaria vesca [alpine strawberry]
gb|EMT27348.1|  Nitrate/chlorate transporter                            160   2e-43   
dbj|BAC56916.1|  nitrate transporter                                    163   2e-43   Nicotiana tabacum [American tobacco]
ref|XP_006358355.1|  PREDICTED: nitrate transporter 1.1-like            163   3e-43   Solanum tuberosum [potatoes]
ref|XP_008649786.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       163   3e-43   Zea mays [maize]
ref|XP_009598780.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       163   3e-43   Nicotiana tomentosiformis
gb|EAY88182.1|  hypothetical protein OsI_09629                          163   3e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_004972811.1|  PREDICTED: nitrate transporter 1.1-like isof...    162   4e-43   Setaria italica
ref|XP_004972812.1|  PREDICTED: nitrate transporter 1.1-like isof...    162   5e-43   
ref|XP_009763469.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       162   7e-43   Nicotiana sylvestris
gb|AFW57313.1|  hypothetical protein ZEAMMB73_359381                    162   7e-43   
dbj|BAC56915.1|  nitrate transporter                                    162   7e-43   Nicotiana tabacum [American tobacco]
ref|NP_001145735.1|  uncharacterized protein LOC100279242               162   7e-43   Zea mays [maize]
ref|XP_002464959.1|  hypothetical protein SORBIDRAFT_01g029470          162   9e-43   Sorghum bicolor [broomcorn]
ref|XP_003566777.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.2            161   1e-42   Brachypodium distachyon [annual false brome]
dbj|BAD87491.1|  putative dicarboxylate transporter                     161   1e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008367434.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    161   1e-42   
gb|EAY74514.1|  hypothetical protein OsI_02405                          161   2e-42   Oryza sativa Indica Group [Indian rice]
dbj|BAJ90348.1|  predicted protein                                      160   4e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010324989.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    159   4e-42   
ref|XP_008658424.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       159   6e-42   Zea mays [maize]
ref|XP_009801608.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       159   6e-42   Nicotiana sylvestris
ref|XP_011070105.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       159   8e-42   Sesamum indicum [beniseed]
gb|EMT10378.1|  Nitrate/chlorate transporter                            159   9e-42   
dbj|BAK05363.1|  predicted protein                                      159   9e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001043326.1|  Os01g0556700                                       159   1e-41   
ref|XP_006662041.1|  PREDICTED: nitrate transporter 1.1-like            159   1e-41   Oryza brachyantha
ref|XP_009613364.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       159   1e-41   Nicotiana tomentosiformis
gb|EEC67416.1|  hypothetical protein OsI_34598                          159   1e-41   Oryza sativa Indica Group [Indian rice]
gb|EAZ16929.1|  hypothetical protein OsJ_32411                          159   1e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003572060.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       159   1e-41   Brachypodium distachyon [annual false brome]
gb|ABB47972.1|  Nitrate/chlorate transporter, putative, expressed       158   2e-41   Oryza sativa Japonica Group [Japonica rice]
gb|AAK15441.1|AC037426_3  putative nitrate transporter                  158   2e-41   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ12317.1|  hypothetical protein OsJ_02208                          158   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008658431.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       157   3e-41   Zea mays [maize]
ref|XP_004242006.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       157   4e-41   Solanum lycopersicum
ref|XP_006366745.1|  PREDICTED: nitrate transporter 1.1-like            157   5e-41   Solanum tuberosum [potatoes]
ref|XP_008794846.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       156   8e-41   Phoenix dactylifera
gb|KDP25643.1|  hypothetical protein JCGZ_20799                         156   1e-40   Jatropha curcas
dbj|BAC99394.1|  putative nitrate transporter                           155   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010941437.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       155   2e-40   Elaeis guineensis
gb|KHN42706.1|  Nitrate transporter 1.1                                 154   3e-40   Glycine soja [wild soybean]
ref|XP_010533775.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       155   3e-40   Tarenaya hassleriana [spider flower]
ref|XP_009591624.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    154   3e-40   Nicotiana tomentosiformis
gb|EAZ41557.1|  hypothetical protein OsJ_26080                          154   4e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003574312.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       154   4e-40   Brachypodium distachyon [annual false brome]
ref|XP_002468692.1|  hypothetical protein SORBIDRAFT_01g050410          154   5e-40   Sorghum bicolor [broomcorn]
ref|XP_010669517.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            154   6e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006659845.1|  PREDICTED: nitrate transporter 1.1-like            152   2e-39   
gb|EMS53820.1|  Nitrate transporter 1.4                                 151   5e-39   Triticum urartu
gb|EYU24743.1|  hypothetical protein MIMGU_mgv1a003354mg                151   6e-39   Erythranthe guttata [common monkey flower]
ref|XP_006355480.1|  PREDICTED: nitrate transporter 1.1-like            150   7e-39   Solanum tuberosum [potatoes]
emb|CAC00544.1|  putative low-affinity nitrate transporter              150   2e-38   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009798260.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       149   2e-38   Nicotiana sylvestris
ref|XP_009611019.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       149   2e-38   Nicotiana tomentosiformis
ref|XP_006475799.1|  PREDICTED: nitrate transporter 1.4-like isof...    149   2e-38   Citrus sinensis [apfelsine]
ref|XP_002452347.1|  hypothetical protein SORBIDRAFT_04g024090          148   4e-38   Sorghum bicolor [broomcorn]
ref|NP_001047240.1|  Os02g0580900                                       148   5e-38   
gb|EEC73483.1|  hypothetical protein OsI_07814                          149   5e-38   Oryza sativa Indica Group [Indian rice]
ref|XP_011005904.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like...    148   7e-38   Populus euphratica
ref|XP_002301604.2|  hypothetical protein POPTR_0002s21630g             147   1e-37   
ref|XP_003575234.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            147   2e-37   Brachypodium distachyon [annual false brome]
dbj|BAJ98569.1|  predicted protein                                      147   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS59108.1|  hypothetical protein M569_15702                         146   3e-37   Genlisea aurea
ref|XP_007011887.1|  Major facilitator superfamily protein isoform 2    145   4e-37   
ref|XP_004245746.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       145   6e-37   Solanum lycopersicum
ref|NP_001173227.1|  Os03g0103000                                       137   8e-37   
gb|EMT12146.1|  Nitrate/chlorate transporter                            136   2e-36   
ref|XP_002274227.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            144   3e-36   Vitis vinifera
gb|KJB64774.1|  hypothetical protein B456_010G064200                    143   3e-36   Gossypium raimondii
ref|XP_011005903.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like...    142   5e-36   Populus euphratica
gb|EAZ09238.1|  hypothetical protein OsI_31511                          136   7e-36   Oryza sativa Indica Group [Indian rice]
ref|XP_002972300.1|  hypothetical protein SELMODRAFT_97069              142   9e-36   
ref|XP_002984211.1|  hypothetical protein SELMODRAFT_119838             142   9e-36   
gb|ACF22756.1|  nitrate transporter                                     141   2e-35   Brachypodium distachyon [annual false brome]
ref|NP_001281186.1|  peptide transporter PTR2                           141   2e-35   Zea mays [maize]
ref|XP_010050000.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    140   2e-35   Eucalyptus grandis [rose gum]
emb|CBI28855.3|  unnamed protein product                                144   2e-35   Vitis vinifera
gb|ACG29230.1|  peptide transporter PTR2                                140   2e-35   Zea mays [maize]
gb|ACR34962.1|  unknown                                                 139   1e-34   Zea mays [maize]
ref|XP_004952902.1|  PREDICTED: nitrate transporter 1.3-like            139   1e-34   Setaria italica
gb|KJB64773.1|  hypothetical protein B456_010G064200                    138   1e-34   Gossypium raimondii
ref|XP_001781235.1|  predicted protein                                  139   2e-34   
ref|XP_006357958.1|  PREDICTED: nitrate transporter 1.3-like            138   3e-34   Solanum tuberosum [potatoes]
ref|XP_009365099.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            137   3e-34   
dbj|BAJ34220.1|  unnamed protein product                                134   3e-34   
ref|XP_008379664.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       137   4e-34   
ref|XP_002986344.1|  hypothetical protein SELMODRAFT_425373             137   5e-34   
ref|XP_004243520.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            135   1e-33   
ref|XP_008230007.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            135   2e-33   
ref|XP_004251535.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            134   6e-33   
ref|XP_002979108.1|  hypothetical protein SELMODRAFT_444106             134   8e-33   
gb|KJB46720.1|  hypothetical protein B456_008G2375002                   133   8e-33   
ref|XP_009608738.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.2-like...    133   9e-33   
gb|KDO54285.1|  hypothetical protein CISIN_1g008231mg                   133   1e-32   
gb|KDP30797.1|  hypothetical protein JCGZ_13740                         133   1e-32   
gb|KJB46719.1|  hypothetical protein B456_008G2375002                   132   2e-32   
ref|XP_009606081.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       133   2e-32   
gb|KDO54284.1|  hypothetical protein CISIN_1g008231mg                   132   2e-32   
ref|XP_006447629.1|  hypothetical protein CICLE_v10014744mg             132   2e-32   
ref|XP_006406246.1|  hypothetical protein EUTSA_v10020360mg             132   2e-32   
ref|XP_009785350.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       132   3e-32   
ref|XP_007214955.1|  hypothetical protein PRUPE_ppa003196mg             132   3e-32   
ref|XP_010488187.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            132   3e-32   
gb|EYU30262.1|  hypothetical protein MIMGU_mgv1a019117mg                129   3e-32   
ref|XP_008342128.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       132   3e-32   
ref|XP_010466420.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       132   3e-32   
ref|XP_010510466.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       132   4e-32   
ref|XP_011047208.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       132   4e-32   
ref|XP_010035531.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            131   5e-32   
ref|XP_006352020.1|  PREDICTED: nitrate transporter 1.3-like            131   5e-32   
ref|XP_008798047.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4 isof...    129   5e-32   
gb|ACJ85753.1|  unknown                                                 127   5e-32   
ref|XP_008798048.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4 isof...    129   5e-32   
ref|XP_006483349.1|  PREDICTED: nitrate transporter 1.4-like isof...    130   6e-32   
gb|KJB25603.1|  hypothetical protein B456_004G199600                    130   1e-31   
ref|XP_009109414.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       130   1e-31   
tpg|DAA41872.1|  TPA: hypothetical protein ZEAMMB73_744112              127   1e-31   
ref|XP_011100362.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            130   2e-31   
ref|XP_002525323.1|  oligopeptide transporter, putative                 130   2e-31   
emb|CDY44319.1|  BnaC05g30740D                                          129   2e-31   
ref|XP_002885459.1|  nitrate transporter                                130   2e-31   
emb|CDY38629.1|  BnaA05g19580D                                          129   2e-31   
ref|XP_004491123.1|  PREDICTED: nitrate transporter 1.3-like            129   3e-31   
ref|XP_006408723.1|  hypothetical protein EUTSA_v10001943mg             128   4e-31   
ref|XP_009391232.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            129   5e-31   
ref|XP_006297285.1|  hypothetical protein CARUB_v10013300mg             129   6e-31   
ref|XP_008798046.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4 isof...    129   6e-31   
gb|AFK36687.1|  unknown                                                 127   7e-31   
ref|XP_003545571.1|  PREDICTED: nitrate transporter 1.3-like            128   9e-31   
gb|KFK39483.1|  hypothetical protein AALP_AA3G250100                    128   1e-30   
ref|XP_002975508.1|  hypothetical protein SELMODRAFT_103849             127   1e-30   
ref|XP_003616931.1|  Nitrate transporter                                127   1e-30   
ref|XP_004304094.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            127   2e-30   
ref|XP_009145465.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            127   2e-30   
ref|XP_002993534.1|  hypothetical protein SELMODRAFT_137176             127   2e-30   
gb|EYU34037.1|  hypothetical protein MIMGU_mgv1a003180mg                127   2e-30   
ref|XP_008670698.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       127   2e-30   
gb|KHM99092.1|  Nitrate transporter 1.3                                 127   3e-30   
ref|NP_188804.1|  nitrate transporter 1.3                               126   4e-30   
ref|XP_010913451.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            126   6e-30   
ref|XP_007049158.1|  Major facilitator superfamily protein isoform 1    125   7e-30   
gb|KHN38482.1|  Nitrate transporter 1.3                                 125   8e-30   
ref|XP_003519455.1|  PREDICTED: nitrate transporter 1.3                 125   9e-30   
gb|KJB10335.1|  hypothetical protein B456_001G196400                    124   9e-30   
gb|AAM61107.1|  nitrate transporter                                     125   1e-29   
gb|KJB10334.1|  hypothetical protein B456_001G196400                    124   2e-29   
gb|KHG25065.1|  Nitrate transporter 1.3 -like protein                   124   2e-29   
gb|KJB10333.1|  hypothetical protein B456_001G196400                    124   2e-29   
gb|KJB42856.1|  hypothetical protein B456_007G170800                    124   3e-29   
ref|XP_009589428.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       124   3e-29   
ref|XP_010110635.1|  Nitrate transporter 1.3                            124   3e-29   
ref|XP_009779307.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4-like       124   3e-29   
ref|XP_006441808.1|  hypothetical protein CICLE_v10019334mg             123   7e-29   
ref|XP_003529696.1|  PREDICTED: probable peptide/nitrate transpor...    122   8e-29   
ref|XP_007141630.1|  hypothetical protein PHAVU_008G212300g             122   1e-28   
ref|XP_010548417.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    122   1e-28   
gb|EMT27347.1|  Nitrate/chlorate transporter                            122   1e-28   
ref|NP_176183.1|  probable peptide/nitrate transporter                  122   2e-28   
ref|XP_006478312.1|  PREDICTED: probable peptide/nitrate transpor...    121   3e-28   
ref|XP_010064621.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       121   3e-28   
ref|XP_001771110.1|  predicted protein                                  121   3e-28   
ref|XP_006648788.1|  PREDICTED: nitrate transporter 1.3-like            119   5e-28   
gb|KGN63217.1|  Oligopeptide transporter                                120   5e-28   
gb|AFR11353.1|  nitrate transporter                                     120   5e-28   
ref|XP_007153917.1|  hypothetical protein PHAVU_003G076000g             120   6e-28   
ref|XP_010244160.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            120   7e-28   
ref|XP_010470202.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       120   8e-28   
ref|XP_002888185.1|  proton-dependent oligopeptide transport fami...    120   8e-28   
ref|XP_010511033.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       120   8e-28   
ref|XP_008455932.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            119   2e-27   
ref|XP_004151945.1|  PREDICTED: nitrate transporter 1.3-like            119   3e-27   
ref|XP_010548886.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.4            118   3e-27   
gb|KFK40857.1|  hypothetical protein AALP_AA2G050600                    118   5e-27   
ref|XP_010414658.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    117   6e-27   
ref|XP_009415000.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       117   8e-27   
gb|KHN04342.1|  Putative peptide/nitrate transporter                    115   8e-27   
emb|CAB38706.1|  nitrate transporter                                    117   9e-27   
gb|EMS61581.1|  Nitrate transporter 1.3                                 116   1e-26   
gb|KDO42071.1|  hypothetical protein CISIN_1g008953mg                   115   2e-26   
emb|CDP11323.1|  unnamed protein product                                117   2e-26   
ref|XP_006470829.1|  PREDICTED: probable peptide/nitrate transpor...    116   2e-26   
ref|XP_009416965.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       116   2e-26   
ref|XP_006431440.1|  hypothetical protein CICLE_v10000639mg             116   2e-26   
ref|XP_009401109.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       115   3e-26   
ref|XP_002527829.1|  nitrate transporter, putative                      114   4e-26   
ref|XP_006392243.1|  hypothetical protein EUTSA_v10023363mg             115   5e-26   
ref|XP_009341381.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       115   5e-26   
ref|XP_003562233.2|  PREDICTED: protein NRT1/ PTR FAMILY 6.3            114   1e-25   
ref|XP_008339431.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       114   1e-25   
ref|XP_003579814.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       114   1e-25   
ref|XP_004300018.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       114   1e-25   
ref|XP_006302056.1|  hypothetical protein CARUB_v10020041mg             114   1e-25   
ref|XP_010462648.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       107   2e-25   
ref|XP_002510466.1|  peptide transporter, putative                      113   2e-25   
ref|XP_003540130.1|  PREDICTED: probable peptide/nitrate transpor...    114   2e-25   
emb|CDY67653.1|  BnaAnng24930D                                          111   2e-25   
ref|XP_009113280.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    113   3e-25   
gb|KHN11039.1|  Putative peptide/nitrate transporter                    112   3e-25   
ref|XP_009403716.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    112   4e-25   
ref|XP_010682129.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            113   4e-25   
ref|XP_009403715.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like...    112   4e-25   
ref|XP_002268504.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       112   6e-25   
emb|CBI29637.3|  unnamed protein product                                112   6e-25   
emb|CDY70795.1|  BnaCnng69820D                                          109   6e-25   
gb|KHG30344.1|  hypothetical protein F383_15360                         112   7e-25   
ref|XP_004967918.1|  PREDICTED: probable peptide/nitrate transpor...    112   8e-25   
gb|KJB70778.1|  hypothetical protein B456_011G091000                    111   8e-25   
ref|XP_009103101.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       111   1e-24   
ref|XP_006836895.1|  hypothetical protein AMTR_s00099p00121400          111   1e-24   
ref|XP_009776306.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       111   1e-24   
ref|XP_008378949.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       111   2e-24   
ref|XP_007201615.1|  hypothetical protein PRUPE_ppa019863mg             111   2e-24   
ref|XP_010252354.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3 isof...    111   2e-24   
ref|XP_008237812.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       110   2e-24   
ref|XP_004485415.1|  PREDICTED: probable peptide/nitrate transpor...    110   2e-24   
ref|XP_007023125.1|  Major facilitator superfamily protein              111   2e-24   
ref|XP_010911895.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      110   2e-24   
ref|XP_009148612.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.3-like       106   2e-24   
ref|XP_009421158.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       110   2e-24   
ref|NP_001173970.1|  Os04g0464400                                       110   2e-24   
ref|XP_006844420.1|  hypothetical protein AMTR_s00016p00024040          110   2e-24   
ref|XP_007019707.1|  Major facilitator superfamily protein              110   3e-24   
ref|XP_008218643.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       110   3e-24   
ref|XP_003553503.1|  PREDICTED: peptide transporter PTR3-A-like         110   4e-24   
ref|XP_009419340.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       109   4e-24   
ref|XP_008459507.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4            109   4e-24   
emb|CAO02542.1|  putative proton-dependent oligopeptide transport...    104   5e-24   
ref|XP_004290270.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4            109   5e-24   
ref|XP_002280138.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       109   6e-24   
ref|XP_002306899.1|  hypothetical protein POPTR_0005s25490g             109   6e-24   
gb|KJB30349.1|  hypothetical protein B456_005G138800                    109   6e-24   
gb|KFK25573.1|  hypothetical protein AALP_AA8G132500                    109   6e-24   
ref|XP_009803729.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       109   7e-24   
ref|XP_003592869.1|  Peptide transporter PTR1                           109   7e-24   
ref|XP_004500964.1|  PREDICTED: peptide transporter PTR1-like iso...    108   7e-24   
ref|XP_007221822.1|  hypothetical protein PRUPE_ppa002962mg             109   7e-24   
ref|XP_004230414.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            108   1e-23   
ref|XP_009355381.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       108   1e-23   
ref|XP_004500965.1|  PREDICTED: peptide transporter PTR1-like iso...    108   1e-23   
gb|AIU49714.1|  major facilitator superfamily protein                   108   1e-23   
gb|KJB26921.1|  hypothetical protein B456_004G266300                    108   2e-23   
gb|ABK25104.1|  unknown                                                 108   2e-23   
gb|AIU49705.1|  major facilitator superfamily protein                   107   2e-23   
ref|XP_009617493.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       107   2e-23   
ref|XP_010059065.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.5-like       107   2e-23   
emb|CBI19780.3|  unnamed protein product                                108   2e-23   
gb|KCW74201.1|  hypothetical protein EUGRSUZ_E02847                     107   2e-23   
ref|XP_011087621.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       107   2e-23   
ref|XP_007226671.1|  hypothetical protein PRUPE_ppa021364mg             107   2e-23   
emb|CDO97656.1|  unnamed protein product                                107   2e-23   
ref|XP_006385089.1|  proton-dependent oligopeptide transport fami...    107   2e-23   
ref|XP_002976499.1|  hypothetical protein SELMODRAFT_105638             107   2e-23   
gb|KDP42512.1|  hypothetical protein JCGZ_00309                         107   2e-23   
emb|CDP07455.1|  unnamed protein product                                107   2e-23   
ref|XP_009624590.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       107   2e-23   
ref|XP_008221413.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       107   3e-23   
ref|XP_011095121.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4            107   3e-23   
ref|XP_011048871.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       107   3e-23   
ref|XP_001778896.1|  predicted protein                                  107   3e-23   
gb|KEH36217.1|  peptide transporter                                     107   3e-23   
ref|XP_007204887.1|  hypothetical protein PRUPE_ppa003472mg             107   3e-23   
ref|XP_006399831.1|  hypothetical protein EUTSA_v10012967mg             107   4e-23   
ref|XP_004504617.1|  PREDICTED: peptide transporter PTR2-like           107   4e-23   
ref|XP_004141613.1|  PREDICTED: probable peptide/nitrate transpor...    107   4e-23   
ref|XP_009336814.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       107   5e-23   
ref|XP_006473898.1|  PREDICTED: peptide transporter PTR1-like           106   5e-23   
ref|XP_010089167.1|  hypothetical protein L484_000371                   100   5e-23   
ref|XP_004299089.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            106   5e-23   
ref|XP_009602084.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       106   5e-23   
ref|XP_006468198.1|  PREDICTED: nitrate transporter 1.2-like            107   5e-23   
ref|XP_010528782.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            106   6e-23   
gb|EYU32880.1|  hypothetical protein MIMGU_mgv1a025520mg                106   6e-23   
dbj|BAJ53174.1|  JHL18I08.8                                             106   7e-23   
gb|KEH36218.1|  peptide transporter                                     106   7e-23   
ref|XP_008240575.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      106   7e-23   
ref|XP_011028408.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3            106   7e-23   
ref|XP_008377236.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       106   7e-23   
ref|XP_006403613.1|  hypothetical protein EUTSA_v10010246mg             106   7e-23   
ref|XP_009780466.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       106   8e-23   
ref|XP_002280835.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       106   8e-23   
gb|AIU49692.1|  major facilitator superfamily protein                   105   8e-23   
gb|KHG26925.1|  hypothetical protein F383_02518                         105   9e-23   
ref|XP_010326140.1|  PREDICTED: uncharacterized protein LOC101268606    107   1e-22   
gb|KJB67117.1|  hypothetical protein B456_010G175400                    105   1e-22   
ref|XP_001769410.1|  predicted protein                                  105   1e-22   
gb|AIU49711.1|  major facilitator superfamily protein                   103   1e-22   
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like           105   1e-22   
ref|XP_010105266.1|  Peptide transporter                                105   1e-22   
gb|AIU49700.1|  major facilitator superfamily protein                   105   1e-22   
ref|XP_010551275.1|  PREDICTED: protein NRT1/ PTR FAMILY 3.1            105   1e-22   
gb|KDO51375.1|  hypothetical protein CISIN_1g008177mg                   105   1e-22   
ref|XP_011003705.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.3-like       105   1e-22   
gb|AIU49689.1|  major facilitator superfamily protein                   105   1e-22   
ref|XP_009757633.1|  PREDICTED: protein NRT1/ PTR FAMILY 4.4-like       105   1e-22   
ref|XP_010937011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       105   2e-22   
ref|XP_006385186.1|  proton-dependent oligopeptide transport fami...    105   2e-22   
ref|XP_007046251.1|  Major facilitator superfamily protein isoform 1    105   2e-22   
ref|XP_010099787.1|  putative peptide/nitrate transporter               105   2e-22   
ref|XP_010091027.1|  hypothetical protein L484_000418                 99.4    2e-22   
ref|XP_008797124.1|  PREDICTED: protein NRT1/ PTR FAMILY 6.1            105   2e-22   
emb|CBI39328.3|  unnamed protein product                                104   2e-22   
emb|CDX91126.1|  BnaC02g04710D                                          105   2e-22   
gb|KHG03840.1|  Uncharacterized protein F383_26454                      104   2e-22   
ref|XP_003520611.1|  PREDICTED: peptide transporter PTR3-A-like         105   2e-22   



>gb|KDP32393.1| hypothetical protein JCGZ_13318 [Jatropha curcas]
Length=586

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMSWTV+DAVDYKGFPAD+SKTGGWVPAAL LGIEI ERL+TMGI VNLVTYL GTM
Sbjct  1    MDGKMSWTVSDAVDYKGFPADRSKTGGWVPAALALGIEICERLATMGIGVNLVTYLIGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HL S+TSANIV+DFMGTSF+LCLLGGFLADSFLGR+KTIAIF+ VQ +GTG LA  TKLP
Sbjct  61   HLSSATSANIVTDFMGTSFMLCLLGGFLADSFLGRYKTIAIFAVVQAIGTGMLATVTKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC  + +C++A GFQMG+LY+ALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCGTNNSCEQATGFQMGVLYIALYLIALGTGGLKSSVSGFGTDQFD  171



>ref|XP_009407665.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=575

 Score =   234 bits (598),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 152/173 (88%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+RK SW+VADAVDYKG PAD+SKTGGW PAALIL IEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MDRKASWSVADAVDYKGLPADRSKTGGWAPAALILVIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            H+PS+ SANIV+DFMGTSFLLCL GGFLADSFLGR+ TIAIF+ +Q LGTG L+++TKLP
Sbjct  61   HIPSAESANIVTDFMGTSFLLCLFGGFLADSFLGRYLTIAIFAMIQALGTGLLSISTKLP  120

Query  480  QLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PCN      CQ ANGFQMG LYL+LYLIA+GTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCNSTVTGQCQRANGFQMGALYLSLYLIAVGTGGLKSSVSGFGTDQFD  173



>ref|XP_008784904.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Phoenix dactylifera]
Length=589

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 155/173 (90%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KM W+VADAVDYKGFPAD+SKTGGWVPAALIL IEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MDGKMRWSVADAVDYKGFPADRSKTGGWVPAALILVIEISERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+ SAN+VSDFMGTS+LLCLLGGFLADSFLGR+ TIAIF+ VQ LGTGTL++AT+LP
Sbjct  61   HLPSAESANVVSDFMGTSYLLCLLGGFLADSFLGRYLTIAIFAMVQALGTGTLSVATRLP  120

Query  480  QLRPSPCNPH--QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PCN      CQ A+ FQMGILYL+L++IALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCNSSTTTTCQHADRFQMGILYLSLFVIALGTGGLKSSVSGFGTDQFD  173



>gb|KJB64775.1| hypothetical protein B456_010G064200 [Gossypium raimondii]
Length=586

 Score =   228 bits (580),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 149/171 (87%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAVDYKGFPAD+SKTGGW+PAALILGIEI ERLSTMGIAVNLVTYLGGT+
Sbjct  1    MEGKMSWTVADAVDYKGFPADRSKTGGWMPAALILGIEICERLSTMGIAVNLVTYLGGTL  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSAN+V+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIFS +Q LGTGTLALATKLP
Sbjct  61   HLPSSTSANVVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFSIIQTLGTGTLALATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC+    C++ANGFQMGILY+ALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCHGSHTCKQANGFQMGILYIALYLIALGTGGLKSSVSGFGTDQFD  171



>ref|XP_004159415.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score =   223 bits (567),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            K M+ K   TVADAVDYKG PA++SKTGGWVPAALI+GIE+ ERLSTMGIAVNLVTYL G
Sbjct  41   KRMDGKQKLTVADAVDYKGCPANRSKTGGWVPAALIVGIELCERLSTMGIAVNLVTYLVG  100

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatK  473
            T+HLPS+ SANIV+DFMGT FLL +LGGFLADSFLGR+KTIAIF+++Q LGTGTLA+ TK
Sbjct  101  TLHLPSANSANIVTDFMGTCFLLSMLGGFLADSFLGRYKTIAIFASIQTLGTGTLAVITK  160

Query  474  LPQLRPSPCNP--HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LPQL P PC+P   + C++ANGFQMG++YL LY+IALGTGG+KSSVSGFGTD FD
Sbjct  161  LPQLHPPPCHPIASKNCKQANGFQMGMIYLPLYIIALGTGGIKSSVSGFGTDQFD  215



>gb|KJB07736.1| hypothetical protein B456_001G041900 [Gossypium raimondii]
Length=581

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAVDYKGFPAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYL G M
Sbjct  1    MEGKMSWTVADAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLVGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSAN+V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+A+Q LGTG LA+ATKLP
Sbjct  61   HLPSSTSANVVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFAAIQTLGTGALAIATKLP  120

Query  480  QLRPSPCN--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC+      C+ ANGFQMGILY+ALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCHASASHTCKPANGFQMGILYVALYLIALGTGGLKSSVSGFGTDQFD  173



>ref|XP_008457678.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Cucumis melo]
Length=581

 Score =   221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 153/173 (88%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ K   TVADAVDYKG PA++SKTGGWVPAALI+GIE+ ERLSTMGIAVNLVTYL GT+
Sbjct  1    MDGKQRLTVADAVDYKGCPANRSKTGGWVPAALIVGIELCERLSTMGIAVNLVTYLVGTL  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+TSANIV+DFMGT FLL +LGGFLADSFLGR+KTIAIF+ +Q LGTGTLA+ TKLP
Sbjct  61   HLPSATSANIVTDFMGTCFLLSMLGGFLADSFLGRYKTIAIFATIQTLGTGTLAVITKLP  120

Query  480  QLRPSPCNP--HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QL P PC+P   + C++ANGFQMG++YL LYLIALGTGG+KSSVSGFGTD FD
Sbjct  121  QLHPPPCHPIGSKNCKQANGFQMGMIYLPLYLIALGTGGIKSSVSGFGTDQFD  173



>ref|XP_010049998.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Eucalyptus 
grandis]
Length=580

 Score =   221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K+SWTV+DAVDYKG PAD+SKTGGWVPAALILGIE+ ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MEEKLSWTVSDAVDYKGSPADRSKTGGWVPAALILGIEVCERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGR++TIAIF+ VQ LGT  LA++TKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFTLVQTLGTALLAISTKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP PC P   C +A+GFQMGILYLALYL+ALGTGGLKSSVSGFGTD FD
Sbjct  121  RLRPPPCQPTLPCNQADGFQMGILYLALYLVALGTGGLKSSVSGFGTDQFD  171



>ref|XP_004139418.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=623

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            K M+ K   TVADAVDYKG PA++SKTGGWVPAAL++GIE+ ERLSTMGIAVNLVTYL G
Sbjct  41   KRMDGKQRLTVADAVDYKGCPANRSKTGGWVPAALVVGIELCERLSTMGIAVNLVTYLVG  100

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatK  473
            T+HLPS+ SANIV+DFMGT FLL +LGGFLADSFLGR+KTIAIF+++Q LGTGTLA+ TK
Sbjct  101  TLHLPSANSANIVTDFMGTCFLLSMLGGFLADSFLGRYKTIAIFASIQTLGTGTLAVITK  160

Query  474  LPQLRPSPCNP--HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LPQL P PC+P   + C++ANGFQMG++YL LY+IALGTGG+KSSVSGFGTD FD
Sbjct  161  LPQLHPPPCHPIASKNCKQANGFQMGMIYLPLYIIALGTGGIKSSVSGFGTDQFD  215



>gb|AFR11354.1| nitrate transporter [Cucumis sativus]
Length=581

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 153/173 (88%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ K   TVADAVDYKG PA++SKTGGWVPAALI+GIE+ ERLSTMGIAVNLVTYL GT+
Sbjct  1    MDGKQRLTVADAVDYKGCPANRSKTGGWVPAALIVGIELCERLSTMGIAVNLVTYLVGTL  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+ SANIV+DFMGT FLL +LGGFLADSFLGR+KTIAIF+++Q LGTGTLA+ TKLP
Sbjct  61   HLPSANSANIVTDFMGTCFLLSMLGGFLADSFLGRYKTIAIFASIQTLGTGTLAVITKLP  120

Query  480  QLRPSPCNP--HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QL P PC+P   + C++ANGFQMG++YL LY+IALGTGG+KSSVSGFGTD FD
Sbjct  121  QLHPPPCHPIASKNCKQANGFQMGMIYLPLYIIALGTGGIKSSVSGFGTDQFD  173



>gb|KGN60671.1| hypothetical protein Csa_2G006170 [Cucumis sativus]
Length=581

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 153/173 (88%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ K   TVADAVDYKG PA++SKTGGWVPAAL++GIE+ ERLSTMGIAVNLVTYL GT+
Sbjct  1    MDGKQRLTVADAVDYKGCPANRSKTGGWVPAALVVGIELCERLSTMGIAVNLVTYLVGTL  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+ SANIV+DFMGT FLL +LGGFLADSFLGR+KTIAIF+++Q LGTGTLA+ TKLP
Sbjct  61   HLPSANSANIVTDFMGTCFLLSMLGGFLADSFLGRYKTIAIFASIQTLGTGTLAVITKLP  120

Query  480  QLRPSPCNP--HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QL P PC+P   + C++ANGFQMG++YL LY+IALGTGG+KSSVSGFGTD FD
Sbjct  121  QLHPPPCHPIASKNCKQANGFQMGMIYLPLYIIALGTGGIKSSVSGFGTDQFD  173



>ref|XP_010254379.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Nelumbo nucifera]
Length=582

 Score =   219 bits (558),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 158/173 (91%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMS +VADAVDYKGFPADKSKTGGWV AALILGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MENKMSLSVADAVDYKGFPADKSKTGGWVSAALILGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+TSAN V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIFS VQ LGTG LA++T+LP
Sbjct  61   HLPSATSANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFSVVQTLGTGLLAMSTRLP  120

Query  480  QLRPSPCNP--HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PCN    + C+EANGFQMGILYL+LYLIALGTGGLKSSVSGFG+D FD
Sbjct  121  QLRPPPCNTTLSRKCEEANGFQMGILYLSLYLIALGTGGLKSSVSGFGSDQFD  173



>ref|XP_002524480.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF37920.1| oligopeptide transporter, putative [Ricinus communis]
Length=581

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMSW VADAVDYKGFPAD+SKTGGW+PAAL+LGIE+ ERLSTMGI VNLVTYL GTM
Sbjct  1    MDGKMSWAVADAVDYKGFPADRSKTGGWLPAALVLGIEVCERLSTMGIGVNLVTYLIGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+TSAN+V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+ VQ LGTG LA  TK+P
Sbjct  61   HLPSATSANVVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFALVQTLGTGMLAAITKIP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PCN + +C +ANGFQMGILYLALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCNTNNSCVQANGFQMGILYLALYLIALGTGGLKSSVSGFGTDQFD  171



>ref|XP_002281975.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Vitis 
vinifera]
Length=580

 Score =   218 bits (555),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 146/173 (84%), Positives = 157/173 (91%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAVDYKGFPAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYL  TM
Sbjct  1    MEGKMSWTVADAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLVSTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+TSAN V+DFMGTSFLLCLLGGFLADSFLGRF+TIAIF+ VQ +GTG LA+ T+LP
Sbjct  61   HLPSATSANTVTDFMGTSFLLCLLGGFLADSFLGRFRTIAIFATVQAMGTGMLAIITRLP  120

Query  480  QLRPSPCN--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QL+P PC   P Q C++ANGFQMGILYLALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLQPPPCKNTPTQTCKQANGFQMGILYLALYLIALGTGGLKSSVSGFGTDQFD  173



>ref|XP_003609313.1| Nitrate transporter [Medicago truncatula]
 gb|AES91510.1| peptide/nitrate transporter [Medicago truncatula]
Length=577

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME+KMSWTV DAVDYKGFPAD+SKTGGWVPAALILGIEIVERLSTMGIAVNLVTYL G M
Sbjct  1    MEKKMSWTVGDAVDYKGFPADRSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLMGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            H+PSST+AN V+DFMGTSFLLCLLGGFLADSFLGR+KTI IFSA+Q LGT  LA++TKLP
Sbjct  61   HMPSSTAANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIGIFSAIQTLGTAALAISTKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             LRP PC+  ++C+ ANG QMG+LYLALYLIALGTGGLKSS+SGFG+D FD
Sbjct  121  SLRPPPCHAGESCKPANGIQMGVLYLALYLIALGTGGLKSSISGFGSDQFD  171



>ref|XP_009591623.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=583

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 145/168 (86%), Positives = 153/168 (91%), Gaps = 1/168 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTV+DAVDYKG PADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  2    MSWTVSDAVDYKGSPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  61

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            STSANIV+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+ +Q LGTG L LA  LPQLRP
Sbjct  62   STSANIVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFALIQTLGTGMLTLAVSLPQLRP  121

Query  492  SPCNPHQ-ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PC+ H  +CQ A G QMGILY+ALYLIALGTGGLKSSVSGFGTD FD
Sbjct  122  PPCHRHDVSCQPAKGSQMGILYMALYLIALGTGGLKSSVSGFGTDQFD  169



>ref|XP_009781779.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=576

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 155/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMS TVADAV+YKG PAD+SKTGGWVPAAL+LGIEI ERLSTMGIAVNLVTYLGG M
Sbjct  1    MEGKMSLTVADAVNYKGLPADRSKTGGWVPAALVLGIEINERLSTMGIAVNLVTYLGGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+ SANIV+DFMGT+FLLCLLGGFLADSFLGR+KTIAIF+ +Q LGTG L LAT LP
Sbjct  61   HLPSAASANIVTDFMGTAFLLCLLGGFLADSFLGRYKTIAIFAIIQSLGTGMLTLATGLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC+PH+ C+ A GFQMGILYLALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPQPCHPHEKCKPATGFQMGILYLALYLIALGTGGLKSSVSGFGTDQFD  171



>ref|XP_007013426.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY31045.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=581

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 159/173 (92%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAVDYKGFPAD+SKTGGW+PAALILGIEI ERLSTMGIAVNLVTYL  TM
Sbjct  1    MEGKMSWTVADAVDYKGFPADRSKTGGWIPAALILGIEICERLSTMGIAVNLVTYLVSTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS++SAN+V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+ +Q LGTGTLA+ATKLP
Sbjct  61   HLPSASSANVVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFAIIQTLGTGTLAIATKLP  120

Query  480  QLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC+   +  C+ ANGFQMG+LY+ALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCHASASLTCKPANGFQMGVLYMALYLIALGTGGLKSSVSGFGTDQFD  173



>ref|XP_009608737.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=578

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAV+YKG PAD+SKTGGWVPAAL+LGIEI ERLSTMGIAVNLVTYLGG M
Sbjct  1    MEGKMSWTVADAVNYKGLPADRSKTGGWVPAALVLGIEINERLSTMGIAVNLVTYLGGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+ SANIV+DFMGT+FLLCLLGGFLADSFLGR+KTIAIF+ +Q LGTG L L T LP
Sbjct  61   HLPSAASANIVTDFMGTAFLLCLLGGFLADSFLGRYKTIAIFAIIQSLGTGLLTLTTGLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC+PH+ C+ A G QMGILYLALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPHPCHPHEKCKPATGIQMGILYLALYLIALGTGGLKSSVSGFGTDQFD  171



>ref|XP_008444009.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Cucumis melo]
Length=580

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 154/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  RKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHL  305
            +K+SWTVADAVDYKGFPADKSKTGGW+PAALILGIEI ERLSTMGIAVNLVTYLGG MHL
Sbjct  4    KKLSWTVADAVDYKGFPADKSKTGGWIPAALILGIEICERLSTMGIAVNLVTYLGGVMHL  63

Query  306  PSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQL  485
            PS+ SANIV+DFMGT FLLCLLGGFLADSFLGR+ TI I + +Q LGT TLA++TKLPQL
Sbjct  64   PSAASANIVTDFMGTCFLLCLLGGFLADSFLGRYYTILISAIIQTLGTATLAVSTKLPQL  123

Query  486  RPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            RP PC+  + C+EANGFQMGILYLALYLIALGTGGLKSS+SGFGTD FD
Sbjct  124  RPPPCDGTKTCKEANGFQMGILYLALYLIALGTGGLKSSISGFGTDQFD  172



>gb|AGA60121.1| nitrate transporter NRT1.4B [Cucumis sativus]
 gb|KGN65321.1| hypothetical protein Csa_1G324370 [Cucumis sativus]
Length=580

 Score =   213 bits (543),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  RKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHL  305
            +K+SWTVADAVDYKGFPADKSKTGGW+PAALILGIEI ERLSTMGIAVNLVTYLGG MHL
Sbjct  4    KKLSWTVADAVDYKGFPADKSKTGGWIPAALILGIEICERLSTMGIAVNLVTYLGGVMHL  63

Query  306  PSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQL  485
            PS+ SANIV+DFMGT FLLCLLGGFLADSFLGR+ TI I + +Q LGT  LA++TKLPQL
Sbjct  64   PSAASANIVTDFMGTCFLLCLLGGFLADSFLGRYYTILISALIQTLGTAALAVSTKLPQL  123

Query  486  RPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            RP PC+  + C+EANGFQMGILYLALYLIALGTGGLKSS+SGFGTD FD
Sbjct  124  RPPPCDGTKTCKEANGFQMGILYLALYLIALGTGGLKSSISGFGTDQFD  172



>ref|XP_010656420.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010656421.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Vitis 
vinifera]
 emb|CBI28187.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 154/169 (91%), Gaps = 2/169 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAVDYKGFPAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYL  TMHLPS
Sbjct  1    MSWTVADAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLVSTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            +TSAN V+DFMGTSFLLCLLGGFLADSFLGRF+TIAIF+ VQ +GTG LA+ T+LPQL+P
Sbjct  61   ATSANTVTDFMGTSFLLCLLGGFLADSFLGRFRTIAIFATVQAMGTGMLAIITRLPQLQP  120

Query  492  SPCN--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PC   P Q C++ANGFQMGILYLALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  PPCKNTPTQTCKQANGFQMGILYLALYLIALGTGGLKSSVSGFGTDQFD  169



>ref|XP_011093557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=583

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K S TVADA+DYKGFPAD+SKTGGW+PAALILGIEI ERLSTMGIAVNLVTYLGG M
Sbjct  1    MEGKRSLTVADALDYKGFPADRSKTGGWIPAALILGIEICERLSTMGIAVNLVTYLGGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGT FLLCLLGGFLADSFLGR+KTIA+F+ +Q LGTG LA+ ++LP
Sbjct  61   HLPSSTSANIVTDFMGTCFLLCLLGGFLADSFLGRYKTIAVFAIIQTLGTGMLAITSELP  120

Query  480  QLRPSPCNPHQA-CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC+ H   C++ANGFQMG+LYLALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCHAHDINCKQANGFQMGMLYLALYLIALGTGGLKSSVSGFGTDQFD  172



>ref|XP_004150978.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
 ref|XP_004168393.1| PREDICTED: nitrate transporter 1.4-like [Cucumis sativus]
Length=599

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  126  RKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHL  305
            +K+SWTVADAVDYKGFPADKSKTGGW+PAALILGIEI ERLSTMGIAVNLVTYLGG MHL
Sbjct  23   KKLSWTVADAVDYKGFPADKSKTGGWIPAALILGIEICERLSTMGIAVNLVTYLGGVMHL  82

Query  306  PSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQL  485
            PS+ SANIV+DFMGT FLLCLLGGFLADSFLGR+ TI I + +Q LGT  LA++TKLPQL
Sbjct  83   PSAASANIVTDFMGTCFLLCLLGGFLADSFLGRYYTILISALIQTLGTAALAVSTKLPQL  142

Query  486  RPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            RP PC+  + C+EANGFQMGILYLALYLIALGTGGLKSS+SGFGTD FD
Sbjct  143  RPPPCDGTKTCKEANGFQMGILYLALYLIALGTGGLKSSISGFGTDQFD  191



>ref|XP_010254380.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Nelumbo nucifera]
Length=578

 Score =   213 bits (542),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 155/169 (92%), Gaps = 2/169 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MS +VADAVDYKGFPADKSKTGGWV AALILGIEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  1    MSLSVADAVDYKGFPADKSKTGGWVSAALILGIEICERLSTMGIAVNLVTYLGGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            +TSAN V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIFS VQ LGTG LA++T+LPQLRP
Sbjct  61   ATSANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFSVVQTLGTGLLAMSTRLPQLRP  120

Query  492  SPCNP--HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PCN    + C+EANGFQMGILYL+LYLIALGTGGLKSSVSGFG+D FD
Sbjct  121  PPCNTTLSRKCEEANGFQMGILYLSLYLIALGTGGLKSSVSGFGSDQFD  169



>ref|XP_007154995.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
 gb|ESW26989.1| hypothetical protein PHAVU_003G164000g [Phaseolus vulgaris]
Length=581

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 137/172 (80%), Positives = 156/172 (91%), Gaps = 1/172 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSW V +AVDYKGFPAD+SKTGGW+PAALILGIEIVERLSTMGIAVNLVTY+   M
Sbjct  1    MEEKMSWIVTEAVDYKGFPADRSKTGGWIPAALILGIEIVERLSTMGIAVNLVTYMISVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSST+AN V+DFMGTSFLLCLLGGFLADSFLGR+KTI IF+++Q LGT  LA+++KLP
Sbjct  61   HLPSSTAANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIGIFASIQTLGTAALAISSKLP  120

Query  480  QLRPSPCNPH-QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC+ +  +CQ+ANGFQMGILYL+LYLIALGTGGLKSSVSGFG+D FD
Sbjct  121  QLRPPPCHANSDSCQQANGFQMGILYLSLYLIALGTGGLKSSVSGFGSDQFD  172



>ref|XP_004508509.1| PREDICTED: nitrate transporter 1.4-like [Cicer arietinum]
Length=581

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 142/172 (83%), Positives = 157/172 (91%), Gaps = 1/172 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME+KMSWT+ DAVDYKGFPAD+SKTGGWV AALILGIEIVERLSTMGIAVNLVTYL G M
Sbjct  1    MEKKMSWTIGDAVDYKGFPADRSKTGGWVTAALILGIEIVERLSTMGIAVNLVTYLMGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSST+AN V+DFMGTSFLLCLLGGFLADSFLGRF+TI IF+A+Q LGT TLA++TKLP
Sbjct  61   HLPSSTAANTVTDFMGTSFLLCLLGGFLADSFLGRFRTIVIFAAIQTLGTATLAISTKLP  120

Query  480  QLRPSPC-NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC   +++C+ ANG QMGILYLALYLIALGTGGLKSSVSGFG+D FD
Sbjct  121  QLRPPPCPASNESCKPANGIQMGILYLALYLIALGTGGLKSSVSGFGSDQFD  172



>ref|XP_006600752.1| PREDICTED: nitrate transporter 1.4-like [Glycine max]
Length=585

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMSWTVADAVDYKGFPAD+SKTGGWVPAALILGIEIVERLSTMGIAVNLVTY+   M
Sbjct  1    MKEKMSWTVADAVDYKGFPADRSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYMISIM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSST+AN V+DFMGTSFLLCLLGGFLADSFLGR+KTI IF+++Q LGT TLA++TKLP
Sbjct  61   HLPSSTAANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIGIFASIQTLGTATLAISTKLP  120

Query  480  QLRPSPCNPH-QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             LRP PC+ +  +C++ANGFQMGILYL+LYLIALGTGGLKSSVSGFG+D FD
Sbjct  121  GLRPPPCHANSDSCKQANGFQMGILYLSLYLIALGTGGLKSSVSGFGSDQFD  172



>gb|KHN47160.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 140/172 (81%), Positives = 158/172 (92%), Gaps = 1/172 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWTVADAV+YKGFPAD+SKTGGWVPAALILGIEIVERLSTMGIAVNLVTY+   M
Sbjct  1    MEEKMSWTVADAVNYKGFPADRSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYMISIM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSST+AN V+DFMGTSFLLCLLGGFLADSFLGR+KTI IF+++Q LGT TLA++TKLP
Sbjct  61   HLPSSTAANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIGIFASIQTLGTATLAISTKLP  120

Query  480  QLRPSPCNPH-QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             LRP PC+ +  +C++ANGFQMGILYL+LYLIALGTGGLKSSVSGFG+D FD
Sbjct  121  GLRPPPCHANSDSCKQANGFQMGILYLSLYLIALGTGGLKSSVSGFGSDQFD  172



>ref|XP_011458172.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Fragaria vesca subsp. 
vesca]
Length=579

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 151/174 (87%), Gaps = 3/174 (2%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSWT ADAVDYKGFPADKS+TGGWV AALILGIEI ERLSTMGIAVNLVTYL GTM
Sbjct  1    MEEKMSWTAADAVDYKGFPADKSRTGGWVSAALILGIEICERLSTMGIAVNLVTYLVGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DF GTSFLLCLLGGFLADSFLGR+KTIAIF+++Q LG   LA++ KLP
Sbjct  61   HLPSSTSANIVTDFAGTSFLLCLLGGFLADSFLGRYKTIAIFASIQSLGIVALAISVKLP  120

Query  480  QLRPSPCNPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP  C+   A   CQ+AN FQMG LYLALY+IALG GGLKSSVSGFGTD FD
Sbjct  121  QLRPPHCDITAANNDCQQANEFQMGFLYLALYMIALGIGGLKSSVSGFGTDQFD  174



>ref|XP_010533169.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   211 bits (537),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 145/171 (85%), Positives = 156/171 (91%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PA+KSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYL  TM
Sbjct  1    MENKGSWTVADAVDYMGRPAEKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLMDTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIF+ VQ+LGTG+LALATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFAFVQLLGTGSLALATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             LRP PC+  + C+ A+GFQM ILY+ALYLIALGTGGLKSSVSGFG+D FD
Sbjct  121  GLRPPPCHHGEHCKPASGFQMTILYIALYLIALGTGGLKSSVSGFGSDQFD  171



>ref|XP_008792048.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Phoenix 
dactylifera]
Length=589

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 154/175 (88%), Gaps = 4/175 (2%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KM W+V DAVDYKG PAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MDGKMRWSVEDAVDYKGLPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+ SAN+VSDFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ LGT  L++ T+LP
Sbjct  61   HLPSAESANVVSDFMGTSFLLCLLGGFLADSFLGRYLTIAIFAVVQALGTCMLSVTTRLP  120

Query  480  QLRPSPCNPHQA----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PCN   +    C++ANGFQ+GILYL+LYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCNSLSSRSTKCEQANGFQLGILYLSLYLIALGTGGLKSSVSGFGTDQFD  175



>gb|KJB82816.1| hypothetical protein B456_013G215400 [Gossypium raimondii]
Length=579

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 141/173 (82%), Positives = 155/173 (90%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMS TVADAVDYKG PADKS+TGGWVPAAL LGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MDEKMSLTVADAVDYKGHPADKSRTGGWVPAALSLGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+TSAN+V+DFMGTSFLLCLLGGFLADS+LGR++TIAIF+ VQMLGT  LA++TKLP
Sbjct  61   HLPSATSANVVTDFMGTSFLLCLLGGFLADSYLGRYRTIAIFAMVQMLGTCLLAVSTKLP  120

Query  480  QLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC       C++AN FQMGILYL+LYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCKYTNVTQCEQANSFQMGILYLSLYLIALGTGGLKSSVSGFGTDQFD  173



>ref|XP_009778211.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Nicotiana sylvestris]
Length=587

 Score =   210 bits (534),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 146/174 (84%), Positives = 153/174 (88%), Gaps = 4/174 (2%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            KEM   MSWTV+DAVDYKG PADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG
Sbjct  3    KEM---MSWTVSDAVDYKGSPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  59

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatK  473
            TMHLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGR+KTI IF+ +Q LGTG L LA  
Sbjct  60   TMHLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRYKTIVIFALIQTLGTGMLTLAVS  119

Query  474  LPQLRPSPCNPHQA-CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LPQLRP  C+ H   CQ A G QMGILY+ALYLIALGTGGLKSSVSGFGTD FD
Sbjct  120  LPQLRPPLCHRHDVNCQPAKGSQMGILYMALYLIALGTGGLKSSVSGFGTDQFD  173



>ref|XP_010541927.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Tarenaya hassleriana]
Length=582

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 153/171 (89%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K  WTVADAVDYKG PA+KSKTGGW+PAALILGIEIVERLSTMGIAVNLVTYL  TM
Sbjct  1    MENKGGWTVADAVDYKGRPAEKSKTGGWIPAALILGIEIVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLL LLGGFLADSFLGRFKTIA F+ VQMLGTG+LALATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLSLLGGFLADSFLGRFKTIAAFAVVQMLGTGSLALATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             LRP PC+  + C  A+GFQM ILY+ALYLIALGTGGLKSSVSGFG+D FD
Sbjct  121  GLRPPPCHHGEHCNPASGFQMTILYIALYLIALGTGGLKSSVSGFGSDQFD  171



>ref|XP_006837800.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
 gb|ERN00369.1| hypothetical protein AMTR_s00104p00113760 [Amborella trichopoda]
Length=576

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 144/161 (89%), Gaps = 1/161 (1%)
 Frame = +3

Query  153  AVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIV  332
            A+DYKGFPAD+SKTGGWVPAA ILGIE+VERLST+GI VNLVTYL GTMHLPS+TSANIV
Sbjct  4    ALDYKGFPADRSKTGGWVPAAFILGIELVERLSTLGIGVNLVTYLVGTMHLPSATSANIV  63

Query  333  SDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC-NPH  509
            +DFMGT FLLCLLGGF+ADSFLGR+ TI IFSA+Q LGTG LA+ +++PQL P PC + +
Sbjct  64   TDFMGTCFLLCLLGGFIADSFLGRYLTILIFSALQALGTGMLAIVSRIPQLHPPPCGHGN  123

Query  510  QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              C++ANG QMG+LY++LYLIALGTGGLKSSVSGFGTD FD
Sbjct  124  HHCEQANGLQMGVLYISLYLIALGTGGLKSSVSGFGTDQFD  164



>emb|CDX71495.1| BnaC04g17300D [Brassica napus]
Length=600

 Score =   209 bits (531),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            ++ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  
Sbjct  22   RKMESKGSWTVADAVDYNGLPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLME  81

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatK  473
            TMHLPSS SANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATK
Sbjct  82   TMHLPSSNSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATK  141

Query  474  LPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LPQLRP  C+  +AC  A  FQM  LY+ALYLIALGTGGLKSS+SGFG+D FD
Sbjct  142  LPQLRPPTCHHGEACTPATAFQMTFLYIALYLIALGTGGLKSSISGFGSDQFD  194



>ref|XP_004230062.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=574

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAV+YKG PAD++KTGGWVPAAL+LGIEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  2    MSWTVADAVNYKGLPADRTKTGGWVPAALVLGIEINERLSTMGIAVNLVTYLGGTMHLPS  61

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            + SANIV+DFMGT+FLL LLGGFLADSFLGR+KTIAIF+ +Q LGTG L + T LPQLRP
Sbjct  62   AASANIVTDFMGTAFLLSLLGGFLADSFLGRYKTIAIFALIQALGTGMLTVTTGLPQLRP  121

Query  492  SPCNPH-QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              C+PH + C+ ANGFQMGILYLALYLIALGTGGLKSSVSGFGTD FD
Sbjct  122  PTCHPHDKYCEPANGFQMGILYLALYLIALGTGGLKSSVSGFGTDQFD  169



>gb|KDO61703.1| hypothetical protein CISIN_1g008020mg [Citrus sinensis]
Length=581

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 152/173 (88%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M   +SWTVADAVDYKGFPAD+SKTGGWVPAAL LGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MGEMVSWTVADAVDYKGFPADRSKTGGWVPAALSLGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+TSANIV+DFMGTSFLLCLLGGFLADSFLGR++TIAIF+ VQ  GTG LA++TK P
Sbjct  61   HLPSATSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFATVQTFGTGLLAISTKQP  120

Query  480  QLRPSPCNPHQ--ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC       CQ A+G QMG+LY++LYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCQATDITKCQHASGIQMGVLYISLYLIALGTGGLKSSVSGFGTDQFD  173



>ref|XP_006483348.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
Length=581

 Score =   208 bits (529),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 152/173 (88%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M   +SWTVADAVDYKGFPAD+SKTGGWVPAAL LGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MGEMVSWTVADAVDYKGFPADRSKTGGWVPAALSLGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+TSANIV+DFMGTSFLLCLLGGFLADSFLGR++TIAIF+ VQ  GTG LA++TK P
Sbjct  61   HLPSATSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFATVQTFGTGLLAISTKQP  120

Query  480  QLRPSPCNPHQ--ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC       CQ A+G QMG+LY++LYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCQATDITKCQHASGIQMGVLYISLYLIALGTGGLKSSVSGFGTDQFD  173



>ref|XP_007011886.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY29505.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=668

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            K M  KMS TVADA+DYKGFPADKS+TGGWVPAAL LGIEI ERLSTMGIAVNLVTYLGG
Sbjct  87   KTMAEKMSLTVADAMDYKGFPADKSRTGGWVPAALSLGIEICERLSTMGIAVNLVTYLGG  146

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatK  473
            TMHLPS+TSAN+V+DFMGTSFLLCLLGGFLADS+LGR++TIAIF+ +Q LGT  LA++T+
Sbjct  147  TMHLPSATSANVVTDFMGTSFLLCLLGGFLADSYLGRYRTIAIFAIIQTLGTCMLAVSTR  206

Query  474  LPQLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LP+LRP PC   +   C++AN FQMGILYL+LYLIALGTGGLKSSVSGFGTD FD
Sbjct  207  LPELRPPPCQSTEVAQCKQANNFQMGILYLSLYLIALGTGGLKSSVSGFGTDQFD  261



>emb|CDY45207.1| BnaA07g12830D, partial [Brassica napus]
Length=587

 Score =   207 bits (528),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            ++ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  
Sbjct  9    RKMESKGSWTVADAVDYNGLPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLME  68

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatK  473
            TMHLPSS SANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATK
Sbjct  69   TMHLPSSNSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATK  128

Query  474  LPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LP+LRP  C+  +AC  A  FQM  LY+ALYLIALGTGGLKSS+SGFG+D FD
Sbjct  129  LPELRPPTCHHGEACTPATAFQMTFLYIALYLIALGTGGLKSSISGFGSDQFD  181



>ref|XP_006475801.1| PREDICTED: nitrate transporter 1.4-like isoform X6 [Citrus sinensis]
Length=417

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW VADAVDYKG PAD SKTGGWVPAAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MSWAVADAVDYKGSPADPSKTGGWVPAALVLGIELCERLSTMGIAVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            +TSANIV+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIF+AVQ LGTG LA+ TKL QLRP
Sbjct  61   ATSANIVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFAAVQTLGTGMLAMVTKLRQLRP  120

Query  492  SPCN--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PC       C++A+GFQMG+LY+ALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  RPCKETATHTCEQASGFQMGVLYIALYLIALGTGGLKSSVSGFGTDQFD  169



>ref|XP_008792049.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Phoenix 
dactylifera]
Length=585

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 151/171 (88%), Gaps = 4/171 (2%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            M W+V DAVDYKG PAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  1    MRWSVEDAVDYKGLPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            + SAN+VSDFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ LGT  L++ T+LPQLRP
Sbjct  61   AESANVVSDFMGTSFLLCLLGGFLADSFLGRYLTIAIFAVVQALGTCMLSVTTRLPQLRP  120

Query  492  SPCNPHQA----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PCN   +    C++ANGFQ+GILYL+LYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  PPCNSLSSRSTKCEQANGFQLGILYLSLYLIALGTGGLKSSVSGFGTDQFD  171



>ref|XP_002880817.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57076.1| nitrate transporter [Arabidopsis lyrata subsp. lyrata]
Length=577

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 140/171 (82%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDYKG PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP  C+  +AC  A  FQM ILY++LYLIALGTGGLKSS+SGFG+D FD
Sbjct  121  ELRPPTCHHGEACIPATSFQMTILYISLYLIALGTGGLKSSISGFGSDQFD  171



>ref|XP_006356754.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=580

 Score =   207 bits (527),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 143/168 (85%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MS TVADA+DYKG PADKSKTGGWVPA LILGIEIVERLSTMGIAVNLVTYLGG MHL S
Sbjct  1    MSLTVADAMDYKGSPADKSKTGGWVPATLILGIEIVERLSTMGIAVNLVTYLGGAMHLAS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            S SANIV+DFMGTSFLLCLLGGFLADSFLGR+KTIA+F+ +Q LGTG L +AT LPQLRP
Sbjct  61   SNSANIVTDFMGTSFLLCLLGGFLADSFLGRYKTIALFALIQTLGTGMLTVATSLPQLRP  120

Query  492  SPCNPHQA-CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            SPC+ H   CQ ANGFQMGILYLALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  SPCHRHDVNCQPANGFQMGILYLALYLIALGTGGLKSSVSGFGTDQFD  168



>gb|KHN15097.1| Nitrate transporter 1.4 [Glycine soja]
Length=581

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 155/168 (92%), Gaps = 1/168 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAVDYKGFPAD+SKTGGWVPAALILGIEIVERLSTMGIAVNLVTY+   MHLPS
Sbjct  1    MSWTVADAVDYKGFPADRSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYMISIMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            ST+AN V+DFMGTSFLLCLLGGFLADSFLGR+KTI IF+++Q LGT TLA++TKLP LRP
Sbjct  61   STAANTVTDFMGTSFLLCLLGGFLADSFLGRYKTIGIFASIQTLGTATLAISTKLPGLRP  120

Query  492  SPCNPHQ-ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PC+ +  +C++ANGFQMGILYL+LYLIALGTGGLKSSVSGFG+D FD
Sbjct  121  PPCHANSDSCKQANGFQMGILYLSLYLIALGTGGLKSSVSGFGSDQFD  168



>ref|XP_007204809.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
 gb|EMJ06008.1| hypothetical protein PRUPE_ppa021603mg [Prunus persica]
Length=585

 Score =   206 bits (525),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 147/170 (86%), Gaps = 3/170 (2%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAVDYKGFPADKS+TGGWV AALILGIEI ERLSTMGI VNLVTYL GTMHLPS
Sbjct  1    MSWTVADAVDYKGFPADKSRTGGWVAAALILGIEICERLSTMGIGVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            STSANIV+DF+GTSFLLCLLGGFLADSFLGR+ TIAIF+++Q +G   LA++ KLPQLRP
Sbjct  61   STSANIVTDFVGTSFLLCLLGGFLADSFLGRYNTIAIFASIQTVGMVALAISVKLPQLRP  120

Query  492  SPCNPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              C+   A   C++ANGFQMGI YLALY I LG GGLKSSVSGFGTD FD
Sbjct  121  PLCHATAASNNCKQANGFQMGIFYLALYTIGLGIGGLKSSVSGFGTDQFD  170



>gb|KHG05036.1| Nitrate transporter 1.4 -like protein [Gossypium arboreum]
Length=579

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 154/173 (89%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMS TVADAVDYKG PADKS+TGGWVPAAL LGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MDEKMSLTVADAVDYKGHPADKSRTGGWVPAALSLGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+TSAN+V+DFMGTSFLLCLLGGFLADS+LGR++TIAIF+ VQMLGT  LA++TKLP
Sbjct  61   HLPSATSANVVTDFMGTSFLLCLLGGFLADSYLGRYRTIAIFAMVQMLGTCLLAVSTKLP  120

Query  480  QLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP  C       C++AN FQMGILYL+LYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPLCKYTDVTQCEQANSFQMGILYLSLYLIALGTGGLKSSVSGFGTDQFD  173



>ref|NP_850084.1| nitrate transporter 1.4 [Arabidopsis thaliana]
 sp|Q9SZY4.1|PTR27_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.2; Short=AtNPF6.2; AltName: 
Full=Nitrate transporter 1.4 [Arabidopsis thaliana]
 emb|CAB38705.1| nitrate transporter [Arabidopsis thaliana]
 gb|AEC07875.1| nitrate transporter 1.4 [Arabidopsis thaliana]
Length=577

 Score =   206 bits (524),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDYKG PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTI IFS +Q LGTG LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIGIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP  C+  +AC  A  FQM ILY++LYLIALGTGGLKSS+SGFG+D FD
Sbjct  121  ELRPPTCHHGEACIPATAFQMTILYVSLYLIALGTGGLKSSISGFGSDQFD  171



>ref|XP_009103552.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brassica rapa]
Length=577

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 149/171 (87%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYNGLPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSS SANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATKLP
Sbjct  61   HLPSSNSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP  C+  +AC  A  FQM  LY+ALYLIALGTGGLKSS+SGFG+D FD
Sbjct  121  ELRPPTCHHGEACTPATAFQMTFLYIALYLIALGTGGLKSSISGFGSDQFD  171



>ref|XP_006347704.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=575

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAV+YKG PAD++KTGGW+PAAL+LGIEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  1    MSWTVADAVNYKGLPADRTKTGGWMPAALVLGIEINERLSTMGIAVNLVTYLGGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            + SANIV+DFMGT+FLL LLGGFLADSFLGR+KTIAIF+ +Q LGTG L + T +PQLRP
Sbjct  61   AASANIVTDFMGTAFLLSLLGGFLADSFLGRYKTIAIFALIQALGTGMLTVTTGMPQLRP  120

Query  492  SPCNPH-QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              C+PH + C+ ANGFQMGILYLALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  PTCHPHDKYCEPANGFQMGILYLALYLIALGTGGLKSSVSGFGTDQFD  168



>gb|AAM20651.1| putative nitrate transporter [Arabidopsis thaliana]
Length=577

 Score =   206 bits (523),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDYKG PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTI IFS +Q LGTG LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIGIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP  C+  +AC  A  FQM ILY++LYLIALGTGGLKSS+SGFG+D FD
Sbjct  121  ELRPPTCHHGEACIPATAFQMTILYVSLYLIALGTGGLKSSISGFGSDQFD  171



>ref|XP_006408724.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
 dbj|BAJ33792.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50177.1| hypothetical protein EUTSA_v10001943mg [Eutrema salsugineum]
Length=578

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 138/171 (81%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL GTM
Sbjct  1    MESKGSWTVADAVDYSGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSAN+V+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATKLP
Sbjct  61   HLPSSTSANVVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP  C+  + C  A  FQM ILY+ALYLIALGTGGLKSS+SGFG+D F+
Sbjct  121  ELRPPVCHHGEVCTPATAFQMTILYIALYLIALGTGGLKSSISGFGSDQFN  171



>emb|CDP10398.1| unnamed protein product [Coffea canephora]
Length=578

 Score =   205 bits (522),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = +3

Query  147  ADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSAN  326
            ADAVD++GFPADKSKTGGWVPAALILGIEI ERLSTMGIAVNLVTYLGGTMHLPS+ SAN
Sbjct  8    ADAVDHEGFPADKSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTMHLPSAVSAN  67

Query  327  IVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNP  506
             V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIFS +Q +GTG LA+ TK+PQLRP PC  
Sbjct  68   TVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFSTIQAMGTGMLAITTKVPQLRPPPCAA  127

Query  507  HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            H  CQ ANG QMG+LYLALYLIALGTGGLKSSVSGFG+D FD
Sbjct  128  HANCQTANGLQMGMLYLALYLIALGTGGLKSSVSGFGSDQFD  169



>ref|XP_010914872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=582

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 140/174 (80%), Positives = 154/174 (89%), Gaps = 3/174 (2%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMS +V DAVDYKG  AD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYL GTM
Sbjct  1    MDGKMSLSVEDAVDYKGSLADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLVGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+ SAN+V+DFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ LGTG L++ T+LP
Sbjct  61   HLPSAESANVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAIFAVVQALGTGMLSVTTRLP  120

Query  480  QLRPSPCNPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP+PCN   A   CQ+ANGFQMGILYL+LYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPAPCNASTATKSCQQANGFQMGILYLSLYLIALGTGGLKSSVSGFGTDQFD  174



>ref|XP_006475796.1| PREDICTED: nitrate transporter 1.4-like isoform X1 [Citrus sinensis]
 ref|XP_006475797.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Citrus sinensis]
 gb|KDO80312.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=575

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 151/169 (89%), Gaps = 2/169 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW VADAVDYKG PAD SKTGGWVPAAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MSWAVADAVDYKGSPADPSKTGGWVPAALVLGIELCERLSTMGIAVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            +TSANIV+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIF+AVQ LGTG LA+ TKL QLRP
Sbjct  61   ATSANIVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFAAVQTLGTGMLAMVTKLRQLRP  120

Query  492  SPCN--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PC       C++A+GFQMG+LY+ALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  RPCKETATHTCEQASGFQMGVLYIALYLIALGTGGLKSSVSGFGTDQFD  169



>ref|XP_010417814.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYSGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAIATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP  C+  +AC  A  FQM ILY++LYLIALGTGGLKSS+SGFG+D FD
Sbjct  121  ELRPPACHHGEACIPATTFQMTILYISLYLIALGTGGLKSSISGFGSDQFD  171



>ref|XP_010510873.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510875.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510876.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
 ref|XP_010510877.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X1 [Camelina 
sativa]
Length=577

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYSGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAIATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP  C+  +AC  A  FQM ILY++LYLIALGTGGLKSS+SGFG+D FD
Sbjct  121  ELRPPTCHHGEACIPATTFQMTILYISLYLIALGTGGLKSSISGFGSDQFD  171



>ref|XP_010473052.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Camelina sativa]
Length=577

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYSGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAIATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP  C+  +AC  A  FQM ILY++LYLIALGTGGLKSS+SGFG+D FD
Sbjct  121  ELRPPTCHHGEACIPATTFQMTILYISLYLIALGTGGLKSSISGFGSDQFD  171



>emb|CDY30787.1| BnaC07g16870D [Brassica napus]
Length=601

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = +3

Query  114  KEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGG  293
            ++ME K SWTVADAVDY G PADKSKTGGW+ AA ILGIE+VERLSTMGIAVNLVTYL  
Sbjct  23   RKMESKGSWTVADAVDYNGLPADKSKTGGWITAAFILGIEVVERLSTMGIAVNLVTYLME  82

Query  294  TMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatK  473
            TMHLPSS SANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATK
Sbjct  83   TMHLPSSNSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATK  142

Query  474  LPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LP+LRP  C+  + C  A  FQM  LY+ALYLIALGTGGLKSS+SGFG+D FD
Sbjct  143  LPELRPPTCHHGETCTTATAFQMTFLYIALYLIALGTGGLKSSISGFGSDQFD  195



>ref|XP_010510874.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 isoform X2 [Camelina 
sativa]
Length=577

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SWTVADAVDY G PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWTVADAVDYSGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAIATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP  C+  +AC  A  FQM ILY++LYLIALGTGGLKSS+SGFG+D FD
Sbjct  121  ELRPPTCHHGEACIPATTFQMTILYISLYLIALGTGGLKSSISGFGSDQFD  171



>ref|XP_010093242.1| Nitrate transporter 1.4 [Morus notabilis]
 gb|EXB53744.1| Nitrate transporter 1.4 [Morus notabilis]
Length=581

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 155/169 (92%), Gaps = 2/169 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSWTVADAVDYKGFPADKSKTGGW+PAALIL IE+ ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MSWTVADAVDYKGFPADKSKTGGWLPAALILVIELSERLSTMGIAVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            STSANIV+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+A+Q LGTG LA++TKLPQL+P
Sbjct  61   STSANIVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFAAIQTLGTGALAISTKLPQLQP  120

Query  492  SPCNPH--QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              C+    + C+ ANGFQMGILYLALYLIALGTGGLKSSVSGFG+D FD
Sbjct  121  PACDTASGKNCKPANGFQMGILYLALYLIALGTGGLKSSVSGFGSDQFD  169



>ref|XP_006450986.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
 gb|ESR64226.1| hypothetical protein CICLE_v10007850mg [Citrus clementina]
Length=575

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 150/169 (89%), Gaps = 2/169 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW VADAVDYKG PAD SKTGGWVPAAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MSWAVADAVDYKGSPADPSKTGGWVPAALVLGIELCERLSTMGIAVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            +TSANIV+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIF+AVQ LGTG LA+ TKL QLRP
Sbjct  61   ATSANIVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFAAVQTLGTGMLAMVTKLRQLRP  120

Query  492  SPCN--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PC       C++A GFQMG+LY+ALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  RPCKETATHTCEQARGFQMGVLYIALYLIALGTGGLKSSVSGFGTDQFD  169



>gb|EYU29790.1| hypothetical protein MIMGU_mgv1a003653mg [Erythranthe guttata]
Length=571

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 149/172 (87%), Gaps = 1/172 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M+ KMS TV DAVDY G PAD+S TGGWVPAALILGIEI ERLSTMGIAVNLVTYLGG M
Sbjct  1    MDEKMSLTVGDAVDYNGLPADRSNTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGVM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGT FLLCLLGGFLADSFLGR+KTIA+F+ VQ LGTG LA  T LP
Sbjct  61   HLPSSTSANIVTDFMGTCFLLCLLGGFLADSFLGRYKTIAVFALVQTLGTGMLATITALP  120

Query  480  QLRPSPCNPHQA-CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP PC+     C+EANGFQ+ ILYLALYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  ELRPPPCHTRDINCKEANGFQIAILYLALYLIALGTGGLKSSVSGFGTDQFD  172



>gb|AAB95302.1| putative nitrate transporter [Arabidopsis thaliana]
Length=586

 Score =   204 bits (519),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 150/170 (88%), Gaps = 0/170 (0%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K SWTVADAVDYKG PADKSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TMH
Sbjct  11   ESKGSWTVADAVDYKGRPADKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETMH  70

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQ  482
            LPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTI IFS +Q LGTG LA+ATKLP+
Sbjct  71   LPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIGIFSTIQALGTGALAVATKLPE  130

Query  483  LRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LRP  C+  +AC  A  FQM ILY++LYLIALGTGGLKSS+SGFG+D FD
Sbjct  131  LRPPTCHHGEACIPATAFQMTILYVSLYLIALGTGGLKSSISGFGSDQFD  180



>gb|KFK32490.1| hypothetical protein AALP_AA6G249500 [Arabis alpina]
Length=577

 Score =   203 bits (517),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 137/171 (80%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME K SW VADAVDY+G PA+KSKTGGW+ AALILGIE+VERLSTMGIAVNLVTYL  TM
Sbjct  1    MESKGSWMVADAVDYRGRPAEKSKTGGWITAALILGIEVVERLSTMGIAVNLVTYLMETM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG LA+ATKLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALAVATKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP  C+  +AC  A  FQM ILY++LYLIALGTGGLKSS+SGFG+D FD
Sbjct  121  ELRPPTCHHGEACTPATSFQMTILYISLYLIALGTGGLKSSISGFGSDQFD  171



>ref|XP_007013425.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY31044.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=591

 Score =   203 bits (517),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 158/183 (86%), Gaps = 12/183 (7%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALIL----------GIEIVERLSTMGIAV  269
            ME KMSWTVADAVDYKGFPAD+SKTGGW+PAALIL           IEI ERLSTMGIAV
Sbjct  1    MEGKMSWTVADAVDYKGFPADRSKTGGWIPAALILEGPEKSSSRKRIEICERLSTMGIAV  60

Query  270  NLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgt  449
            NLVTYL  TMHLPS++SAN+V+DFMGTSFLLCLLGGFLADSFLGR+KTIAIF+ +Q LGT
Sbjct  61   NLVTYLVSTMHLPSASSANVVTDFMGTSFLLCLLGGFLADSFLGRYKTIAIFAIIQTLGT  120

Query  450  gtlalatKLPQLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTD  623
            GTLA+ATKLPQLRP PC+   +  C+ ANGFQMG+LY+ALYLIALGTGGLKSSVSGFGTD
Sbjct  121  GTLAIATKLPQLRPPPCHASASLTCKPANGFQMGVLYMALYLIALGTGGLKSSVSGFGTD  180

Query  624  PFD  632
             FD
Sbjct  181  QFD  183



>ref|XP_010925226.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Elaeis guineensis]
Length=588

 Score =   203 bits (516),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 150/169 (89%), Gaps = 2/169 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW+V DAVDYKGFPAD++KTGGWVPAALIL IEI ERLSTMGIAVNLVTYLGGT+HLPS
Sbjct  1    MSWSVGDAVDYKGFPADRTKTGGWVPAALILVIEIAERLSTMGIAVNLVTYLGGTLHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            + SAN+VSDFMGTSFLLCLLGGFLADSFLGR+ TI IF+ +Q LGTG L++ T+LPQLRP
Sbjct  61   AESANVVSDFMGTSFLLCLLGGFLADSFLGRYLTIVIFAVIQALGTGMLSVVTRLPQLRP  120

Query  492  SPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PCN      CQEA+ FQMGILYL+LYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  PPCNSSTTAKCQEADVFQMGILYLSLYLIALGTGGLKSSVSGFGTDQFD  169



>ref|XP_010688014.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Beta vulgaris subsp. 
vulgaris]
Length=589

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 152/173 (88%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSW VADA DYKG PAD+SKTGGWVPAALILGIE+ ERLSTMGIAVNLVTYL  TM
Sbjct  1    MEGKMSWAVADAFDYKGDPADRSKTGGWVPAALILGIEMCERLSTMGIAVNLVTYLVNTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSAN+V+DFMGTSFLLCLLGGFLADSFLGRFKT+AIF+ VQ LGT  LA++TK+P
Sbjct  61   HLPSSTSANVVTDFMGTSFLLCLLGGFLADSFLGRFKTVAIFAVVQALGTAMLAISTKIP  120

Query  480  QLRPSPCN--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP PC+   ++ CQ A  FQMGILYLALYLIALGTGGLKSSVSG G+D FD
Sbjct  121  ELRPPPCDSSKNEPCQRATEFQMGILYLALYLIALGTGGLKSSVSGLGSDQFD  173



>ref|XP_009368838.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Pyrus x bretschneideri]
Length=576

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 148/170 (87%), Gaps = 3/170 (2%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            M WTVA AVDYKGFPA+ S+TGGWV AALILGIEI ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MGWTVAGAVDYKGFPANNSRTGGWVAAALILGIEICERLSTMGIAVNLVTYLVGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            +T+ANIV+DF+GTSFLLCLLGGFLADSFLGR+ TIAIF+++Q LG   LA++ KLPQLRP
Sbjct  61   ATAANIVTDFVGTSFLLCLLGGFLADSFLGRYNTIAIFASIQTLGMVGLAISVKLPQLRP  120

Query  492  SPCNPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              C+   A   C+EANGFQMGILYLALY+IALG GGLKSSVSGFGTD FD
Sbjct  121  PHCDTTAATNHCKEANGFQMGILYLALYIIALGIGGLKSSVSGFGTDQFD  170



>ref|XP_004243154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
 ref|XP_010323568.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Solanum lycopersicum]
Length=569

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 146/161 (91%), Gaps = 2/161 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DAVDYKGFPADKSKTGGWVPA LILGIEIVERLSTMGIAVNLVTYLGGTMHL SS SANI
Sbjct  4    DAVDYKGFPADKSKTGGWVPATLILGIEIVERLSTMGIAVNLVTYLGGTMHLASSNSANI  63

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V+DFMGTSFLLCLLGGFLADSFLGR+KTIA+F+ +Q LGTG L +AT LPQLRP PCN +
Sbjct  64   VTDFMGTSFLLCLLGGFLADSFLGRYKTIALFALIQTLGTGMLTVATTLPQLRPPPCNLN  123

Query  510  QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              CQ ANGFQMGILYLALYLIALGTGGLKSSVS FGTD FD
Sbjct  124  --CQPANGFQMGILYLALYLIALGTGGLKSSVSVFGTDQFD  162



>ref|XP_009403461.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 148/174 (85%), Gaps = 3/174 (2%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSW+VADAVDYKG PAD++KTGGW+PA LIL IEI ERLST+GI VNLVTYL GTM
Sbjct  1    MEGKMSWSVADAVDYKGSPADRTKTGGWIPAMLILVIEICERLSTLGIGVNLVTYLSGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+ SAN+VSDFMGTSFLLCLLGGFLAD++LGR+ T+AIFSAVQ  GTG L + TKLP
Sbjct  61   HLPSAESANVVSDFMGTSFLLCLLGGFLADAYLGRYLTVAIFSAVQAFGTGMLTVVTKLP  120

Query  480  QLRPSPCNPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC        C  ANGFQ+G+LYL+LYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  QLRPPPCGSSSGASKCHRANGFQIGLLYLSLYLIALGTGGLKSSVSGFGTDQFD  174



>ref|XP_008337300.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 148/171 (87%), Gaps = 3/171 (2%)
 Frame = +3

Query  129  KMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLP  308
            KM WTVA  +DYKG PA+KS+TGGWV AALILGIEI ERLSTMGIAVNLVTYL GTMHLP
Sbjct  5    KMGWTVAGVMDYKGLPANKSRTGGWVAAALILGIEICERLSTMGIAVNLVTYLVGTMHLP  64

Query  309  SSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLR  488
            S+T+ANIV+DF+GTSFLLCLLGGFLADSFLGR+ TIAIF+++Q LG   LA++ KLPQLR
Sbjct  65   SATAANIVTDFVGTSFLLCLLGGFLADSFLGRYNTIAIFASIQTLGMVGLAISVKLPQLR  124

Query  489  PSPCNPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            P  C+   A   C+EANGFQMGILYLALY+IALG GGLKSSVSGFGTD FD
Sbjct  125  PPHCDTTAATNHCKEANGFQMGILYLALYIIALGIGGLKSSVSGFGTDQFD  175



>ref|XP_008352261.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Malus domestica]
Length=581

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 148/171 (87%), Gaps = 3/171 (2%)
 Frame = +3

Query  129  KMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLP  308
            KM WTVA  +DYKG PA+KS+TGGWV AALILGIEI ERLSTMGIAVNLVTYL GTMHLP
Sbjct  5    KMGWTVAGVMDYKGLPANKSRTGGWVAAALILGIEICERLSTMGIAVNLVTYLVGTMHLP  64

Query  309  SSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLR  488
            S+T+ANIV+DF+GTSFLLCLLGGFLADSFLGR+ TIAIF+++Q LG   LA++ KLPQLR
Sbjct  65   SATAANIVTDFVGTSFLLCLLGGFLADSFLGRYNTIAIFASIQTLGMVGLAISVKLPQLR  124

Query  489  PSPCNPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            P  C+   A   C+EANGFQMGILYLALY+IALG GGLKSSVSGFGTD FD
Sbjct  125  PPHCDTTAATNHCKEANGFQMGILYLALYIIALGIGGLKSSVSGFGTDQFD  175



>ref|XP_010049997.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Eucalyptus grandis]
Length=580

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 143/171 (84%), Positives = 158/171 (92%), Gaps = 0/171 (0%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME KMSW ++DAVDYKGFPAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYLGGTM
Sbjct  1    MEEKMSWAISDAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGR++TIAIF+ +Q LGT TLAL+ KLP
Sbjct  61   HLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFTLIQTLGTATLALSAKLP  120

Query  480  QLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +LRP PC P + C++A+G QMGILYLALYL+ALGTGGLKSSVSGFGTD FD
Sbjct  121  RLRPPPCLPDRPCEQADGLQMGILYLALYLVALGTGGLKSSVSGFGTDQFD  171



>ref|XP_006361731.1| PREDICTED: nitrate transporter 1.4-like [Solanum tuberosum]
Length=599

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 145/176 (82%), Gaps = 6/176 (3%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            M  K S +V D+VDYKG  A +SKTGGW+  ALI+GIE+ ERLSTMGIAVNLVTYL GTM
Sbjct  1    MRTKNSSSV-DSVDYKGLLAIRSKTGGWLSNALIVGIEVSERLSTMGIAVNLVTYLIGTM  59

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+TSA IVSDFMGTSFLLCLLGG +ADSFLGR++TIAIF+ +Q LGTG L+++T+LP
Sbjct  60   HLPSATSAKIVSDFMGTSFLLCLLGGVIADSFLGRYRTIAIFAIIQTLGTGMLSISTRLP  119

Query  480  QLRPSPCNPHQA-----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QL+P+PCN H +     C++A   QM +LY++LYL+ALG GGLKSSVSGF TD FD
Sbjct  120  QLQPTPCNVHYSLKSTNCEQATTSQMSVLYISLYLMALGIGGLKSSVSGFCTDQFD  175



>ref|XP_010093703.1| Nitrate transporter 1.1 [Morus notabilis]
 gb|EXB54483.1| Nitrate transporter 1.1 [Morus notabilis]
Length=272

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 140/179 (78%), Gaps = 5/179 (3%)
 Frame = +3

Query  96   TVELPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNL  275
            T  LP K+ E     T+ DA DYKG PA++SKTGGW  AA+ILG E++ERL+T+GIAVNL
Sbjct  4    TNSLPKKQGE-----TIPDAWDYKGRPAERSKTGGWASAAMILGGEVMERLTTLGIAVNL  58

Query  276  VTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgt  455
            VTYL GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   
Sbjct  59   VTYLVGTMHLGNATSANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQATGVTI  118

Query  456  lalatKLPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            L ++T +P LRP  C   + C +A+G ++ +LY+ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  119  LTISTIVPSLRPPKCTADKPCIQASGMELTVLYIALYLTALGTGGLKSSVSGFGSDQFD  177



>ref|XP_009397479.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Musa acuminata 
subsp. malaccensis]
Length=583

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 147/169 (87%), Gaps = 2/169 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MS  VADAVDYKGFPAD+S TGGWVPAALIL IEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  1    MSPAVADAVDYKGFPADRSVTGGWVPAALILVIEICERLSTMGIAVNLVTYLGGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            + SAN+VSDF+G SFLLCLLGGFLADSFLGR+ T+AIF+ VQ LGTG L ++T LP+LRP
Sbjct  61   AESANVVSDFLGASFLLCLLGGFLADSFLGRYLTVAIFALVQALGTGMLTVSTSLPRLRP  120

Query  492  SPCNPH--QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PCN      C+ A+GFQMGILYL+LYLIALGTGGLKSSVSGFGTD FD
Sbjct  121  PPCNTSATNRCRRASGFQMGILYLSLYLIALGTGGLKSSVSGFGTDQFD  169



>gb|KCW82843.1| hypothetical protein EUGRSUZ_C04214 [Eucalyptus grandis]
Length=576

 Score =   192 bits (487),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 140/167 (84%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW ++DAVDYKGFPAD+SKTGGWVPAALILGIEI ERLSTMGIAVNLVTYLGGTMHLPS
Sbjct  1    MSWAISDAVDYKGFPADRSKTGGWVPAALILGIEICERLSTMGIAVNLVTYLGGTMHLPS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            STSANIV+DFMGTSFLLCLLGGFLADSFLGR++TIAIF+ +Q LGT TLAL+ KLP+LRP
Sbjct  61   STSANIVTDFMGTSFLLCLLGGFLADSFLGRYRTIAIFTLIQTLGTATLALSAKLPRLRP  120

Query  492  SPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PC P + C++A+G QMGILYLALYL+ALGTGGLKSSVSGFGTD FD
Sbjct  121  PPCLPDRPCEQADGLQMGILYLALYLVALGTGGLKSSVSGFGTDQFD  167



>ref|XP_006293915.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
 gb|EOA26813.1| hypothetical protein CARUB_v10022906mg [Capsella rubella]
Length=570

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            VADAVDY G PADKSKTGGW+ A LILGIE+VERLSTMGIAVNLVTYL  TMHLPSSTSA
Sbjct  2    VADAVDYSGQPADKSKTGGWITATLILGIEVVERLSTMGIAVNLVTYLMETMHLPSSTSA  61

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            NIV+DFMGTSFLLCLLGGFLADSFLGRFKTIAIFS +Q LGTG L++ATKLP+LRP  C+
Sbjct  62   NIVTDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSTIQALGTGALSIATKLPELRPPTCH  121

Query  504  PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +AC  A  FQM ILY++LYLIALGTGGLKSS+SGFG+D FD
Sbjct  122  HGEACVPATSFQMTILYISLYLIALGTGGLKSSISGFGSDQFD  164



>ref|XP_004245323.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Solanum 
lycopersicum]
Length=564

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 138/165 (84%), Gaps = 5/165 (3%)
 Frame = +3

Query  153  AVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIV  332
            AVDYKG  A +SKTGGW+  ALI+GIE+ ERLSTMGIAVNLVTYL G MH+PS+TSA IV
Sbjct  9    AVDYKGLLAIRSKTGGWLSNALIVGIEVSERLSTMGIAVNLVTYLIGRMHIPSATSAKIV  68

Query  333  SDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPHQ  512
            SDFMGTSFLLCLLGG +ADSFLGR++TIAIF+ +Q LGTG LA+++ LPQL+P+PCN H 
Sbjct  69   SDFMGTSFLLCLLGGLIADSFLGRYRTIAIFAIIQTLGTGMLAISSMLPQLQPTPCNIHY  128

Query  513  A-----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +     C++A   QM +LY++LYL+ALGTGGLKSSVSGF TD FD
Sbjct  129  SLKSSNCEQATTSQMSVLYISLYLMALGTGGLKSSVSGFCTDQFD  173



>ref|XP_007013427.1| Major facilitator superfamily protein, putative [Theobroma cacao]
 gb|EOY31046.1| Major facilitator superfamily protein, putative [Theobroma cacao]
Length=583

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 134/173 (77%), Gaps = 2/173 (1%)
 Frame = +3

Query  120  MERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTM  299
            ME   +  V+DAVDYKG  AD++ +GGWV AALILG+EI ERLSTM I VNLVTYL GTM
Sbjct  1    MEENQTQLVSDAVDYKGNSADRNTSGGWVAAALILGVEICERLSTMAIVVNLVTYLVGTM  60

Query  300  HLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLP  479
            HLPS+TS+N+ ++F GTS++LCLLGG LAD+FL R+ TIAIF+ +  +GT  LA++T LP
Sbjct  61   HLPSATSSNVSTNFGGTSYMLCLLGGILADTFLTRYWTIAIFAVINAMGTCLLAISTGLP  120

Query  480  QLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            QLRP PC P Q+  C EAN  QMG+   ALYL  LG GG+KSSVSGFGTD FD
Sbjct  121  QLRPPPCGPAQSNECVEANSLQMGVFSCALYLYGLGLGGIKSSVSGFGTDQFD  173



>gb|EMT23542.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=630

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 141/177 (80%), Gaps = 6/177 (3%)
 Frame = +3

Query  117  EMERKMSWT-----VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVT  281
            E+ER  SW+     V DAVDY+G PA++S TG W+ AA ++GIE+ ERL+TMGIAVNLVT
Sbjct  54   EIERS-SWSDDGNLVQDAVDYRGCPANRSSTGSWLGAASVVGIELCERLATMGIAVNLVT  112

Query  282  YLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtla  461
            YL  TMHLP + SAN+V+DFMGTSFLLC LGGFLAD+FLGR+ TIAIF+ VQ LGTG LA
Sbjct  113  YLTDTMHLPGAASANVVTDFMGTSFLLCFLGGFLADAFLGRYLTIAIFALVQALGTGLLA  172

Query  462  latKLPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            ++T +  LRP PC     C+EA G QMG+LY+ LYLIALGTGGLKSSVSGFGTD FD
Sbjct  173  VSTTVRHLRPPPCGGAAPCEEATGLQMGVLYVCLYLIALGTGGLKSSVSGFGTDQFD  229



>emb|CDY69100.1| BnaCnng61860D [Brassica napus]
Length=332

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWTSAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P L+P 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLQPP  127

Query  495  PCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             CNP  +  C +A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  128  RCNPTTSSHCVQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>emb|CDY30051.1| BnaC05g09690D [Brassica napus]
Length=349

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P L+P 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLQPP  127

Query  495  PCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             CNP  +  C +A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  128  RCNPTTSSHCVQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>dbj|BAJ90833.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=574

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 139/177 (79%), Gaps = 11/177 (6%)
 Frame = +3

Query  117  EMERKMSWT-----VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVT  281
            +ME + SW+     V DAVDY+G PAD+S TG W+ AA ++GIE+ ERL+TMGIAVNLVT
Sbjct  4    KMEIERSWSEDGNLVQDAVDYRGCPADRSSTGSWLGAASVVGIELCERLATMGIAVNLVT  63

Query  282  YLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtla  461
            YL  TMHLPS+ SAN+V+DFMGTSFLLC LGGFLAD+FLGR+ TIAIF+ VQ LGTG LA
Sbjct  64   YLTDTMHLPSADSANVVTDFMGTSFLLCFLGGFLADAFLGRYLTIAIFALVQALGTGLLA  123

Query  462  latKLPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            ++T + QLRP P       +EA   QM +LY+ LYLIALGTGGLKSSVSGFGTD FD
Sbjct  124  VSTTVHQLRPPP------SEEATDLQMSVLYMCLYLIALGTGGLKSSVSGFGTDQFD  174



>ref|XP_004968920.1| PREDICTED: nitrate transporter 1.4-like isoform X2 [Setaria italica]
Length=590

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 142/165 (86%), Gaps = 2/165 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V DAVDY+G  ADKS TGGWV AAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS+T+A
Sbjct  23   VQDAVDYRGCRADKSSTGGWVAAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSATAA  82

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V+DFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ +GTG LA++T++ QLRP PC 
Sbjct  83   NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAIFALVQAIGTGLLAVSTEVRQLRPPPCG  142

Query  504  PHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            P  A  C++A G QM +LY+ LYLIALGTGGLKSSVSGFGTD FD
Sbjct  143  PGAAGPCEQATGLQMSVLYVCLYLIALGTGGLKSSVSGFGTDQFD  187



>ref|XP_006841166.1| hypothetical protein AMTR_s00086p00160300 [Amborella trichopoda]
 gb|ERN02841.1| hypothetical protein AMTR_s00086p00160300 [Amborella trichopoda]
Length=578

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA +S TGGW+ AA ILG+E+VERL+T+GIAVNLVTYL  TMHL S+ +AN 
Sbjct  10   DAWDYKGRPAKRSTTGGWLSAASILGVELVERLTTLGIAVNLVTYLTNTMHLRSAYAANS  69

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+ADSFLGR++TIAIF+AVQ LG   L ++T +P LRP PCN  
Sbjct  70   VTNFLGTSFMLCLLGGFIADSFLGRYRTIAIFAAVQALGVTLLTISTVIPALRPPPCNEG  129

Query  510  QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              C  A+  Q+ +L+LALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  GRCVPASTLQLSMLFLALYLTALGTGGLKSSVSGFGSDQFD  170



>ref|XP_011093558.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Sesamum indicum]
Length=571

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 134/178 (75%), Gaps = 4/178 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            + ++  ER M   V+ AVDY G PA +S TGGWV AA IL +E+ ERLSTM IAVNLVTY
Sbjct  1    MSMEASERTM--FVSAAVDYTGAPASRSTTGGWVSAASILVVELCERLSTMAIAVNLVTY  58

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L GTMHLPSSTS+ I++++ G S+L  LLGG LADSFLGR+ TIAIF+ + MLG+  LA+
Sbjct  59   LVGTMHLPSSTSSTIITNWSGISYLFSLLGGVLADSFLGRYWTIAIFANIHMLGSCLLAI  118

Query  465  atKLPQLRPSPCNPH--QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            ++ LP LRP PCNP     C+EANG QM + Y+++Y IA+G GG+K SVSGFGTD FD
Sbjct  119  SSVLPNLRPPPCNPSLLDNCKEANGLQMAVFYISVYTIAVGLGGIKCSVSGFGTDQFD  176



>gb|KFK43476.1| hypothetical protein AALP_AA1G129900 [Arabis alpina]
Length=591

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K   T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMH
Sbjct  5    ETKSENTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMH  64

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQ  482
            L ++T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P 
Sbjct  65   LGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPG  124

Query  483  LRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LRP  CNP  +  C +A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  125  LRPPRCNPTTSSNCVQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  176



>gb|KDO61483.1| hypothetical protein CISIN_1g007736mg [Citrus sinensis]
Length=591

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            + E+ +    T+ DA DYKG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  1    MTELPQAQGKTLPDAWDYKGRPAERSKTGGWTSAAMILGGEACERLTTLGIAVNLVTYLT  60

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
            GTMHL ++++AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T
Sbjct  61   GTMHLGNASAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQAAGVTILTIST  120

Query  471  KLPQLRPSPCNPH--QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +P LRP  CN +  Q+C +A+G Q+ +LY+ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  121  IIPSLRPPKCNLNHGQSCIQASGMQLVVLYIALYLTALGTGGLKSSVSGFGSDQFD  176



>ref|XP_006440344.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
 gb|ESR53584.1| hypothetical protein CICLE_v10019412mg [Citrus clementina]
Length=591

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            + E+ +    T+ DA DYKG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  1    MTELPQAQGKTLPDAWDYKGRPAERSKTGGWTSAAMILGGEACERLTTLGIAVNLVTYLT  60

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
            GTMHL ++++AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T
Sbjct  61   GTMHLGNASAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQAAGVTILTIST  120

Query  471  KLPQLRPSPCNPH--QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +P LRP  CN +  Q+C +A+G Q+ +LY+ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  121  IIPSLRPPKCNLNHGQSCIQASGMQLVVLYIALYLTALGTGGLKSSVSGFGSDQFD  176



>ref|XP_003549905.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=594

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  AA+ILG+E  ERL+TMG+AVNLVTYL GTMHL S+ S
Sbjct  11   TIPDACDYKGHPAERSKTGGWTAAAMILGVEACERLTTMGVAVNLVTYLTGTMHLGSANS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++FMGTSF+LCL GGF+AD+F+GR+ TIAIF+ VQ  G   L ++T +P L P  C
Sbjct  71   ANTVTNFMGTSFMLCLFGGFVADTFIGRYLTIAIFATVQATGVTILTISTIIPSLHPPKC  130

Query  501  --NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +  + C  AN  Q+ +LY+ALY  +LG GGLKSSVSGFGTD FD
Sbjct  131  IRDATRRCMPANNMQLMVLYIALYTTSLGIGGLKSSVSGFGTDQFD  176



>ref|XP_010676153.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=593

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 135/165 (82%), Gaps = 1/165 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA +YKG PA++S+TGGW+ +A+ILG+E  ERL T+GIA NLVTYL G MHL ++TS
Sbjct  12   TLNDAWNYKGLPANRSETGGWISSAMILGVETCERLITLGIAFNLVTYLTGVMHLGNATS  71

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ LG   L ++T +P LRP PC
Sbjct  72   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQALGVTVLTISTIIPNLRPPPC  131

Query  501  NPHQA-CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              H + C +ANG Q+GIL+LALYL ALGTGGLKSSVSGFG+D +D
Sbjct  132  AEHSSTCVQANGTQLGILHLALYLTALGTGGLKSSVSGFGSDQYD  176



>gb|KHN09796.1| Nitrate transporter 1.1 [Glycine soja]
Length=593

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  AA+ILG+E  ERL+TMG+AVNLVTYL GTMHL S+ S
Sbjct  11   TIPDACDYKGHPAERSKTGGWTAAAMILGVEACERLTTMGVAVNLVTYLTGTMHLGSANS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++FMGTSF+LCL GGF+AD+F+GR+ TIAIF+ VQ  G   L ++T +P L P  C
Sbjct  71   ANTVTNFMGTSFMLCLFGGFVADTFIGRYLTIAIFATVQATGVTILTISTIIPSLHPPKC  130

Query  501  --NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +  + C  AN  Q+ +LY+ALY  +LG GGLKSSVSGFGTD FD
Sbjct  131  IRDATRRCMPANNMQLMVLYIALYTTSLGIGGLKSSVSGFGTDQFD  176



>emb|CDY21035.1| BnaA08g24900D [Brassica napus]
Length=575

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPP  127

Query  495  PCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             CNP  +  C +A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  128  RCNPTTSSHCVQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>ref|XP_006307075.1| hypothetical protein CARUB_v10008661mg [Capsella rubella]
 gb|EOA39973.1| hypothetical protein CARUB_v10008661mg [Capsella rubella]
Length=590

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K    + DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMH
Sbjct  5    ETKSDDVLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMH  64

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQ  482
            L ++T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+AVQ  G   L L+T +P 
Sbjct  65   LGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAVQATGVSILTLSTIIPG  124

Query  483  LRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LRP  CNP  +  C++A G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  125  LRPPRCNPTTSSHCEQATGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  176



>ref|XP_002282012.3| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Vitis vinifera]
Length=587

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            + ++  ERK    V DA DYKG PAD+++TGGWV AA ILGIE+ ER +TMGIAVNLVTY
Sbjct  1    MEMETEERKA--LVLDAYDYKGAPADRAQTGGWVSAATILGIEVSERFTTMGIAVNLVTY  58

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L  TMH PS+TS+ IV++F G SFLLCLLGG +ADSFLGR+ TIAIF+ ++ LG   LA+
Sbjct  59   LDNTMHQPSATSSTIVANFSGVSFLLCLLGGCVADSFLGRYWTIAIFAVIEALGACVLAI  118

Query  465  atKLPQLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +  L  LRP PCNP  A  C +AN  QMG+ +L L+ +ALG GG+KSSVS  GTD FD
Sbjct  119  SATLSHLRPPPCNPSVAIKCVKANNLQMGVFFLGLFAMALGIGGVKSSVSALGTDQFD  176



>emb|CDY31242.1| BnaC08g15370D [Brassica napus]
Length=575

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPP  127

Query  495  PCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             CNP  +  C +A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  128  RCNPTTSSHCVQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>emb|CDY26539.1| BnaA09g47380D [Brassica napus]
Length=574

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+
Sbjct  10   TLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +P  +  C +ANG Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  130  DPTTSSHCVQANGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>ref|XP_007155635.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
 gb|ESW27629.1| hypothetical protein PHAVU_003G218500g, partial [Phaseolus vulgaris]
Length=620

 Score =   179 bits (454),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 130/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA +SKTGGWV AA+ILG+E  ERL+TMG+AVNLVTYL GTMHL S+ S
Sbjct  38   TIPDACDYKGHPAQRSKTGGWVAAAMILGVEASERLTTMGVAVNLVTYLTGTMHLGSANS  97

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++FMGTSF+LCLLGGF+AD+F+GR+ TIAIF+ VQ  G   L ++T +P L P  C
Sbjct  98   ANTVTNFMGTSFMLCLLGGFVADTFIGRYLTIAIFATVQATGVTILTISTIIPGLHPPKC  157

Query  501  --NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +  + C+ A+  Q+ +LYLALY+ +LG GGLKSSVSGFGTD FD
Sbjct  158  VRSATRRCEPASNMQLLVLYLALYITSLGIGGLKSSVSGFGTDQFD  203



>ref|XP_006477230.1| PREDICTED: nitrate transporter 1.1-like [Citrus sinensis]
Length=591

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 139/176 (79%), Gaps = 2/176 (1%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            + E+ +    T+ DA DYKG PA++SKTGGW  AA+ILG E  ERL+T+GIAVN+VTYL 
Sbjct  1    MTELPQTQGKTLPDAWDYKGRPAERSKTGGWTSAAMILGGEACERLTTLGIAVNMVTYLT  60

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
            GTMHL ++++AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T
Sbjct  61   GTMHLGNASAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQAAGVTILTIST  120

Query  471  KLPQLRPSPCNPH--QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +P LRP  CN +  Q+C +A+G Q+ +LY+ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  121  IIPSLRPPKCNLNHGQSCIQASGMQLVVLYIALYLTALGTGGLKSSVSGFGSDQFD  176



>ref|XP_009110669.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Brassica rapa]
 gb|AFK74856.1| low-affinity nitrate transporter [Brassica rapa subsp. oleifera]
Length=590

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPP  127

Query  495  PCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             CNP  +  C +A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  128  RCNPTTSSHCVQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>ref|NP_563899.1| nitrate transporter 1.1 [Arabidopsis thaliana]
 sp|Q05085.1|PTR7_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 6.3; Short=AtNPF6.3; AltName: 
Full=Nitrate transporter 1.1; Short=AtNRT1; AltName: 
Full=Nitrate/chlorate transporter; AltName: Full=Protein CHLORINA 
1 [Arabidopsis thaliana]
 pdb|4CL4|A Chain A, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana.
 pdb|4CL4|B Chain B, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana.
 pdb|4CL5|A Chain A, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana In Complex With Nitrate.
 pdb|4CL5|B Chain B, Crystal Structure Of The Nitrate Transporter Nrt1.1 
From Arabidopsis Thaliana In Complex With Nitrate.
 gb|AAA32770.1| CHL1 [Arabidopsis thaliana]
 gb|AAC17604.1| Identical to nitrate/chlorate transporter cDNA gb|L10357 from 
A. thaliana. ESTs gb|H37533 and gb|R29790, gb|T46117, gb|T46068, 
gb|T75688, gb|R29817, gb|R29862, gb|Z34634 and gb|Z34258 
come from this gene [Arabidopsis thaliana]
 gb|AAN72027.1| putative NPK1-related protein kinase 2 [Arabidopsis thaliana]
 gb|AAP68222.1| At1g12110 [Arabidopsis thaliana]
 dbj|BAH20163.1| AT1G12110 [Arabidopsis thaliana]
 gb|AEE28838.1| nitrate transporter 1.1 [Arabidopsis thaliana]
Length=590

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K    + DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMH
Sbjct  5    ETKSDDILLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMH  64

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQ  482
            L ++T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P 
Sbjct  65   LGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPG  124

Query  483  LRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LRP  CNP  +  C++A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  125  LRPPRCNPTTSSHCEQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  176



>pdb|4OH3|A Chain A, Crystal Structure Of A Nitrate Transporter
 pdb|4OH3|B Chain B, Crystal Structure Of A Nitrate Transporter
Length=599

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K    + DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMH
Sbjct  5    ETKSDDILLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMH  64

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQ  482
            L ++T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P 
Sbjct  65   LGNATAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPG  124

Query  483  LRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LRP  CNP  +  C++A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  125  LRPPRCNPTTSSHCEQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  176



>ref|XP_011033950.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Populus euphratica]
Length=583

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  AA++LG E +ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  10   TLPDAWDYKGRPAERSKTGGWTSAAMVLGGEAMERLTTLGIAVNLVTYLTGTMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQATGVTILTISTVVPSLRPPKC  129

Query  501  NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                 C  ANG Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  VDSTGCIPANGEQLTVLYLALYLTALGTGGLKSSVSGFGSDQFD  173



>gb|AAA80582.1| RCH2 protein [Brassica napus]
Length=589

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+
Sbjct  10   TLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +P  +  C +ANG Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  130  DPTTSSHCVQANGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>ref|XP_010493752.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Camelina sativa]
Length=589

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+AN 
Sbjct  13   DAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANT  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  CNP 
Sbjct  73   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPT  132

Query  510  QA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +  C++A G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  133  TSSHCEQATGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>ref|XP_010458634.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Camelina sativa]
Length=589

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+AN 
Sbjct  13   DAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANT  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  CNP 
Sbjct  73   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPT  132

Query  510  QA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +  C++A G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  133  TSSHCEQATGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>emb|CBI28188.3| unnamed protein product [Vitis vinifera]
Length=585

 Score =   178 bits (452),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 107/172 (62%), Positives = 129/172 (75%), Gaps = 4/172 (2%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            ERK    V DA DYKG PAD+++TGGWV AA ILGIE+ ER +TMGIAVNLVTYL  TMH
Sbjct  5    ERKA--LVLDAYDYKGAPADRAQTGGWVSAATILGIEVSERFTTMGIAVNLVTYLDNTMH  62

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQ  482
             PS+TS+ IV++F G SFLLCLLGG +ADSFLGR+ TIAIF+ ++ LG   LA++  L  
Sbjct  63   QPSATSSTIVANFSGVSFLLCLLGGCVADSFLGRYWTIAIFAVIEALGACVLAISATLSH  122

Query  483  LRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LRP PCNP  A  C +AN  QMG+ +L L+ +ALG GG+KSSVS  GTD FD
Sbjct  123  LRPPPCNPSVAIKCVKANNLQMGVFFLGLFAMALGIGGVKSSVSALGTDQFD  174



>ref|XP_002889915.1| NRT1.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66174.1| NRT1.1 [Arabidopsis lyrata subsp. lyrata]
Length=589

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 134/163 (82%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+AN 
Sbjct  13   DAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANT  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  CNP 
Sbjct  73   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPT  132

Query  510  QA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +  C++A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  133  TSSHCEQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>gb|KHG28852.1| Uncharacterized protein F383_16009 [Gossypium arboreum]
Length=526

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 130/167 (78%), Gaps = 3/167 (2%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            TV DA DYKG P D+SK+GGW  AA+ILG+E  ERL+T+GIAVNLVTYL  TMHL ++TS
Sbjct  10   TVPDAWDYKGHPVDRSKSGGWTSAAMILGVEACERLTTLGIAVNLVTYLTETMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            ANIV++F GTSF+LCLLGGF+AD+FLGR+ TI IF+AVQ  G   L ++T +P LRP  C
Sbjct  70   ANIVTNFFGTSFMLCLLGGFIADTFLGRYFTIGIFTAVQATGVTILTVSTIIPTLRPPKC  129

Query  501  NPHQ---ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            N       C  A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  NREDITTICTPASGIQLSVLYLALYLTALGTGGLKSSVSGFGSDQFD  176



>ref|XP_010476167.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Camelina sativa]
Length=589

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 133/163 (82%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+AN 
Sbjct  13   DAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATAANT  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  CNP 
Sbjct  73   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRCNPT  132

Query  510  QA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +  C++A G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  133  TSSHCEQATGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>ref|XP_007157339.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
 gb|ESW29333.1| hypothetical protein PHAVU_002G061900g [Phaseolus vulgaris]
Length=586

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  +A+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  11   TIPDATDYKGHPAERSKTGGWTASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAAS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN+V++F+GTSF+LCLLGGFLAD+FLGR++TIA+F+AVQ  G   LA++T +P L P  C
Sbjct  71   ANVVTNFLGTSFMLCLLGGFLADTFLGRYRTIAVFAAVQATGVAILAISTIVPSLHPPKC  130

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C  AN  Q+ +LYLALY+ ALGTGGLKSSVSGFG+D FD
Sbjct  131  REDTVPPCVRANEKQLMVLYLALYITALGTGGLKSSVSGFGSDQFD  176



>ref|XP_010053448.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Eucalyptus grandis]
 gb|KCW77743.1| hypothetical protein EUGRSUZ_D02037 [Eucalyptus grandis]
Length=593

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            + L E E K   T+ DA DY+G PAD+S+TGGW  AA+ILG E  ERL+T+G+AVNLVTY
Sbjct  1    MSLPETEGK---TIPDAWDYQGRPADRSRTGGWTSAAMILGGEACERLTTLGVAVNLVTY  57

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L GTMHL S+TSANIV++FMGTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q  G   LA+
Sbjct  58   LTGTMHLGSATSANIVTNFMGTSFMLCLLGGFVADTFLGRYLTIAIFATIQATGVTILAI  117

Query  465  atKLPQLRPSPCNP--HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T +P LRP  C     Q C  A   QM +LYLALY +ALGTGGLKSSVSGFG+D FD
Sbjct  118  STIIPSLRPPTCTASNDQLCTPATDTQMTVLYLALYTLALGTGGLKSSVSGFGSDQFD  175



>ref|XP_002529778.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF32592.1| oligopeptide transporter, putative [Ricinus communis]
Length=584

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  +A+ILG+E +ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  12   TLPDAWDYKGRPAERSKTGGWTSSAMILGVEAIERLTTLGIAVNLVTYLTGTMHLANATS  71

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+L LLGGF+AD+FLGR+ TIAIF+ VQ +G   L ++T +P LRP  C
Sbjct  72   ANTVTNFLGTSFMLTLLGGFVADTFLGRYLTIAIFATVQAMGITILTISTIIPSLRPPKC  131

Query  501  NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            + + AC  A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  132  HNNTACIPASGTQLNVLYLALYLTALGTGGLKSSVSGFGSDQFD  175



>emb|CAD32549.1| dicarboxylate transporter [Alnus glutinosa]
Length=583

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 135/174 (78%), Gaps = 4/174 (2%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E K S  ++D VDYKG PAD++ TGGWVPAALI+GIE+ ERLSTMGI VNLVTYL GTMH
Sbjct  3    ESKKSCFISDRVDYKGDPADRNTTGGWVPAALIVGIEVSERLSTMGIIVNLVTYLKGTMH  62

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQ  482
              S+TS+N  S+  GTSFLLCLLGG LADSFLGR+ TIAIFS +  LGT  LA++  LP+
Sbjct  63   QSSTTSSNSTSNVAGTSFLLCLLGGILADSFLGRYWTIAIFSVIHALGTCMLAISAALPE  122

Query  483  LRPSPCNPHQ----ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LRPS CN H      C+E + FQMGILY ALY +ALG GG+KSSVSGFGT+ FD
Sbjct  123  LRPSECNLHHDFPLKCEEPSSFQMGILYTALYSMALGVGGIKSSVSGFGTEQFD  176



>ref|XP_003517427.1| PREDICTED: nitrate transporter 1.1-like [Glycine max]
Length=586

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA++SKTGGW  +A+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ SA
Sbjct  12   IPDASDYKGRPAERSKTGGWTASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASA  71

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V++F+GTSF+LCLLGGFLAD+FLGR++TIAIF+AVQ  G   L ++T +P L P  CN
Sbjct  72   NVVTNFLGTSFMLCLLGGFLADTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCN  131

Query  504  PHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                  C  AN  Q+  LYLALY+ ALGTGGLKSSVSGFG+D FD
Sbjct  132  GDTVPPCVRANEKQLTALYLALYVTALGTGGLKSSVSGFGSDQFD  176



>ref|XP_010919516.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Elaeis 
guineensis]
Length=592

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D KG PA +S+TGGW  AA+ILG+E+ ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  13   TLSDAWDCKGRPAVRSQTGGWTSAAMILGVELCERLTTLGIAVNLVTYLTGTMHLGNATS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            ANIV++F+GTSF+LCLLGGFLADSFLGR+ TIAIF+AVQ LG   L ++T  P LRP  C
Sbjct  73   ANIVTNFLGTSFMLCLLGGFLADSFLGRYLTIAIFTAVQALGITILTISTVAPGLRPPAC  132

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                A  C +A G Q+G+LYLAL L ALGTGGLKSSVSGFG+D FD
Sbjct  133  ADPSAGGCVQAKGAQLGVLYLALNLTALGTGGLKSSVSGFGSDQFD  178



>emb|CDY15967.1| BnaC08g41560D [Brassica napus]
Length=574

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+
Sbjct  10   TLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +P  +  C +A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  130  DPTTSSHCVQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>ref|XP_009118113.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brassica rapa]
Length=589

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+
Sbjct  10   TLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +P  +  C +A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  130  DPTTSSHCVQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>ref|XP_010264234.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=593

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 135/176 (77%), Gaps = 3/176 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            + L E E K   T++DA DYKG  A++  TGGW  AA+ILG+E+ ERL+T+GIAVNLVTY
Sbjct  1    MSLPETEGK---TLSDAWDYKGRSAERFTTGGWTSAAMILGVELCERLTTLGIAVNLVTY  57

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ T+AIF+ VQ  G   L +
Sbjct  58   LTGTMHLGNATSANNVTNFLGTSFMLCLLGGFIADTFLGRYLTVAIFATVQATGVTILTI  117

Query  465  atKLPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T +P LRP  C   + C +A+G Q+ +LYL LYL ALGTGGLKSSVSG G+D FD
Sbjct  118  STIVPSLRPPKCTAGEVCVQASGLQLTVLYLGLYLTALGTGGLKSSVSGLGSDQFD  173



>ref|XP_006475798.1| PREDICTED: nitrate transporter 1.4-like isoform X3 [Citrus sinensis]
 gb|KDO80313.1| hypothetical protein CISIN_1g008182mg [Citrus sinensis]
Length=565

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 141/169 (83%), Gaps = 12/169 (7%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MSW VADAVDYKG PAD SKTG          IE+ ERLSTMGIAVNLVTYL GTMHLPS
Sbjct  1    MSWAVADAVDYKGSPADPSKTG----------IELCERLSTMGIAVNLVTYLVGTMHLPS  50

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            +TSANIV+DFMGTSFLLCLLGGFLAD+FLGR+KTIAIF+AVQ LGTG LA+ TKL QLRP
Sbjct  51   ATSANIVTDFMGTSFLLCLLGGFLADTFLGRYKTIAIFAAVQTLGTGMLAMVTKLRQLRP  110

Query  492  SPCN--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PC       C++A+GFQMG+LY+ALYLIALGTGGLKSSVSGFGTD FD
Sbjct  111  RPCKETATHTCEQASGFQMGVLYIALYLIALGTGGLKSSVSGFGTDQFD  159



>gb|AEA35415.1| nitrate transporter [Brassica rapa subsp. chinensis]
Length=589

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++T+
Sbjct  10   TLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPPRC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +P  +  C +A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  130  DPTTSSHCVQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>ref|XP_006417264.1| hypothetical protein EUTSA_v10007157mg [Eutrema salsugineum]
 gb|ESQ35617.1| hypothetical protein EUTSA_v10007157mg [Eutrema salsugineum]
Length=590

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 135/168 (80%), Gaps = 2/168 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+ KTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRFKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L L+T +P LRP 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVSILTLSTIIPGLRPP  127

Query  495  PCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             CNP  +  C +A+G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  128  RCNPTTSSHCVQASGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  175



>ref|XP_008448872.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Cucumis melo]
Length=593

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 128/163 (79%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PAD+SKTG W  AA+ILG E VERL+T+GIAVNLVTY+ GTMHL ++ SANI
Sbjct  15   DAWDYKGRPADRSKTGRWTAAAMILGGEAVERLTTLGIAVNLVTYMTGTMHLGNAVSANI  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVTILTISTIIPSLRPPRCTVE  134

Query  510  QA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +  C  A  FQ+ ILY+ALY  ALGTGGLKSSVSGFG+D FD
Sbjct  135  SSSHCAPATDFQLTILYIALYTTALGTGGLKSSVSGFGSDQFD  177



>ref|NP_001275529.1| nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004163647.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|ADQ74763.1| nitrate transporter 1.1 [Cucumis sativus]
 gb|KGN55889.1| hypothetical protein Csa_3G027720 [Cucumis sativus]
Length=593

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 128/163 (79%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PAD+SKTG W  AA+ILG E VERL+T+GIAVNLVTY+ GTMHL ++ SANI
Sbjct  15   DAWDYKGRPADRSKTGRWTAAAMILGGEAVERLTTLGIAVNLVTYMTGTMHLGNAVSANI  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+A+Q  G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFAAIQATGVTILTISTIIPSLRPPRCTVE  134

Query  510  QA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +  C  A  FQ+ ILY+ALY  ALGTGGLKSSVSGFG+D FD
Sbjct  135  SSSHCAPATDFQLTILYIALYTTALGTGGLKSSVSGFGSDQFD  177



>ref|XP_010933692.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=600

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 135/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D+KG PA +S+TGGW  AA+ILG+E+ ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  13   TLSDAWDFKGRPAVRSQTGGWTSAAMILGVELCERLTTLGIAVNLVTYLTGTMHLGNATS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+G+SF+LCLLGGFLADSFLGR+ TIAIF+AVQ  GT  L ++T  P LRP  C
Sbjct  73   ANTVTNFLGSSFMLCLLGGFLADSFLGRYLTIAIFTAVQASGTTILTISTAAPGLRPPAC  132

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                A  C  A+G Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  133  ADPSAGGCVRASGAQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  178



>gb|EYU29794.1| hypothetical protein MIMGU_mgv1a003534mg [Erythranthe guttata]
Length=579

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 127/165 (77%), Gaps = 2/165 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V+DA DYKG PA KS TGGW+ AA IL +E+ ERLSTM IAVNLVTYL GT+HLPS+ S+
Sbjct  11   VSDATDYKGAPAHKSTTGGWLSAASILSVELCERLSTMAIAVNLVTYLQGTLHLPSAESS  70

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
             +VS++ G SFLL L GG LADSFLGR+ TIAIFS V  LG+  LAL+T  P+LRP PCN
Sbjct  71   AVVSNWGGISFLLSLFGGILADSFLGRYWTIAIFSTVHFLGSCLLALSTVFPKLRPPPCN  130

Query  504  PHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            P  +  C +ANG QM + Y+++Y +ALG GG+K SVSGFGTD FD
Sbjct  131  PSLSNNCIQANGLQMAVFYISIYTVALGLGGIKCSVSGFGTDQFD  175



>ref|XP_002303512.2| nitrate transporter family protein [Populus trichocarpa]
 gb|EEE78491.2| nitrate transporter family protein [Populus trichocarpa]
Length=583

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D KG PA++SKTGGW  AA+ILG E +ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  10   TLPDAWDCKGRPAERSKTGGWTSAAMILGGEAMERLTTLGIAVNLVTYLTGTMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQATGVTILTISTVVPSLRPPKC  129

Query  501  NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +  C  ANG Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  VDNTDCIPANGEQLTVLYLALYLTALGTGGLKSSVSGFGSDQFD  173



>ref|XP_010919515.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Elaeis 
guineensis]
Length=509

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D KG PA +S+TGGW  AA+ILG+E+ ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  13   TLSDAWDCKGRPAVRSQTGGWTSAAMILGVELCERLTTLGIAVNLVTYLTGTMHLGNATS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            ANIV++F+GTSF+LCLLGGFLADSFLGR+ TIAIF+AVQ LG   L ++T  P LRP  C
Sbjct  73   ANIVTNFLGTSFMLCLLGGFLADSFLGRYLTIAIFTAVQALGITILTISTVAPGLRPPAC  132

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                A  C +A G Q+G+LYLAL L ALGTGGLKSSVSGFG+D FD
Sbjct  133  ADPSAGGCVQAKGAQLGVLYLALNLTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_004511669.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Cicer arietinum]
 ref|XP_004511670.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Cicer arietinum]
Length=593

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            TV DA D+KG PAD+S TGGW  AA+ILG EI+ERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  11   TVHDASDFKGRPADRSTTGGWSAAAMILGGEIMERLTTLGIAVNLVTYLTGTMHLGNAAS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN+V++F+GTSF+LCLLGGFLAD+FLGR+ TIAIF+A+Q +G   L ++T +P L P  C
Sbjct  71   ANVVTNFLGTSFMLCLLGGFLADTFLGRYLTIAIFAAIQAMGVTILTISTIIPSLHPPKC  130

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C EA+  Q+ +L LALY+ ALGTGGLKSSVSGFG+D FD
Sbjct  131  TKDSTTPCVEASNKQLLVLNLALYVTALGTGGLKSSVSGFGSDQFD  176



>ref|XP_008675518.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like [Zea mays]
 tpg|DAA59044.1| TPA: hypothetical protein ZEAMMB73_584071 [Zea mays]
Length=591

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 148/183 (81%), Gaps = 10/183 (5%)
 Frame = +3

Query  114  KEMERKMSW--------TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAV  269
            K+++ + +W         V DAVDY+G  ADKS TGGWV AAL LGIE+ ERL+TMGIAV
Sbjct  4    KKVQERAAWGASDGGGNLVQDAVDYRGCRADKSSTGGWVAAALALGIELCERLATMGIAV  63

Query  270  NLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgt  449
            NLVTYL  TMHLPS+ +AN+V+DFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ +Q +GT
Sbjct  64   NLVTYLTDTMHLPSAAAANVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAIFALIQAIGT  123

Query  450  gtlalatKLPQLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTD  623
            G LA++T++ QLRP PC P  A  C++A GFQMG+LY+ LYLIALGTGGLKSSVSGFGTD
Sbjct  124  GLLAVSTEVRQLRPPPCGPGAAGPCEQATGFQMGVLYVCLYLIALGTGGLKSSVSGFGTD  183

Query  624  PFD  632
             FD
Sbjct  184  QFD  186



>ref|XP_009382411.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ADA D+KG PA KS TGGW  AA+ILG+E+ ER++T+GIAVNLVTYL GTMHL ++ S
Sbjct  13   TLADAWDFKGRPAVKSTTGGWTSAAMILGVELCERMTTLGIAVNLVTYLTGTMHLGNAAS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN+V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF+A+Q  G   L ++T  P LRP  C
Sbjct  73   ANVVTNFLGTSFMLCLLGGFVADTYLGRYLTIAIFTAIQASGVTILTISTAAPGLRPPEC  132

Query  501  -NP-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             NP    C  ANG Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  133  SNPLGGGCVTANGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_010670639.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=599

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 141/171 (82%), Gaps = 2/171 (1%)
 Frame = +3

Query  126  RKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHL  305
            RKM+   ADA DYKG  ADKSKTGGW+PAA ILGIE  ERLSTMGIAVNLVTYL G MHL
Sbjct  23   RKMNLIHADAFDYKGLLADKSKTGGWLPAAFILGIEFCERLSTMGIAVNLVTYLSGKMHL  82

Query  306  PSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQL  485
             SS SANIV+DFMGTSFLLCLLGGFLADSFLGRF+TIAI + +Q +GTG LAL+T+LP L
Sbjct  83   SSSASANIVTDFMGTSFLLCLLGGFLADSFLGRFRTIAISAIIQTIGTGLLALSTRLPSL  142

Query  486  RPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             P PC+   A  C+ A+ FQMGILYL+LYLIALGTGGLKSSVS FG D FD
Sbjct  143  HPPPCDTTNADKCEPASSFQMGILYLSLYLIALGTGGLKSSVSSFGADQFD  193



>gb|ACJ85583.1| unknown [Medicago truncatula]
Length=360

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            TV DA DYKG PAD+S TGGW  AA+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  11   TVPDASDYKGRPADRSTTGGWSAAAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAAS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN+V++F+GTSF+LCLLGGFLAD+FLGR+ TIAIF+AVQ +G   L ++T +P L P  C
Sbjct  71   ANVVTNFLGTSFMLCLLGGFLADTFLGRYLTIAIFAAVQAIGVTILTISTIIPSLHPPKC  130

Query  501  NP-HQACQEANGFQMgilylalylialgtgglKSSVSGFG  617
                ++C +A+  Q+ ++YLALY+ ALGTGGLKSSVSGFG
Sbjct  131  KEDSKSCIQADSKQLLVMYLALYITALGTGGLKSSVSGFG  170



>ref|XP_008796822.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=600

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + E K   T++DA D+KG PA +S+TG W  AA+ILG+E+ ERL+T+GIAVNLVTY
Sbjct  4    LPETDAEGK---TLSDAWDFKGRPAVRSQTGRWTSAAMILGVELCERLTTLGIAVNLVTY  60

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L GTMHL ++ SAN V++F+GTSF+LCLLGGFLADSFLGR+ TIAIF+AVQ  GT  L +
Sbjct  61   LTGTMHLGNAASANTVTNFLGTSFMLCLLGGFLADSFLGRYLTIAIFTAVQATGTTILTV  120

Query  465  atKLPQLRPSPCN--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T  P LRP  C   P   C  A+G Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  121  STAAPGLRPPACADPPAGGCARASGAQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_004516839.1| PREDICTED: nitrate transporter 1.1-like [Cicer arietinum]
Length=592

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D KG PA++SKTGGW  +A+ILG+E  ERL+TMGIAVNLVTYL GTMHL +++S
Sbjct  11   TIQDAWDCKGSPAERSKTGGWTSSAMILGVEACERLTTMGIAVNLVTYLTGTMHLGNASS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            ANIV++FMGT F+LCLLGGF+AD+F+GR+ TIAIF+ V+ +G   L ++T +P L P  C
Sbjct  71   ANIVTNFMGTCFMLCLLGGFVADTFIGRYLTIAIFATVEAIGVTMLTISTIIPSLHPPKC  130

Query  501  --NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              N  + C+ AN  Q+ +LY+ALY+ ALG GGLKSSVSGFG+D FD
Sbjct  131  TQNSVKHCEAANNIQLTVLYIALYVTALGIGGLKSSVSGFGSDQFD  176



>ref|XP_003608752.1| Nitrate transporter [Medicago truncatula]
 gb|AES90949.1| peptide/nitrate transporter [Medicago truncatula]
Length=593

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D KG PA++SKTGGW  +A+ILG+E  ERL+TMGIAVNLVTYL GTMHL +++S
Sbjct  11   TIQDAWDCKGHPAERSKTGGWTSSAMILGVEACERLTTMGIAVNLVTYLTGTMHLGNASS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            ANIV++FMGT F+LCLLGGF+AD+F+GR+ TIAIF+ V+ +G   L ++T +P L P  C
Sbjct  71   ANIVTNFMGTCFMLCLLGGFVADTFIGRYLTIAIFATVEAIGVTILTISTIIPSLHPPKC  130

Query  501  NPH--QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                 ++C+ AN  Q+ +LY+ALY+ ALG GGLKSSVSGFG+D FD
Sbjct  131  TKSNLKSCEPANNIQLTVLYIALYVTALGIGGLKSSVSGFGSDQFD  176



>emb|CBI31901.3| unnamed protein product [Vitis vinifera]
Length=593

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++S+TGGW+ AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL +++S
Sbjct  10   TILDAWDYKGRPAERSRTGGWMSAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNASS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATVQATGVTILTISTTIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C  A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  AMETGPLCTPASGMQLVVLYLALYLTALGTGGLKSSVSGFGSDQFD  175



>ref|XP_002266951.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Vitis vinifera]
Length=591

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++S+TGGW+ AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL +++S
Sbjct  10   TILDAWDYKGRPAERSRTGGWMSAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNASS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATVQATGVTILTISTTIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C  A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  AMETGPLCTPASGMQLVVLYLALYLTALGTGGLKSSVSGFGSDQFD  175



>emb|CAN71417.1| hypothetical protein VITISV_004658 [Vitis vinifera]
Length=591

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++S+TGGW+ AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL +++S
Sbjct  10   TILDAWDYKGRPAERSRTGGWMSAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNASS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATVQATGVTILTISTTIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C  A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  AMETGPLCTPASGMQLVVLYLALYLTALGTGGLKSSVSGFGSDQFD  175



>ref|XP_010258991.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nelumbo nucifera]
Length=592

 Score =   174 bits (441),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 130/164 (79%), Gaps = 0/164 (0%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA +Y G PA++S TGGW  AA+ILG+E+ ERL+T+GIAVNLVTYL GTMH  +++S
Sbjct  10   TISDARNYNGRPAERSTTGGWTSAAMILGVELCERLTTLGIAVNLVTYLTGTMHFGNASS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFILCLLGGFVADTFLGRYLTIAIFATVQATGVTLLTISTVVPSLRPPKC  129

Query  501  NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               + C  AN  Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  TAGEPCTPANRLQLAVLYLALYLTALGTGGLKSSVSGFGSDQFD  173



>ref|NP_001169613.1| uncharacterized protein LOC100383494 [Zea mays]
 gb|ACN34269.1| unknown [Zea mays]
 gb|AFW80907.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=591

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 147/183 (80%), Gaps = 10/183 (5%)
 Frame = +3

Query  114  KEMERKMSWTVAD--------AVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAV  269
            K+++ + +W V+D        AVDY+G  ADKS TGGW  AAL +GIE+ ERLSTMGIAV
Sbjct  4    KKVQERAAWCVSDGGGNLVQDAVDYRGCRADKSSTGGWASAALAVGIELCERLSTMGIAV  63

Query  270  NLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgt  449
            NLVTYL  TMHLPS+ +AN+V+DFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ +GT
Sbjct  64   NLVTYLTATMHLPSAAAANVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAIFAVVQAIGT  123

Query  450  gtlalatKLPQLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTD  623
            G LA++T++ QLRP PC P  A  C++A G QMG+LY+ LYLIALGTGGLKSSVSGFGTD
Sbjct  124  GLLAVSTEVRQLRPPPCGPGAAGPCEQATGLQMGVLYVCLYLIALGTGGLKSSVSGFGTD  183

Query  624  PFD  632
             FD
Sbjct  184  QFD  186



>ref|XP_009411557.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=595

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D+KG PA KS+TGGW  AA ILG+E+ ERL+T+GIAVNLVTYL GTMHL S+ S
Sbjct  13   TLPDAWDFKGRPAVKSRTGGWSCAATILGVELCERLTTLGIAVNLVTYLTGTMHLGSAAS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            ANIV++F+GTSF+LCLLGGF+AD++LGR+ TIAIF+AVQ  G   L ++T  P LRP  C
Sbjct  73   ANIVTNFLGTSFMLCLLGGFIADTYLGRYLTIAIFTAVQASGVTILTISTAAPGLRPPAC  132

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +   +  C  A+G Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  133  DGSYSGGCARASGLQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_010553465.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=589

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA D++G PA +SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++TS
Sbjct  9    TLLDAWDFQGRPAIRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLKGTMHLGNATS  68

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q  G   L L+T +P LRP  C
Sbjct  69   ANTVTNFIGTSFMLCLLGGFVADTFLGRYMTIAIFATIQATGVTILTLSTIIPGLRPPKC  128

Query  501  NP--HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +P    +C +A+G Q+ +LY+ALYL ALGTGG+K+SVSGFG+D FD
Sbjct  129  DPTSSNSCVQASGMQLLVLYIALYLTALGTGGVKASVSGFGSDQFD  174



>ref|XP_003611284.1| Nitrate transporter [Medicago truncatula]
 gb|AES94242.1| peptide/nitrate transporter [Medicago truncatula]
Length=583

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 133/176 (76%), Gaps = 3/176 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    + K+   V DA D KGFPA++SKTGGW  A++ILG E++ERL+T+GI VNLVTY
Sbjct  4    LPTTTQQEKI---VPDAYDCKGFPAERSKTGGWTSASMILGGEVMERLTTLGITVNLVTY  60

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L GTMHL +++SANIV++F+GTSF+LCL GGFL D+++GR+  IA+F+AVQ  G   L +
Sbjct  61   LTGTMHLGNASSANIVTNFVGTSFMLCLFGGFLGDTYIGRYLNIAVFAAVQATGVALLMI  120

Query  465  atKLPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T +P L P  C  H  C +AN  Q+ +L+LALY+ ALGTGGLKSSV GFG+D FD
Sbjct  121  STIIPSLSPPTCKEHTTCVKANNTQLTVLFLALYVTALGTGGLKSSVPGFGSDQFD  176



>emb|CDP09929.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG  A +S TGGW  AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  12   TIPDAWDYKGGQAQRSTTGGWAAAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNATS  71

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF+AVQ  G   L ++T +P LRP  C
Sbjct  72   ANTVTNFLGTSFMLCLLGGFIADTYLGRYLTIAIFAAVQATGVALLTISTTIPSLRPPKC  131

Query  501  -NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                ++C +A+G Q+ +LY ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  132  AQGSRSCVQASGNQLLVLYAALYLTALGTGGLKSSVSGFGSDQFD  176



>gb|KJB20886.1| hypothetical protein B456_003G170400 [Gossypium raimondii]
Length=585

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG P+++SK+GGW  AA+ILG+E  ERL+T+GIAVNLVTYL  TMHL ++TS
Sbjct  10   TLPDAWDYKGHPSERSKSGGWTSAAMILGVEACERLTTLGIAVNLVTYLTETMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            ANIV++F GTSF+LCLLGGF+AD+FLGR+ TI IF+AVQ  G   L ++T +P LRP  C
Sbjct  70   ANIVTNFFGTSFMLCLLGGFVADTFLGRYLTIGIFTAVQATGVTILTVSTIIPSLRPPKC  129

Query  501  --NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +    C  A+G Q+ +LYLALYLIALGTGGLKSSVSGFG+D FD
Sbjct  130  TRDSTTVCIPASGIQLTVLYLALYLIALGTGGLKSSVSGFGSDQFD  175



>ref|XP_007039888.1| Nitrate transporter 1.1 isoform 1 [Theobroma cacao]
 gb|EOY24389.1| Nitrate transporter 1.1 isoform 1 [Theobroma cacao]
Length=583

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 132/167 (79%), Gaps = 4/167 (2%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SK+GGW  AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  10   TLPDAWDYKGSPAERSKSGGWTSAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            A  V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTILTISTVIPSLRPPKC  129

Query  501  ---NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               NP   C +A+G Q+ ILYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  SMDNP-TTCTQASGIQLIILYLALYLTALGTGGLKSSVSGFGSDQFD  175



>ref|XP_009411558.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D+KG PA KS+TGGW  A++ILG+E+ ERL+T+GIAVNLVTYL  TMHL S+ S
Sbjct  13   TLSDAWDFKGRPAVKSQTGGWTCASMILGVELCERLTTLGIAVNLVTYLTATMHLGSAAS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+AVQ  G   L ++T  P LRP  C
Sbjct  73   ANAVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPPAC  132

Query  501  -NPHQ-ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +P    C  ANG QMG+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  133  ADPLTGGCVRANGTQMGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_008238567.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 [Prunus mume]
Length=599

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 137/176 (78%), Gaps = 4/176 (2%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E + K+  T+ DA D+KG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  6    LPETQEKL--TLPDAWDFKGRPAERSKTGGWAAAAMILGGEACERLTTLGIAVNLVTYLT  63

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
            GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+++Q +G   L ++T
Sbjct  64   GTMHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFASIQAMGVTILTIST  123

Query  471  KLPQLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +P LRP  C       C  A+G Q+ +LY+ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  124  TVPSLRPPKCTADTGTPCIPASGKQLMVLYIALYLTALGTGGLKSSVSGFGSDQFD  179



>ref|XP_010676154.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Beta vulgaris subsp. 
vulgaris]
Length=599

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            +V DA DYKG PAD+SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL G MHL ++ S
Sbjct  20   SVFDAWDYKGRPADRSKTGGWKSAAMILGGEACERLTTLGIAVNLVTYLTGVMHLGNAAS  79

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++FMGTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ LG   L ++T +P LRP  C
Sbjct  80   ANTVTNFMGTSFMLCLLGGFIADTFLGRYLTIAIFATVQALGVTVLTISTIIPSLRPPAC  139

Query  501  NPH-QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             P   +C  A+  Q+G+LYLALYL ALGTGG+K+SVSGFGTD FD
Sbjct  140  KPEFGSCTPASDTQLGVLYLALYLTALGTGGVKASVSGFGTDQFD  184



>gb|AFW80908.1| hypothetical protein ZEAMMB73_061861 [Zea mays]
Length=587

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 2/165 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V DAVDY+G  ADKS TGGW  AAL +GIE+ ERLSTMGIAVNLVTYL  TMHLPS+ +A
Sbjct  18   VQDAVDYRGCRADKSSTGGWASAALAVGIELCERLSTMGIAVNLVTYLTATMHLPSAAAA  77

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V+DFMGTSFLLCLLGGFLADSFLGR+ TIAIF+ VQ +GTG LA++T++ QLRP PC 
Sbjct  78   NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAIFAVVQAIGTGLLAVSTEVRQLRPPPCG  137

Query  504  PHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            P  A  C++A G QMG+LY+ LYLIALGTGGLKSSVSGFGTD FD
Sbjct  138  PGAAGPCEQATGLQMGVLYVCLYLIALGTGGLKSSVSGFGTDQFD  182



>ref|XP_004298652.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=591

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 134/176 (76%), Gaps = 5/176 (3%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L+E E K   T+ DA DY+G PAD+S TGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  4    LQETEGK---TLPDAWDYQGQPADRSTTGGWTSAAMILGGEACERLTTLGIAVNLVTYLT  60

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
            GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T
Sbjct  61   GTMHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATVQATGVTILTIST  120

Query  471  KLPQLRPSPCNP--HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +P LRP  C       C  A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  121  VIPSLRPPKCTAGSDSPCIPASGKQLMVLYLALYLTALGTGGLKSSVSGFGSDQFD  176



>dbj|BAC81420.1| nitrate transporter [Prunus persica]
Length=596

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 4/176 (2%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E + K+  T+ DA D+KG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  6    LPETQEKL--TLPDAWDFKGRPAERSKTGGWTAAAMILGGEACERLTTLGIAVNLVTYLT  63

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
            GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+  Q +G   L ++T
Sbjct  64   GTMHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATFQAMGVTILTIST  123

Query  471  KLPQLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +P LRP  C    +  C  A+G Q+ +LY+ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  124  TIPSLRPPKCTSDTSTPCIPASGKQLMVLYIALYLTALGTGGLKSSVSGFGSDQFD  179



>dbj|BAD22820.1| nitrate transporter [Prunus persica]
Length=594

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 4/176 (2%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E + K+  T+ DA D+KG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  6    LPETQEKL--TLPDAWDFKGRPAERSKTGGWTAAAMILGGEACERLTTLGIAVNLVTYLT  63

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
            GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+  Q +G   L ++T
Sbjct  64   GTMHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATFQAMGVTILTIST  123

Query  471  KLPQLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +P LRP  C    +  C  A+G Q+ +LY+ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  124  TIPSLRPPKCTSDTSTPCIPASGKQLMVLYIALYLTALGTGGLKSSVSGFGSDQFD  179



>ref|XP_007210870.1| hypothetical protein PRUPE_ppa003177mg [Prunus persica]
 gb|EMJ12069.1| hypothetical protein PRUPE_ppa003177mg [Prunus persica]
Length=596

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 135/176 (77%), Gaps = 4/176 (2%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E + K+  T+ DA D+KG PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLVTYL 
Sbjct  6    LPETQEKL--TLPDAWDFKGRPAERSKTGGWTAAAMILGGEACERLTTLGIAVNLVTYLT  63

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
            GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+  Q +G   L ++T
Sbjct  64   GTMHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATFQAMGVTILTIST  123

Query  471  KLPQLRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +P LRP  C       C  A+G Q+ +LY+ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  124  TIPSLRPRKCTSDTGTPCIPASGKQLMVLYIALYLTALGTGGLKSSVSGFGSDQFD  179



>ref|XP_011081220.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 131/165 (79%), Gaps = 1/165 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA KS +GGW  AA+ILG+E+ ERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  14   TLPDAWDYKGRPAVKSSSGGWTSAAMILGVEVCERLTTLGIAVNLVTYLTGTMHLGNAGS  73

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD++LGR+ TI IF+ VQ +G   L ++T +P LRP  C
Sbjct  74   ANTVTNFLGTSFMLCLLGGFIADTYLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKC  133

Query  501  NP-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +P  ++C  A+  Q+ +LY ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  134  SPGSKSCIPASNKQLMVLYAALYLTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_009333599.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=596

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  A +ILG E  ERL+T+GIAVNLVTYL GTMHL S+TS
Sbjct  15   TLPDAWDYKGHPAERSKTGGWTAATMILGGEACERLTTLGIAVNLVTYLTGTMHLGSATS  74

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q +G   L ++T +P L+P  C
Sbjct  75   ANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATIQAMGVTILTISTTVPSLQPPKC  134

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C  A+G Q+ +LY ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  135  TAGTGSQCLPASGKQLTVLYTALYLTALGTGGLKSSVSGFGSDQFD  180



>gb|KJB20885.1| hypothetical protein B456_003G170300 [Gossypium raimondii]
Length=586

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (77%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++S TGGW  AA+ILG+E  ERL+T+GIAVNLVTYL  TMHL ++TS
Sbjct  10   TLPDAWDYKGHPAERSTTGGWTSAAMILGVEACERLTTLGIAVNLVTYLTETMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            A  V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTVLTISTIIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                A  C  A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  TRDNATICTPASGIQLTVLYLALYLTALGTGGLKSSVSGFGSDQFD  175



>ref|XP_010670640.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=575

 Score =   170 bits (431),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            M+   ADA DYKG  ADKSKTGGW+PAA ILGIE  ERLSTMGIAVNLVTYL G MHL S
Sbjct  1    MNLIHADAFDYKGLLADKSKTGGWLPAAFILGIEFCERLSTMGIAVNLVTYLSGKMHLSS  60

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            S SANIV+DFMGTSFLLCLLGGFLADSFLGRF+TIAI + +Q +GTG LAL+T+LP L P
Sbjct  61   SASANIVTDFMGTSFLLCLLGGFLADSFLGRFRTIAISAIIQTIGTGLLALSTRLPSLHP  120

Query  492  SPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PC+   A  C+ A+ FQMGILYL+LYLIALGTGGLKSSVS FG D FD
Sbjct  121  PPCDTTNADKCEPASSFQMGILYLSLYLIALGTGGLKSSVSSFGADQFD  169



>gb|KHG24776.1| Uncharacterized protein F383_04224 [Gossypium arboreum]
Length=585

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (77%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++S TGGW  AA+ILG+E  ERL+T+GIAVNLVTYL  TMHL ++TS
Sbjct  10   TLPDAWDYKGHPAERSTTGGWTSAAMILGVEACERLTTLGIAVNLVTYLTETMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            A  V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTVLTISTIIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                A  C  A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  TRDNATICTPASGIQLTVLYLALYLTALGTGGLKSSVSGFGSDQFD  175



>ref|XP_009333673.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=596

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SKTGGW  A +ILG E  ERL+T+GIAVNLVTYL GTMHL S+TS
Sbjct  15   TLPDAWDYKGRPAERSKTGGWTAATMILGGEACERLTTLGIAVNLVTYLTGTMHLGSATS  74

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q +G   L ++T +P L+P  C
Sbjct  75   ANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATIQAMGVTILTISTTVPSLQPPKC  134

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C  A+G Q+ +LY ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  135  TAGTGSQCLPASGKQLTVLYTALYLTALGTGGLKSSVSGFGSDQFD  180



>ref|XP_003538742.1| PREDICTED: nitrate transporter 1.1 [Glycine max]
Length=586

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA++SKTGGW  +A+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ SA
Sbjct  12   IPDASDYKGRPAERSKTGGWTASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASA  71

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V++F+GTSF+LCLLGGFLAD+FLGR++TIAIF+AVQ  G   L ++T +P L P  CN
Sbjct  72   NVVTNFLGTSFMLCLLGGFLADTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCN  131

Query  504  PHQA--CQEANGFQMgilylalylialgtgglKSSVSGFG  617
                  C  AN  Q+ +LYLALY+ ALGTGGLKSSVSGFG
Sbjct  132  GDTVPPCVRANEKQLTVLYLALYVTALGTGGLKSSVSGFG  171



>gb|KHN34951.1| Nitrate transporter 1.1 [Glycine soja]
Length=586

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA++SKTGGW  +A+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ SA
Sbjct  12   IPDASDYKGRPAERSKTGGWTASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASA  71

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V++F+GTSF+LCLLGGFLAD+FLGR++TIAIF+AVQ  G   L ++T +P L P  CN
Sbjct  72   NVVTNFLGTSFMLCLLGGFLADTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCN  131

Query  504  PHQA--CQEANGFQMgilylalylialgtgglKSSVSGFG  617
                  C  AN  Q+ +LYLALY+ ALGTGGLKSSVSGFG
Sbjct  132  GDTVPPCVRANEKQLTVLYLALYVTALGTGGLKSSVSGFG  171



>ref|XP_006645998.1| PREDICTED: nitrate transporter 1.4-like [Oryza brachyantha]
Length=593

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 140/167 (84%), Gaps = 3/167 (2%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
             V DAVDY+G PAD++ TGGWV AAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS+ +
Sbjct  76   VVRDAVDYRGCPADRAATGGWVAAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAA  135

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN+V+DFMGTSFLLCLLGGFLADSFLGR+ TIA+F+ VQ +GTG LA++T + QLRP PC
Sbjct  136  ANVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQAVGTGLLAVSTLMHQLRPPPC  195

Query  501  NPHQ---ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   AC++A   QMG+LY+ LYLIALGTGGLKSSVSGFGTD FD
Sbjct  196  AAAAAGVACEQATPVQMGVLYVCLYLIALGTGGLKSSVSGFGTDQFD  242



>gb|KHG00259.1| Uncharacterized protein F383_18798 [Gossypium arboreum]
Length=585

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DY+G PA++SK+GGW  AA+ILG+E  ERL+T+GIAVN+VTYL GTMHL ++TS
Sbjct  10   TLPDAWDYRGCPAERSKSGGWTSAAMILGVEACERLTTLGIAVNMVTYLTGTMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            A  V++F+GTSF+LCLLGGF+AD+FLGR+ TI +F+AVQ  G   L ++T +P LRP  C
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGRYLTIVLFAAVQATGVTILTISTVIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +      C  A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  SRDSVTTCTPASGIQLVVLYLALYLTALGTGGLKSSVSGFGSDQFD  175



>ref|XP_003611286.1| Nitrate transporter [Medicago truncatula]
 gb|AES94244.1| peptide/nitrate transporter [Medicago truncatula]
Length=591

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 130/160 (81%), Gaps = 1/160 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            TV DA DYKG PAD+S TGGW  AA+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  11   TVPDASDYKGRPADRSTTGGWSAAAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAAS  70

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN+V++F+GTSF+LCLLGGFLAD+FLGR+ TIAIF+AVQ +G   L ++T +P L P  C
Sbjct  71   ANVVTNFLGTSFMLCLLGGFLADTFLGRYLTIAIFAAVQAIGVTILTISTIIPSLHPPKC  130

Query  501  NP-HQACQEANGFQMgilylalylialgtgglKSSVSGFG  617
                ++C +A+  Q+ ++YLALY+ ALGTGGLKSSVSGFG
Sbjct  131  KEDSKSCIQADSKQLLVMYLALYITALGTGGLKSSVSGFG  170



>gb|KHG27943.1| Uncharacterized protein F383_15837 [Gossypium arboreum]
Length=586

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 130/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DY+G PA++SK+GGW  AA+ILG E  ERL+T+GIAVNLVTYL  TMHL ++T+
Sbjct  10   TLPDAWDYRGKPAERSKSGGWASAAMILGGEACERLTTLGIAVNLVTYLTETMHLGNATA  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ANTVTNFLGTSFMLCLLGGFIADTFLGRYLTIAIFATVQATGVTILTISTIIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                A  C  A+G Q+ ILYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  TRDNATTCTPASGIQLIILYLALYLTALGTGGLKSSVSGFGSDQFD  175



>ref|XP_007039889.1| Nitrate transporter 1.1 isoform 2 [Theobroma cacao]
 gb|EOY24390.1| Nitrate transporter 1.1 isoform 2 [Theobroma cacao]
Length=584

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 132/168 (79%), Gaps = 5/168 (3%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA++SK+GGW  AA+ILG+E  ERL+T+GIAVNLVTYL GTMHL ++TS
Sbjct  10   TLPDAWDYKGSPAERSKSGGWTSAAMILGVEACERLTTLGIAVNLVTYLTGTMHLGNATS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLG-RFKTIAIFSAVQMlgtgtlalatKLPQLRPSP  497
            A  V++F+GTSF+LCLLGGF+AD+FLG R+ TI IF+ VQ  G   L ++T +P LRP  
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGSRYLTIGIFATVQATGVTILTISTVIPSLRPPK  129

Query  498  C---NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            C   NP   C +A+G Q+ ILYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  CSMDNP-TTCTQASGIQLIILYLALYLTALGTGGLKSSVSGFGSDQFD  176



>gb|ABF93501.1| Nitrate/chlorate transporter, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAH01124.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64490.1| hypothetical protein OsJ_19340 [Oryza sativa Japonica Group]
Length=589

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V +A DYKG  A +  TGGW  AA+IL +E+ ERL+T+G+AVNLVTYL GTMHL S+ SA
Sbjct  29   VGEAWDYKGRGAIRGSTGGWRSAAMILCVELNERLTTLGVAVNLVTYLTGTMHLGSAASA  88

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N V++F+GTSF+LCLLGGFLAD++LGR+ TIAIF+AVQ  G   L ++T  P LRP PC+
Sbjct  89   NAVTNFLGTSFMLCLLGGFLADTYLGRYLTIAIFTAVQAAGMAVLTISTAAPGLRPPPCS  148

Query  504  P-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                 C  ANG Q+G+LYL LY+ ALGTGGLKSSVSGFG+D FD
Sbjct  149  SGGSGCAAANGTQLGVLYLGLYMTALGTGGLKSSVSGFGSDQFD  192



>gb|KJB25599.1| hypothetical protein B456_004G199600 [Gossypium raimondii]
Length=586

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 130/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DY+G PA++SK+GGW  AA+ILG+E  ERL+T+GIAVN+VTYL GTMHL +++S
Sbjct  10   TLPDAWDYRGCPAERSKSGGWTSAAMILGVEACERLTTLGIAVNMVTYLTGTMHLGNASS  69

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            A  V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  70   ATTVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTILTISTVIPSLRPPKC  129

Query  501  NPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +      C  A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  130  SRDSVTTCTPASGIQLVVLYLALYLTALGTGGLKSSVSGFGSDQFD  175



>ref|XP_008358135.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Malus domestica]
Length=595

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 103/172 (60%), Positives = 131/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E + + T+ DA DY+G PA++SKTGGW  AA+ILG E  ERL+T+GIAVNLV YL GTMH
Sbjct  9    ETQGNLTLPDAWDYRGCPAERSKTGGWTAAAMILGGEACERLTTLGIAVNLVNYLTGTMH  68

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQ  482
            L ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q  G   L ++T +P 
Sbjct  69   LGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATIQATGVTVLTISTIVPS  128

Query  483  LRPSPCN--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LRP  C       C  A+G Q+ +LY+ALYL ALGTGGLKS VSGFG+D FD
Sbjct  129  LRPPKCTDGTDLPCITASGKQLTVLYIALYLTALGTGGLKSGVSGFGSDQFD  180



>ref|XP_009411045.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=605

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            ++DA DYKG PA +S++GGW  AA+IL +E+ ERL+T+GIAVNLVTYL GTMHL ++ SA
Sbjct  14   LSDAWDYKGRPAIRSRSGGWTSAAMILVVELNERLTTLGIAVNLVTYLRGTMHLGTAVSA  73

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N V++FMGTSF+LCLLGGF+AD+FLGR+ TIAIF+AVQ  G   L ++T +  LRP  C+
Sbjct  74   NTVTNFMGTSFMLCLLGGFIADTFLGRYLTIAIFAAVQASGVTILTISTVVRGLRPPACS  133

Query  504  PHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               A  C +A+G Q+ +LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  134  DLAAGGCVKASGTQLAVLYLALYLTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_004244572.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=590

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG P+ +S +GGW   A+ILG+E VERL+T+GIAVNLVTYL GTMHL ++T+
Sbjct  12   TLPDAWDYKGRPSLRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATA  71

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L ++T +P LRP  C
Sbjct  72   ANNVTNFLGTSFMLTLLGGFIADTFLGRYLTIGIFATVQAIGVTILTISTIVPSLRPPKC  131

Query  501  NP-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                 +C  ANG Q+ +LY+ALY+ ALGTGGLKSSVSGFGTD FD
Sbjct  132  EQGSSSCIPANGKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFD  176



>ref|XP_008437115.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 6.3-like 
[Cucumis melo]
Length=591

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DY G PA KSKTGGWV AA+ILG E VERL+T+GIAVNLVTYL  TMHL ++T+
Sbjct  13   TLPDAWDYTGKPAIKSKTGGWVAAAMILGPEAVERLTTLGIAVNLVTYLTETMHLGNATA  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCL GGF+AD+FLGR+ TI+IF+ VQ  G   L ++T +P LRP  C
Sbjct  73   ANNVTNFLGTSFMLCLFGGFVADTFLGRYLTISIFATVQATGVTLLTISTIIPSLRPPKC  132

Query  501  NPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +P  +   C  A+  Q+ +L+ ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  133  SPGVSTTPCIMADSKQLAVLHTALYLTALGTGGLKSSVSGFGSDQFD  179



>ref|XP_006650950.1| PREDICTED: nitrate transporter 1.1-like [Oryza brachyantha]
Length=570

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +3

Query  132  MSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPS  311
            MS  + DA DYKG PA ++ TGGW  AA+IL +E+ ERL+T+GIAVNLVTYL  TMHL +
Sbjct  2    MSSQLPDAWDYKGRPAIRASTGGWSCAAMILFVELNERLTTLGIAVNLVTYLTATMHLGT  61

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            + SAN V++F+GTSF+LCLLGGFLAD++L R+ TIAIF+A+Q  G   L ++T    LRP
Sbjct  62   AASANTVTNFLGTSFILCLLGGFLADTYLARYLTIAIFTALQATGMAVLTISTAATGLRP  121

Query  492  SPC-NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             PC +P  +C+ ANG Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  122  PPCTDPIGSCEPANGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  169



>ref|XP_009407160.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=601

 Score =   166 bits (419),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            ++DA DYKG PA +S+TG W  AA+IL +E+ ERL+T+GIAVNLVTYL GTMHL ++ SA
Sbjct  11   LSDAWDYKGRPAVRSRTGVWSGAAMILVVELNERLTTLGIAVNLVTYLTGTMHLGNAASA  70

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC-  500
            N V++FMGTSF+LCLLGGF+AD+FLGR+ TIAIF+AVQ  G   L ++T +P LRP  C 
Sbjct  71   NTVTNFMGTSFMLCLLGGFVADTFLGRYLTIAIFAAVQASGVSILTISTAVPGLRPPACA  130

Query  501  NPHQ-ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +P    C +A+G Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  131  DPASGGCVKASGAQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  175



>ref|XP_009376056.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Pyrus x bretschneideri]
Length=597

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 130/172 (76%), Gaps = 2/172 (1%)
 Frame = +3

Query  123  ERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMH  302
            E + + T+ DA DY+G PA++SKTGGW  A +ILG E  ERL+T+GIAVNLV YL GTMH
Sbjct  9    ETQGNLTLPDAWDYRGCPAERSKTGGWTAATMILGGEACERLTTLGIAVNLVNYLTGTMH  68

Query  303  LPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQ  482
            L ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q  G   L ++T +P 
Sbjct  69   LGNATSANTVTNFLGTSFILCLLGGFVADTFLGRYLTIAIFATIQATGVTVLTISTIVPS  128

Query  483  LRPSPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            LRP  C       C  ++G Q+ +LY+ALYL ALGTGGLKS VSGFG+D FD
Sbjct  129  LRPPKCTDGTVLPCITSSGKQLTVLYIALYLTALGTGGLKSGVSGFGSDQFD  180



>gb|EYU18566.1| hypothetical protein MIMGU_mgv1a020825mg [Erythranthe guttata]
Length=590

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG  + +S +GGW  AA+ILG+E VERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  13   TLPDAWDYKGRASVRSSSGGWASAAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNAMS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  73   ANNVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTILTISTVIPSLRPPKC  132

Query  501  NP-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                ++C  A+G Q+ +L+ ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  133  TAGSESCIPASGKQLMVLFAALYLTALGTGGLKSSVSGFGSDQFD  177



>ref|XP_010906609.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Elaeis 
guineensis]
Length=603

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            ++DA DY+G PA +SK+GGW  AA+IL +E+ ERL+T+GIAVNLVTYL GTMHL ++ +A
Sbjct  14   LSDAWDYRGRPAVRSKSGGWTSAAMILVVELNERLTTLGIAVNLVTYLTGTMHLGNAAAA  73

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N V++FMGTSF+LCLLGGF+AD+F+GR+ TIAIF+AVQ  G   L ++T +P LRP  C 
Sbjct  74   NTVTNFMGTSFMLCLLGGFVADTFIGRYLTIAIFAAVQASGVTILTISTAVPGLRPPKC-  132

Query  504  PHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            P+ A   C +A+  Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  133  PNMASGNCMKASPAQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_009382412.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 126/166 (76%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D+KG PA KS+T GW  AA ILG+E+ ERL+T+GIAVNLVTY  GTMHL  + S
Sbjct  13   TLSDAWDFKGRPAIKSRTAGWACAAAILGVEMGERLTTLGIAVNLVTYPTGTMHLGGADS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            ANI+++F+GTSF+LCL GGF+AD+FLGR+ TIA+F+AVQ  G   L ++T  P LRP  C
Sbjct  73   ANIITNFLGTSFILCLFGGFIADTFLGRYLTIAVFTAVQACGVIILTISTVAPGLRPPAC  132

Query  501  N--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C  ANG QMG+LYL L+  ALGTGGLKSSVSGFG+D FD
Sbjct  133  AGPSSGGCVPANGLQMGMLYLGLFTTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_004147617.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 ref|XP_004171170.1| PREDICTED: nitrate transporter 1.1-like [Cucumis sativus]
 gb|KGN50229.1| hypothetical protein Csa_5G161290 [Cucumis sativus]
Length=591

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 129/167 (77%), Gaps = 3/167 (2%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DY G PA K+KTGGWV AA+ILG E VERL+T+GIAVNLVTYL  TMHL ++T+
Sbjct  13   TLPDAWDYTGKPAIKAKTGGWVAAAMILGPEAVERLTTLGIAVNLVTYLTETMHLGNATA  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCL GGF+AD+FLGR+ TI+IF+ VQ  G   L ++T +P LRP  C
Sbjct  73   ANNVTNFLGTSFMLCLFGGFVADTFLGRYLTISIFATVQAAGVTILTISTIIPSLRPPKC  132

Query  501  NPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +P  +   C  A+  Q+ +L+ ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  133  SPGVSTTPCIMADSKQLAVLHTALYLTALGTGGLKSSVSGFGSDQFD  179



>gb|EYU30304.1| hypothetical protein MIMGU_mgv1a003140mg [Erythranthe guttata]
Length=605

 Score =   164 bits (416),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 128/165 (78%), Gaps = 1/165 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG  A +S +GGW  AA+ILG+E  ERL+T+GIAVNL+TYL  TMHL ++TS
Sbjct  13   TLPDAWDYKGRAAVRSSSGGWASAAMILGVETCERLTTLGIAVNLLTYLTATMHLGNATS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD++LGR+ TI IF+AVQ +G   L ++T +P LRP  C
Sbjct  73   ANTVTNFLGTSFMLCLLGGFIADTYLGRYLTIGIFAAVQAMGVALLTVSTIIPGLRPPKC  132

Query  501  NP-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                ++C  A G Q+ +LY ALY+ ALGTGGLKSSVSGFG+D FD
Sbjct  133  AAGGESCIPATGKQLMVLYAALYITALGTGGLKSSVSGFGSDQFD  177



>ref|XP_004983703.1| PREDICTED: nitrate transporter 1.1-like [Setaria italica]
Length=590

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ GTMHL ++ +A
Sbjct  15   LTDAWDYKGRPASRATTGGWACAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAA  74

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N V++F+GTSF+LCLLGGF+ADS+LGR+ TIA+F+AVQ  G   L ++T  P LRP PC 
Sbjct  75   NTVTNFIGTSFMLCLLGGFVADSYLGRYLTIAVFTAVQATGVMILTISTAAPGLRPPPCA  134

Query  504  PHQA----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +     C  ANG Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  135  DAKGASPDCVPANGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  181



>ref|XP_009388204.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Musa acuminata 
subsp. malaccensis]
Length=608

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 134/181 (74%), Gaps = 4/181 (2%)
 Frame = +3

Query  96   TVELPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNL  275
            TV LP  E        ++DA DYKG  A +S+TGGW  AA+IL +E+ ERL+T+GIAVNL
Sbjct  5    TVGLP--ETSAASGEVLSDAWDYKGRLAVRSRTGGWTGAAMILVVELNERLATLGIAVNL  62

Query  276  VTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgt  455
            VTYL GTMH  ++ +AN+V++FMG SF+LCLLGGF+AD++LGR+ T+ IF+AVQ  G   
Sbjct  63   VTYLTGTMHQGNADAANVVTNFMGVSFMLCLLGGFVADAYLGRYLTVGIFTAVQASGVTI  122

Query  456  lalatKLPQLRPSPC--NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPF  629
            L ++T LP L P PC      +C EA+G QMG+LYLALYL ALGTGGLKSSVSG G+D F
Sbjct  123  LTISTALPGLHPPPCADTASGSCAEASGLQMGVLYLALYLTALGTGGLKSSVSGLGSDQF  182

Query  630  D  632
            D
Sbjct  183  D  183



>emb|CAC07206.1| nitrate transporter [Brassica napus]
Length=588

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 130/167 (78%), Gaps = 1/167 (1%)
 Frame = +3

Query  135  SWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSS  314
            S T+ DA D++G PAD+SKTGGW  AA+IL IE VERL+T+GI VNLVTYL GTMHL ++
Sbjct  8    SQTLLDAWDFQGRPADRSKTGGWASAAMILCIEAVERLTTLGIGVNLVTYLTGTMHLGNA  67

Query  315  TSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPS  494
            T+AN V++F+GTSF+LCLLGGF+A +FLGR+ TIAIF+A+Q  G   L L+T +P  +P 
Sbjct  68   TAANTVTNFLGTSFMLCLLGGFIAHTFLGRYLTIAIFAAIQATGVSILTLSTIIPGFQPP  127

Query  495  PC-NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             C      C + +G Q+ +LYLALYL ALGTGG+K+SVSGFG+D FD
Sbjct  128  RCPTTSSHCVQPSGIQLTVLYLALYLTALGTGGVKASVSGFGSDQFD  174



>ref|XP_002443879.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
 gb|EES13374.1| hypothetical protein SORBIDRAFT_07g003690 [Sorghum bicolor]
Length=601

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D+KG PA ++ TG W  AA+IL  E+ ERL+T+GIAVNLVTYL GTMHL ++ SAN+
Sbjct  19   DAWDFKGRPAPRATTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTGTMHLGNAESANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+A+Q  G   L ++T  P LRP+ C+ +
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAIQASGVTILTISTAAPGLRPAACSAN  138

Query  510  QA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                 C  A+G Q+G++YLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  139  AGDGECARASGAQLGVMYLALYLTALGTGGLKSSVSGFGSDQFD  182



>ref|XP_008808741.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=604

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            ++DA DYKG PA ++++GGW  AA+IL +E+ ERL+T+GIAVNLVTYL GTMHL ++ +A
Sbjct  14   LSDAWDYKGRPAVRAQSGGWTSAAMILVVELNERLTTLGIAVNLVTYLTGTMHLGNAAAA  73

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N V++FMGTSF+LCLLGGF+AD+FLGR+ TIAIF+AVQ  G   L ++T +P LRP  C 
Sbjct  74   NTVTNFMGTSFMLCLLGGFVADTFLGRYLTIAIFAAVQASGVTILTISTAVPGLRPPACT  133

Query  504  PHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               +  C +A+  Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  134  DVGSGNCVKASAAQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_003573480.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=595

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 127/166 (77%), Gaps = 3/166 (2%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DY+G PA +  TG W  AA+IL  E+ ERL+T+GIAVNLVTYL  TMH+ ++ +A
Sbjct  15   LGDAWDYRGRPAARVSTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTATMHVGNAEAA  74

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V++FMGTSF+LCLLGGF+ADSFLGRF TIAIF+A+Q  G   L ++T  P LRP+ C 
Sbjct  75   NVVTNFMGTSFMLCLLGGFVADSFLGRFLTIAIFTAIQASGVTILTISTAAPGLRPASCT  134

Query  504  PHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            P  +   C  A+G Q+GILY ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  135  PSSSSPVCARASGAQLGILYAALYLTALGTGGLKSSVSGFGSDQFD  180



>ref|XP_004983702.1| PREDICTED: nitrate transporter 1.1-like [Setaria italica]
Length=590

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ GTMHL ++ +A
Sbjct  15   LTDAWDYKGRPASRASTGGWGCAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNAAAA  74

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N V++F+GTSF+LCLLGGF+ADS+LGR+ TIAIF+AVQ  G   L ++T  P LRP PC 
Sbjct  75   NTVTNFIGTSFMLCLLGGFVADSYLGRYLTIAIFTAVQATGVMILTISTAAPGLRPPPCA  134

Query  504  PHQA----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +     C  ANG Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  135  DAKGASPDCVPANGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  181



>ref|XP_009800593.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800594.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like isoform X2 [Nicotiana 
sylvestris]
Length=594

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTYL GTMHL ++T+AN 
Sbjct  15   DAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANN  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNP-  506
            V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQV  134

Query  507  -HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               +C  AN  Q+ +LY+ALY+ ALGTGGLKSSVSGFGTD FD
Sbjct  135  GSSSCIPANSKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFD  177



>emb|CAC00545.1| putative low-affinity nitrate transporter [Nicotiana plumbaginifolia]
Length=594

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTYL GTMHL ++T+AN 
Sbjct  15   DAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANN  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNP-  506
            V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQV  134

Query  507  -HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               +C  AN  Q+ +LY+ALY+ ALGTGGLKSSVSGFGTD FD
Sbjct  135  GSSSCIPANSKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFD  177



>gb|ACT66297.1| truncated nitrate transporter [Fragaria vesca]
Length=172

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 104/144 (72%), Gaps = 5/144 (3%)
 Frame = +3

Query  117  EMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGT  296
            E E K   T+ DA DY+G PAD+S TGGW  AA+ILG E  ERL+T+GIAVNLVTYL GT
Sbjct  5    ETEGK---TLPDAWDYQGQPADRSTTGGWTSAAMILGGEACERLTTLGIAVNLVTYLTGT  61

Query  297  MHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKL  476
            MHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ VQ  G   L ++T +
Sbjct  62   MHLGNATSANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATVQATGVTILTISTVI  121

Query  477  PQLRPSPCN--PHQACQEANGFQM  542
            P LRP  C       C   +G Q+
Sbjct  122  PSLRPPQCTRGSDSPCISCSGKQL  145



>gb|EMT27348.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=381

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 130/178 (73%), Gaps = 4/178 (2%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E+  +    + DA D KG PA +S TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ 
Sbjct  5    LPEIAAEGKGILTDAWDSKGRPAARSTTGGWGCAAMILGAELFERMTTLGIAVNLVPYMT  64

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
            GTMHL S+ +AN V++F+GTSF+LCLLGGF+AD++LGR+ TIA+FSAVQ  G   L ++T
Sbjct  65   GTMHLGSAAAANTVTNFIGTSFMLCLLGGFVADTYLGRYLTIAVFSAVQATGVMVLTIST  124

Query  471  KLPQLRPSPCNPHQA----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              P LRP+ C         C  ANG Q+G+LYL LY+ ALGTGGLKSSVSGFG+D FD
Sbjct  125  VAPGLRPAVCGDATGQSPDCVPANGTQLGVLYLGLYMTALGTGGLKSSVSGFGSDQFD  182



>dbj|BAC56916.1| nitrate transporter [Nicotiana tabacum]
Length=594

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTYL GTMHL +++SAN 
Sbjct  15   DAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNASSANN  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNP-  506
            V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQV  134

Query  507  -HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               +C  AN  Q+ +LY+ALY+ ALGTGGLKSSVSGFGTD FD
Sbjct  135  GSSSCIPANSKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFD  177



>ref|XP_006358355.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=590

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG P+ +S +GGW   A+ILG+E VERL+T+GIAVNLVTYL GTMHL ++T+AN 
Sbjct  15   DAWDYKGRPSLRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANN  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNP-  506
            V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLTLLGGFIADTFLGRYLTIGIFATVQAIGVTILTISTIIPSLRPPKCEQG  134

Query  507  HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +C  A+G Q+ +LY+ALY+ ALGTGGLKSSVSGFGTD FD
Sbjct  135  SSSCIPASGKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFD  176



>ref|XP_008649786.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA42806.1| TPA: hypothetical protein ZEAMMB73_647219 [Zea mays]
Length=600

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 133/182 (73%), Gaps = 6/182 (3%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    E KM+ T+ DA DYKG PA ++ +GGW  AA+IL +E+ ERL+T+G+ VNLVTY
Sbjct  7    LPETVAEGKMTTTMNDAWDYKGRPAVRASSGGWSSAAMILVVELNERLTTLGVGVNLVTY  66

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L GTMHL  + SAN V++F+G SF+LCLLGGF+AD++LGR+ TIAIF+AVQ  G   L +
Sbjct  67   LIGTMHLGGAASANAVTNFLGASFMLCLLGGFVADTYLGRYLTIAIFTAVQAAGMCVLTV  126

Query  465  atKLPQLRPSPC------NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDP  626
            +T  P LRP  C      +   +C E +G Q+G+LYL LYL ALGTGGLKSSVSGFG+D 
Sbjct  127  STAAPGLRPPACADPTGPSRRSSCVEPSGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQ  186

Query  627  FD  632
            FD
Sbjct  187  FD  188



>ref|XP_009598780.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
Length=594

 Score =   163 bits (413),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTYL GTMHL +++SAN 
Sbjct  15   DAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNASSANN  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNP-  506
            V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ VQ +G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQV  134

Query  507  -HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               +C  AN  Q+ +LY+ALY+ ALGTGGLKSSVSGFGTD FD
Sbjct  135  GSSSCIPANSKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFD  177



>gb|EAY88182.1| hypothetical protein OsI_09629 [Oryza sativa Indica Group]
Length=589

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V +A DYKG  A +  TGGW  AA+IL +E+ ERL+T+G+AV+LVTYL GTMHL S+ SA
Sbjct  29   VGEAWDYKGRGAIRGSTGGWRSAAMILCVELNERLTTLGVAVHLVTYLTGTMHLGSAASA  88

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N V++F+GTSF+LCLLGGFLAD++LGR+  IAIF+AVQ  G   L ++T  P LRP PC+
Sbjct  89   NAVTNFLGTSFMLCLLGGFLADTYLGRYLPIAIFTAVQAAGMAVLTISTAAPGLRPPPCS  148

Query  504  P-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                 C  ANG Q+G+LYL LY+ ALGTGGLKSSVSGFG+D FD
Sbjct  149  SGGSGCAAANGTQLGVLYLGLYMTALGTGGLKSSVSGFGSDQFD  192



>ref|XP_004972811.1| PREDICTED: nitrate transporter 1.1-like isoform X1 [Setaria italica]
Length=595

 Score =   162 bits (411),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D+KG PA ++ TG W  AA+IL  E+ ERL+T+GIAVNLVTYL  TMHL ++ SAN+
Sbjct  19   DAWDFKGRPAPRASTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTATMHLGNAESANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L ++T  P LRP+ C  +
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPATCPSN  138

Query  510  QA-CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             A C  A G Q+G+LY+ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  139  DASCSRATGPQLGVLYIALYLTALGTGGLKSSVSGFGSDQFD  180



>ref|XP_004972812.1| PREDICTED: nitrate transporter 1.1-like isoform X2 [Setaria italica]
Length=582

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D+KG PA ++ TG W  AA+IL  E+ ERL+T+GIAVNLVTYL  TMHL ++ SAN+
Sbjct  19   DAWDFKGRPAPRASTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTATMHLGNAESANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L ++T  P LRP+ C  +
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPATCPSN  138

Query  510  QA-CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             A C  A G Q+G+LY+ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  139  DASCSRATGPQLGVLYIALYLTALGTGGLKSSVSGFGSDQFD  180



>ref|XP_009763469.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=594

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 125/163 (77%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTYL GTMHL ++T+AN 
Sbjct  15   DAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANN  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNP-  506
            V++F+GTSF+L L GGF+AD+FLGR+ TI IF+ VQ +G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLTLFGGFVADTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQV  134

Query  507  -HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               +C  AN  Q+ +LY+ALY+ ALGTGGLKSSVSGFGTD FD
Sbjct  135  GSSSCIPANSKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFD  177



>gb|AFW57313.1| hypothetical protein ZEAMMB73_359381 [Zea mays]
Length=608

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (77%), Gaps = 5/166 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D+KG PA ++ TG W  AA+IL  E+ ERL+T+GIAVNLVTYL GTMHL ++ SAN+
Sbjct  19   DAWDFKGRPAPRATTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTGTMHLGNAESANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L ++T  P LRP+ C+  
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPASCSAT  138

Query  510  QA-----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C  A+G Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  139  GGGVVGECARASGAQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  184



>dbj|BAC56915.1| nitrate transporter [Nicotiana tabacum]
Length=594

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 125/163 (77%), Gaps = 2/163 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA +S +GGW   A+ILG+E VERL+T+GIAVNLVTYL GTMHL ++T+AN 
Sbjct  15   DAWDYKGRPALRSSSGGWASGAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNATAANN  74

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNP-  506
            V++F+GTSF+L L GGF+AD+FLGR+ TI IF+ VQ +G   L ++T +P LRP  C   
Sbjct  75   VTNFLGTSFMLTLFGGFVADTFLGRYLTIGIFATVQAMGVTILTISTIIPSLRPPKCEQV  134

Query  507  -HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               +C  AN  Q+ +LY+ALY+ ALGTGGLKSSVSGFGTD FD
Sbjct  135  GSSSCIPANSKQLMVLYIALYMTALGTGGLKSSVSGFGTDQFD  177



>ref|NP_001145735.1| uncharacterized protein LOC100279242 [Zea mays]
 gb|ACL52487.1| unknown [Zea mays]
Length=608

 Score =   162 bits (410),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 128/166 (77%), Gaps = 5/166 (3%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA D+KG PA ++ TG W  AA+IL  E+ ERL+T+GIAVNLVTYL GTMHL ++ SAN+
Sbjct  19   DAWDFKGRPAPRATTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTGTMHLGNAESANV  78

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L ++T  P LRP+ C+  
Sbjct  79   VTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTISTAAPGLRPASCSAT  138

Query  510  QA-----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C  A+G Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  139  GGGVVGECARASGAQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  184



>ref|XP_002464959.1| hypothetical protein SORBIDRAFT_01g029470 [Sorghum bicolor]
 gb|EER91957.1| hypothetical protein SORBIDRAFT_01g029470 [Sorghum bicolor]
Length=595

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 128/167 (77%), Gaps = 4/167 (2%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA ++ TGGW  AA+ILG+E+ ER++T+GIAVNLV Y+ GTMHL ++++A
Sbjct  15   LTDAWDYKGRPASRATTGGWACAAMILGVELFERMTTLGIAVNLVPYMTGTMHLGNASAA  74

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N V++F+G SF+LCLLGGF+AD++LGR+ TIA+F+AVQ  G   L ++T  P LRP PC 
Sbjct  75   NTVTNFIGASFMLCLLGGFVADTYLGRYLTIAVFTAVQATGVMILTISTAAPGLRPPPCG  134

Query  504  PHQA----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +     C  A G Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  135  DARGASADCVPATGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  181



>ref|XP_003566777.2| PREDICTED: protein NRT1/ PTR FAMILY 6.2 [Brachypodium distachyon]
Length=627

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 140/185 (76%), Gaps = 19/185 (10%)
 Frame = +3

Query  117  EMERKM------SWT-------VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTM  257
             ME KM      SW        V DAVDY G PAD+S+TG WV AAL+LGIE+ ERL+TM
Sbjct  45   NMEEKMETGARPSWIGAGNGNLVHDAVDYHGCPADRSRTGSWVAAALVLGIELCERLATM  104

Query  258  GIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQ  437
            GIAVNLVTYL  TMHLPS+ SAN+V+DFMGTSFLLCLLGGFLADSFLGRF TIAIF+ +Q
Sbjct  105  GIAVNLVTYLTDTMHLPSAESANVVTDFMGTSFLLCLLGGFLADSFLGRFLTIAIFALLQ  164

Query  438  MlgtgtlalatKLPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFG  617
             LGTG LA++T + QLRP P       + A G QMG+LY  LYLIALGTGGLKSSVSGFG
Sbjct  165  ALGTGLLAVSTTVRQLRPGP------GEAATGLQMGVLYACLYLIALGTGGLKSSVSGFG  218

Query  618  TDPFD  632
            TD FD
Sbjct  219  TDQFD  223



>dbj|BAD87491.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
 dbj|BAD87642.1| putative dicarboxylate transporter [Oryza sativa Japonica Group]
Length=587

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 141/184 (77%), Gaps = 16/184 (9%)
 Frame = +3

Query  111  LKEMERKMS-WT---------VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMG  260
            ++E+E+K S W+         V DAVDY+G PAD+S TGGWV AAL+LGIE+ ERLSTMG
Sbjct  2    VREVEKKTSAWSGGGGGGGNMVRDAVDYRGCPADRSATGGWVAAALVLGIELCERLSTMG  61

Query  261  IAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQM  440
            IAVNLVTYL GTMHLPS+ +AN+V+DFMGTSFLLCLLGGFLADSFLGR+ TIA+F+ VQ 
Sbjct  62   IAVNLVTYLTGTMHLPSAAAANVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQS  121

Query  441  lgtgtlalatKLPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGT  620
            +GT  LA +T +  LRP P       ++    QM +LY  LYLIALGTGGLKSSVSGFGT
Sbjct  122  IGTALLAASTLVTHLRPPP------GEQPTPVQMAVLYACLYLIALGTGGLKSSVSGFGT  175

Query  621  DPFD  632
            D FD
Sbjct  176  DQFD  179



>ref|XP_008367434.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 6.3-like 
[Malus domestica]
Length=598

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 128/169 (76%), Gaps = 5/169 (3%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGI---EIVERLSTMGIAVNLVTYLGGTMHLPS  311
            T+ DA  YKG P ++SKTGGW  AA+ILGI   E  ERL+T+GIAVNLVTYL GT HL S
Sbjct  15   TLPDAWVYKGCPTERSKTGGWTAAAMILGITSGEACERLTTLGIAVNLVTYLTGTTHLGS  74

Query  312  STSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRP  491
            +T+AN V++F+GTSF+LCLLGGF+AD+FLGR+ TIAIF+ +Q +G   L ++T +P L+P
Sbjct  75   ATAANTVTNFLGTSFMLCLLGGFVADTFLGRYLTIAIFATIQAMGVTILTISTTVPSLQP  134

Query  492  SPCNPHQA--CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              C       C  A+G Q+ ILY ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  135  PKCTAGTGSQCLPASGKQLTILYTALYLTALGTGGLKSSVSGFGSDQFD  183



>gb|EAY74514.1| hypothetical protein OsI_02405 [Oryza sativa Indica Group]
Length=566

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 115/163 (71%), Positives = 132/163 (81%), Gaps = 6/163 (4%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V DAVDY+G PAD+S TGGWV AAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS+ +A
Sbjct  2    VRDAVDYRGCPADRSATGGWVAAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAA  61

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V+DFMGTSFLLCLLGGFLADSFLGR+ TIA+F+ VQ +GT  LA +T +  LRP P  
Sbjct  62   NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPP--  119

Query  504  PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                 ++A   QM +LY  LYLIALGTGGLKSSVSGFGTD FD
Sbjct  120  ----GEQATPVQMAVLYACLYLIALGTGGLKSSVSGFGTDQFD  158



>dbj|BAJ90348.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02884.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92452.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 127/167 (76%), Gaps = 4/167 (2%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DY+G PA +S TG W  AA+IL  E+ ERL+T+GIAVNLVTYL  TMH+ ++ +A
Sbjct  17   LGDAWDYRGRPAARSTTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTATMHVGNAEAA  76

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+A+Q  G   L ++T  P LRP  C 
Sbjct  77   NVVTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAIQASGVTILTISTAAPGLRPPACT  136

Query  504  PHQA----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               A    C  A+G Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  137  AEGAGIGTCTRASGGQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  183



>ref|XP_010324989.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Solanum 
lycopersicum]
Length=544

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 123/149 (83%), Gaps = 5/149 (3%)
 Frame = +3

Query  201  WVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGF  380
            ++   + +GIE+ ERLSTMGIAVNLVTYL G MH+PS+TSA IVSDFMGTSFLLCLLGG 
Sbjct  5    YIQHVISIGIEVSERLSTMGIAVNLVTYLIGRMHIPSATSAKIVSDFMGTSFLLCLLGGL  64

Query  381  LADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPHQA-----CQEANGFQMg  545
            +ADSFLGR++TIAIF+ +Q LGTG LA+++ LPQL+P+PCN H +     C++A   QM 
Sbjct  65   IADSFLGRYRTIAIFAIIQTLGTGMLAISSMLPQLQPTPCNIHYSLKSSNCEQATTSQMS  124

Query  546  ilylalylialgtgglKSSVSGFGTDPFD  632
            +LY++LYL+ALGTGGLKSSVSGF TD FD
Sbjct  125  VLYISLYLMALGTGGLKSSVSGFCTDQFD  153



>ref|XP_008658424.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA46299.1| TPA: hypothetical protein ZEAMMB73_364341 [Zea mays]
 tpg|DAA46300.1| TPA: hypothetical protein ZEAMMB73_364341 [Zea mays]
Length=595

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 127/167 (76%), Gaps = 4/167 (2%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y+ GTMHL ++++A
Sbjct  15   LTDAWDYKGRPASRATTGGWACAAMILGAELFERMTTLGIAVNLVPYMTGTMHLGNASAA  74

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N V++F+G SF+LCLLGGF+AD++LGR+ TIAIF+AVQ  G   L ++T  P LRP  C 
Sbjct  75   NTVTNFIGASFMLCLLGGFVADTYLGRYLTIAIFTAVQATGVMILTISTAAPGLRPPACA  134

Query  504  PHQA----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              +     C  ANG Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  135  DAKGASPDCVPANGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  181



>ref|XP_009801608.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
Length=592

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = +3

Query  99   VELPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLV  278
            ++LP  + + K    + DA DYKG PA KS +GGW  +A+ILG+E VERL T+GIAVNLV
Sbjct  1    MDLPQTQQDTK---AIPDAWDYKGRPALKSLSGGWASSAMILGVEAVERLVTLGIAVNLV  57

Query  279  TYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtl  458
             YL  TMHL ++ +ANIV++FMGTS++L LLGG++AD+F+GR+ TI IF+ VQ +G   L
Sbjct  58   VYLTKTMHLGNANAANIVTNFMGTSYILTLLGGYIADTFIGRYLTIGIFATVQAIGVTIL  117

Query  459  alatKLPQLRPSPCN-PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             ++T +P LRP  C      C  A+G Q+ +LY ALY+ ALGTGGLKSSVSGFGTD FD
Sbjct  118  TISTIIPSLRPPKCELGSSTCIPASGEQLAVLYTALYMTALGTGGLKSSVSGFGTDQFD  176



>ref|XP_011070105.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Sesamum indicum]
Length=594

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 133/175 (76%), Gaps = 1/175 (1%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L +  ++ + T+ DA DYKG  + KS +GGW  AA+ILG+E  ER++T+GI VNLVTYL 
Sbjct  5    LPDTAQQAAETIPDAWDYKGRLSLKSSSGGWGSAAMILGVEACERMTTLGIVVNLVTYLT  64

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
            GTMHL ++T+AN V++F+GT+F+LCLLGGF+AD+FLGR+ TI IF+ +Q  G   L ++T
Sbjct  65   GTMHLGNATAANDVTNFLGTAFMLCLLGGFVADTFLGRYLTIGIFTTIQATGITILTIST  124

Query  471  KLPQLRPSPCNPHQ-ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +P LRP  C     +C  ANG Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  125  VVPGLRPPKCTAGSPSCIPANGKQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  179



>gb|EMT10378.1| Nitrate/chlorate transporter [Aegilops tauschii]
Length=603

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 126/167 (75%), Gaps = 4/167 (2%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DY+G PA +S TG W  AA+IL  E+ ERL+T+GIAVNLVTYL  TMH+ ++ +A
Sbjct  17   LGDAWDYRGRPAARSTTGRWGAAAMILVAELNERLTTLGIAVNLVTYLTATMHVGNAEAA  76

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+A+Q  G   L ++T  P LRP  C 
Sbjct  77   NVVTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAIQASGVTILTISTAAPGLRPPACT  136

Query  504  PHQA----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                    C  A+G Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  137  AEGGGIGTCSRASGAQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  183



>dbj|BAK05363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   159 bits (402),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 125/167 (75%), Gaps = 6/167 (4%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DY+G PA +  +GGW  AA+ILG+E+ ERL+T+GIAVNLVTYL  TMHL ++ SAN 
Sbjct  18   DAWDYRGRPAVRDSSGGWSSAAMILGVELNERLTTLGIAVNLVTYLTATMHLGNAASANA  77

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++F+GTSFLLCLLGGF+AD++LGR+ TIAI +AVQ  G   L ++T  P LRP+PC   
Sbjct  78   VTNFLGTSFLLCLLGGFVADTYLGRYLTIAISTAVQAAGMTVLTVSTAAPGLRPAPCKDP  137

Query  510  Q------ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                    C   +G Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  138  SGDGSAPGCAPPSGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  184



>ref|NP_001043326.1| Os01g0556700 [Oryza sativa Japonica Group]
 dbj|BAF05240.1| Os01g0556700 [Oryza sativa Japonica Group]
Length=566

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 131/163 (80%), Gaps = 6/163 (4%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V DAVDY+G PAD+S TGGWV AAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS+ +A
Sbjct  2    VRDAVDYRGCPADRSATGGWVAAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAA  61

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V+DFMGTSFLLCLLGGFLADSFLGR+ TIA+F+ VQ +GT  LA +T +  LRP P  
Sbjct  62   NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPP--  119

Query  504  PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                 ++    QM +LY  LYLIALGTGGLKSSVSGFGTD FD
Sbjct  120  ----GEQPTPVQMAVLYACLYLIALGTGGLKSSVSGFGTDQFD  158



>ref|XP_006662041.1| PREDICTED: nitrate transporter 1.1-like [Oryza brachyantha]
Length=589

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    E K    + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y
Sbjct  5    LPETAAEGK---ALTDAWDYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPY  61

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            + GTMHL ++ +AN V++F+GTSF+LCLLGGF+AD++LGR+ TIA+F+AVQ  G   L +
Sbjct  62   MTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFIADTYLGRYLTIAVFAAVQATGVMILTI  121

Query  465  atKLPQLRPSPCNPHQA----CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T  P LRP  C+  +     C  ANG Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  122  STAAPGLRPPACSDPKGESADCVVANGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  181



>ref|XP_009613364.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
Length=592

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 132/179 (74%), Gaps = 4/179 (2%)
 Frame = +3

Query  99   VELPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLV  278
            ++LP  + + K   ++ DA DYKG PA KS +GGW  +A+ILG+E VERL T+GIAVNLV
Sbjct  1    MDLPQTQQDTK---SIPDAWDYKGRPALKSLSGGWASSAMILGVEAVERLVTLGIAVNLV  57

Query  279  TYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtl  458
             YL  TMHL ++ +ANIV++FMGTS++L LLGG++AD+F+GR+ TI IF+ VQ +G   L
Sbjct  58   VYLTKTMHLGNANAANIVTNFMGTSYILTLLGGYIADTFIGRYLTIGIFATVQAIGVTIL  117

Query  459  alatKLPQLRPSPCN-PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             ++T +P LRP  C      C  A+G Q+ +LY ALY+ ALGTGGLKSSVSGFG+D FD
Sbjct  118  TISTIIPSLRPPKCELGSSTCIPASGKQLAVLYTALYMTALGTGGLKSSVSGFGSDQFD  176



>gb|EEC67416.1| hypothetical protein OsI_34598 [Oryza sativa Indica Group]
Length=568

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    E K    + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y
Sbjct  3    LPETAAEGK---ALTDAWDYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            + GTMHL ++ +AN V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF AVQ  G   L +
Sbjct  60   MTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFVADTYLGRYLTIAIFEAVQATGVMILTI  119

Query  465  atKLPQLRPSPC-NPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T  P LRP  C +P  A   C  A+G Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  120  STAAPGLRPPACGDPKGASAECVAADGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  179



>gb|EAZ16929.1| hypothetical protein OsJ_32411 [Oryza sativa Japonica Group]
Length=574

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    E K    + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y
Sbjct  3    LPETAAEGK---ALTDAWDYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            + GTMHL ++ +AN V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF AVQ  G   L +
Sbjct  60   MTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFVADTYLGRYLTIAIFEAVQATGVMILTI  119

Query  465  atKLPQLRPSPC-NPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T  P LRP  C +P  A   C  A+G Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  120  STAAPGLRPPACGDPKGASAECVAADGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  179



>ref|XP_003572060.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=601

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 125/167 (75%), Gaps = 4/167 (2%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA DYKG PA ++ TGGW  AA+I G E+ ER++T+GIAVNLV Y+  TMHL S+ +A
Sbjct  23   LTDAWDYKGRPASRAATGGWGCAAMICGAELFERMTTLGIAVNLVPYMTATMHLGSAAAA  82

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC-  500
            N V++F+GTSF+LCLLGGF+AD++LGR+ TIA+FSAVQ  G   L ++T  P LRP+ C 
Sbjct  83   NTVTNFIGTSFMLCLLGGFVADTYLGRYLTIAVFSAVQATGVMVLTISTVAPGLRPAACG  142

Query  501  ---NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                    C  ANG Q+G+LYL LY+ ALGTGGLKSSVSGFG+D FD
Sbjct  143  DATGQSSECVPANGTQLGVLYLGLYMTALGTGGLKSSVSGFGSDQFD  189



>gb|ABB47972.1| Nitrate/chlorate transporter, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG90898.1| unnamed protein product [Oryza sativa Japonica Group]
Length=596

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    E K    + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y
Sbjct  5    LPETAAEGK---ALTDAWDYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPY  61

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            + GTMHL ++ +AN V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF AVQ  G   L +
Sbjct  62   MTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFVADTYLGRYLTIAIFEAVQATGVMILTI  121

Query  465  atKLPQLRPSPC-NPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T  P LRP  C +P  A   C  A+G Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  122  STAAPGLRPPACGDPKGASAECVAADGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  181



>gb|AAK15441.1|AC037426_3 putative nitrate transporter [Oryza sativa Japonica Group]
Length=594

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 132/180 (73%), Gaps = 7/180 (4%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    E K    + DA DYKG PA ++ TGGW  AA+ILG E+ ER++T+GIAVNLV Y
Sbjct  3    LPETAAEGK---ALTDAWDYKGRPAGRAATGGWGCAAMILGAELFERMTTLGIAVNLVPY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            + GTMHL ++ +AN V++F+GTSF+LCLLGGF+AD++LGR+ TIAIF AVQ  G   L +
Sbjct  60   MTGTMHLGNAAAANTVTNFIGTSFMLCLLGGFVADTYLGRYLTIAIFEAVQATGVMILTI  119

Query  465  atKLPQLRPSPC-NPHQA---CQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T  P LRP  C +P  A   C  A+G Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  120  STAAPGLRPPACGDPKGASAECVAADGTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  179



>gb|EAZ12317.1| hypothetical protein OsJ_02208 [Oryza sativa Japonica Group]
Length=566

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 131/163 (80%), Gaps = 6/163 (4%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            V DAVDY+G PAD+S TGGWV AAL+LGIE+ ERLSTMGIAVNLVTYL GTMHLPS+ +A
Sbjct  2    VRDAVDYRGCPADRSATGGWVCAALVLGIELCERLSTMGIAVNLVTYLTGTMHLPSAAAA  61

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCN  503
            N+V+DFMGTSFLLCLLGGFLADSFLGR+ TIA+F+ VQ +GT  LA +T +  LRP P  
Sbjct  62   NVVTDFMGTSFLLCLLGGFLADSFLGRYLTIAVFALVQSIGTALLAASTLVTHLRPPP--  119

Query  504  PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                 ++    QM +LY  LYLIALGTGGLKSSVSGFGTD FD
Sbjct  120  ----GEQPTPVQMAVLYACLYLIALGTGGLKSSVSGFGTDQFD  158



>ref|XP_008658431.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Zea mays]
 tpg|DAA46302.1| TPA: hypothetical protein ZEAMMB73_201644 [Zea mays]
Length=588

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA ++ TGGW  AA+ LG+E+ ER++T+GIAVNLV Y+ GTMHL ++ +AN 
Sbjct  17   DAWDYKGRPASRATTGGWACAAMTLGVELFERMTTLGIAVNLVPYMTGTMHLGNAAAANT  76

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++F+G SF+LCLLGGF+AD++LGR+ TIAIF+AVQ  G   L ++T  P LRP  C   
Sbjct  77   VTNFIGASFMLCLLGGFVADTYLGRYLTIAIFTAVQATGVVILTISTAAPGLRPPACGAA  136

Query  510  Q-ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
               C  AN  Q+G+LYL LYL ALGTGGLKSSVSGFG+D FD
Sbjct  137  SPNCVRANKTQLGVLYLGLYLTALGTGGLKSSVSGFGSDQFD  178



>ref|XP_004242006.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Solanum lycopersicum]
Length=592

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 132/177 (75%), Gaps = 4/177 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + E K+   + DA DYKG PA +S +GGW  AA+ILG+E VERL T+GIAVNLV Y
Sbjct  3    LPHTQQETKV---IPDAWDYKGRPALRSTSGGWAGAAMILGVEAVERLVTLGIAVNLVVY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L  TMHL ++++ANIV++FMGTS++L LLGG++AD+FLGR+ T+ I + VQ +G   L +
Sbjct  60   LTKTMHLGNASAANIVTNFMGTSYILTLLGGYVADTFLGRYLTVGIGATVQAIGVTILTI  119

Query  465  atKLPQLRPSPCNPHQ-ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T +P LRP  C+    +C  A+G Q+ +L++ALY+ ALGTG LKSSVSGFGTD FD
Sbjct  120  STIVPSLRPPKCDLGSPSCIPADGKQLAVLFIALYMTALGTGFLKSSVSGFGTDQFD  176



>ref|XP_006366745.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=592

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 130/177 (73%), Gaps = 4/177 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + E K+   V DA DYKG  A +S +GGW  AA+ILG+E VERL T+GIAVNLV Y
Sbjct  3    LPHTQQETKV---VPDAWDYKGRHALRSTSGGWAGAAMILGVEAVERLVTLGIAVNLVVY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L  TMHL ++++ANIV++FMGTS++L LLGG++AD+FLGR+ T+ I + VQ +G   L +
Sbjct  60   LTKTMHLGNASAANIVTNFMGTSYILTLLGGYVADTFLGRYLTVGIGATVQAIGVTILTI  119

Query  465  atKLPQLRPSPCNPHQ-ACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T +P L+P  CN    +C  ANG Q+ +L+ ALY+ ALGTG LKSSVSGFGTD FD
Sbjct  120  STIIPSLQPPKCNLGSPSCIPANGKQLAVLFTALYMTALGTGFLKSSVSGFGTDQFD  176



>ref|XP_008794846.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Phoenix dactylifera]
Length=606

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA ++++GGW  AA+IL +E+ ERL+T+GI VNLVTYL GTMHL ++ +AN 
Sbjct  16   DAWDYKGRPAIQARSGGWTSAAMILVVELNERLTTLGIGVNLVTYLTGTMHLGNAAAANA  75

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
            V++FMGTSF+LCLLGGF+AD+FLGR++TIAIF+AVQ  G   L ++T  P+LRP  C   
Sbjct  76   VTNFMGTSFMLCLLGGFIADTFLGRYRTIAIFTAVQAAGVTILTISTAAPELRPPACADA  135

Query  510  QA--C-QEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             +  C  EA+  QMG+LYLALYL ALGTGGLKSSVSG G+D FD
Sbjct  136  ASGDCGNEASAVQMGVLYLALYLTALGTGGLKSSVSGIGSDQFD  179



>gb|KDP25643.1| hypothetical protein JCGZ_20799 [Jatropha curcas]
Length=583

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +3

Query  150  DAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANI  329
            DA DYKG PA++S TGGW  AA+ILG E VERL+T+GI VNLVTY+  TMHL ++T+AN 
Sbjct  13   DAWDYKGRPAERSITGGWTSAAMILGGEAVERLTTLGIVVNLVTYMTDTMHLGNATAANT  72

Query  330  VSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH  509
             ++F+GT+F+LCLLGGF+AD+FLGR+ TIAIF+ VQ +G   L ++T LP LRP  C  +
Sbjct  73   TTNFLGTTFMLCLLGGFVADTFLGRYLTIAIFATVQAMGITILTISTALPSLRPPKCENN  132

Query  510  QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              C  A+G Q+ ILYLALY+ ALGTGG+KSSVSGF +D FD
Sbjct  133  TGCIPASGKQLTILYLALYMYALGTGGIKSSVSGFASDQFD  173



>dbj|BAC99394.1| putative nitrate transporter [Oryza sativa Japonica Group]
 gb|EAZ05635.1| hypothetical protein OsI_27853 [Oryza sativa Indica Group]
Length=603

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    +      + DA DY+G PA +S+TG W  AA+IL  E+ ERL+T+GIAVNLVTY
Sbjct  5    LPETNAQAAAEEVLGDAWDYRGRPAARSRTGRWGAAAMILVAELNERLTTLGIAVNLVTY  64

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L  TMH  ++ +AN+V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L +
Sbjct  65   LTATMHAGNAEAANVVTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTI  124

Query  465  atKLPQLRPSPCNPHQACQE-ANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T  P LRP+ C    A  E A G QMG+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  125  STAAPGLRPAACAAGSAACERATGAQMGVLYLALYLTALGTGGLKSSVSGFGSDQFD  181



>ref|XP_010941437.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Elaeis guineensis]
Length=589

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T++DA D+KG PA +S++GGW  AA+IL +E+ ER++T+GIAVNLVTY+  TMHL ++ +
Sbjct  13   TLSDAWDHKGRPAVQSRSGGWTSAAMILVVELNERMTTLGIAVNLVTYMTVTMHLGNAAA  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++FMGTSF+L LLGGF+AD+FLGR+ TIAIF+AVQ  G   LA++T  P LRP PC
Sbjct  73   ANAVTNFMGTSFILSLLGGFIADTFLGRYVTIAIFAAVQASGVVILAISTVAPGLRPPPC  132

Query  501  N--PHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                   C +A+G Q+G+LYLALY  ALGTGGLKSSVSGFG+D FD
Sbjct  133  ADLASGGCAKASGVQLGVLYLALYTTALGTGGLKSSVSGFGSDQFD  178



>gb|KHN42706.1| Nitrate transporter 1.1 [Glycine soja]
Length=575

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = +3

Query  183  KSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLL  362
            K   GGW  +A+ILG E++ERL+T+GIAVNLVTYL GTMHL ++ SAN+V++F+GTSF+L
Sbjct  14   KQVAGGWTASAMILGGEVMERLTTLGIAVNLVTYLTGTMHLGNAASANVVTNFLGTSFML  73

Query  363  CLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPHQA--CQEANGF  536
            CLLGGFLAD+FLGR++TIAIF+AVQ  G   L ++T +P L P  CN      C  AN  
Sbjct  74   CLLGGFLADTFLGRYRTIAIFAAVQATGVTILTISTIIPSLHPPKCNGDTVPPCVRANEK  133

Query  537  QMgilylalylialgtgglKSSVSGFGTDPFD  632
            Q+  LYLALY+ ALGTGGLKSSVSGFG+D FD
Sbjct  134  QLTALYLALYVTALGTGGLKSSVSGFGSDQFD  165



>ref|XP_010533775.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Tarenaya hassleriana]
Length=642

 Score =   155 bits (391),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 141/195 (72%), Gaps = 14/195 (7%)
 Frame = +3

Query  72   FYQLENLFTVELPLKEMERKMSWTVADAVDYKGFPADKSKTGG-WVPAALILG-----IE  233
            F  L+NL  + LP  +       T+ DA +++G PA +SKTGG +V     L      IE
Sbjct  39   FLFLQNLSDMSLPETQD------TLLDAWNFQGQPAVRSKTGGVYVYRVFFLKREFSCIE  92

Query  234  IVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKT  413
             VERL+T+GI VNLVTYL GTMHL ++TSAN V++F+GTSF+LCLLGGF+AD+FLGR+ T
Sbjct  93   AVERLTTLGIGVNLVTYLTGTMHLGNATSANTVTNFLGTSFMLCLLGGFIADTFLGRYLT  152

Query  414  IAIFSAVQMlgtgtlalatKLPQLRPSPCNP--HQACQEANGFQMgilylalylialgtg  587
            IA+F+AVQ  G   L L+T +P LRP  C+P    +C++A+G Q+ +LYLALYL ALGTG
Sbjct  153  IAVFAAVQATGVTILTLSTIIPGLRPPKCDPTSSNSCEQASGVQLLVLYLALYLTALGTG  212

Query  588  glKSSVSGFGTDPFD  632
            G+K+SVSGFG+D FD
Sbjct  213  GVKASVSGFGSDQFD  227



>ref|XP_009591624.1| PREDICTED: protein NRT1/ PTR FAMILY 6.2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=576

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = +3

Query  225  GIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGR  404
            GIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIV+DFMGTSFLLCLLGGFLADSFLGR
Sbjct  26   GIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIVTDFMGTSFLLCLLGGFLADSFLGR  85

Query  405  FKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPHQ-ACQEANGFQMgilylalylialg  581
            +KTIAIF+ +Q LGTG L LA  LPQLRP PC+ H  +CQ A G QMGILY+ALYLIALG
Sbjct  86   YKTIAIFALIQTLGTGMLTLAVSLPQLRPPPCHRHDVSCQPAKGSQMGILYMALYLIALG  145

Query  582  tgglKSSVSGFGTDPFD  632
            TGGLKSSVSGFGTD FD
Sbjct  146  TGGLKSSVSGFGTDQFD  162



>gb|EAZ41557.1| hypothetical protein OsJ_26080 [Oryza sativa Japonica Group]
Length=634

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP    +      + DA DY+G PA +S+TG W  AA+IL  E+ ERL+T+GIAVNLVTY
Sbjct  5    LPETNAQAAAEEVLGDAWDYRGRPAARSRTGRWGAAAMILVAELNERLTTLGIAVNLVTY  64

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L  TMH  ++ +AN+V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L +
Sbjct  65   LTATMHAGNAEAANVVTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQAPGVTILTI  124

Query  465  atKLPQLRPSPCNPHQACQE-ANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T  P LRP+ C    A  E A G QMG+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  125  STAAPGLRPAACAAGSAACERATGAQMGVLYLALYLTALGTGGLKSSVSGFGSDQFD  181



>ref|XP_003574312.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Brachypodium distachyon]
Length=599

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 124/167 (74%), Gaps = 4/167 (2%)
 Frame = +3

Query  144  VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSA  323
            + DA D KG PA ++ TGGW  AA+I G E+ ER++T+GIAVNLV Y+  TMHL S+ +A
Sbjct  19   LTDAWDSKGRPAARASTGGWGCAAMICGAELFERMTTLGIAVNLVPYMTSTMHLGSAAAA  78

Query  324  NIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC-  500
            N V++F+GTSF+LCLLGGF+AD++LGR+ TIA+FSAVQ  G   L ++T  P LRP+ C 
Sbjct  79   NTVTNFIGTSFMLCLLGGFVADTYLGRYLTIAVFSAVQATGVMVLTISTVAPGLRPAACG  138

Query  501  ---NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                    C  ANG Q+G+LYL LY+ ALGTGGLKSSVSGFG+D FD
Sbjct  139  DATGQSSECVPANGTQLGVLYLGLYMTALGTGGLKSSVSGFGSDQFD  185



>ref|XP_002468692.1| hypothetical protein SORBIDRAFT_01g050410 [Sorghum bicolor]
 gb|EER95690.1| hypothetical protein SORBIDRAFT_01g050410 [Sorghum bicolor]
Length=605

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 127/168 (76%), Gaps = 5/168 (3%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG PA +  +GGW  AA+IL +E+ ERL+T+G+ VNLVTYL  TMHL  + S
Sbjct  23   TMMDAWDYKGRPAVRGSSGGWSSAAMILVVELNERLTTLGVGVNLVTYLMDTMHLGGAAS  82

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+G SF+LCLLGGF+AD++LGR+ TIAIF+AVQ +G   L ++T  P LRP  C
Sbjct  83   ANAVTNFLGASFMLCLLGGFVADTYLGRYLTIAIFTAVQAVGMCVLTVSTAAPGLRPPAC  142

Query  501  ----NPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                 P+  C E +G Q+G+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  143  ADPTGPNH-CVEPSGTQLGVLYLALYLTALGTGGLKSSVSGFGSDQFD  189



>ref|XP_010669517.1| PREDICTED: protein NRT1/ PTR FAMILY 6.4 [Beta vulgaris subsp. 
vulgaris]
Length=578

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 120/163 (74%), Gaps = 3/163 (2%)
 Frame = +3

Query  153  AVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTSANIV  332
             VDY G PADKS+TGGW+ A LILG E  ER+  MGI++NLVTYL G +HL SS SA IV
Sbjct  16   VVDYNGNPADKSRTGGWLAAGLILGTEFAERVCVMGISMNLVTYLVGYLHLSSSKSATIV  75

Query  333  SDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPCNPH-  509
            ++FMGT  LL L GGF+AD+ LGR+ T+AIF+++  LG   L LAT LP +RP PCNP  
Sbjct  76   TNFMGTLNLLGLFGGFVADAKLGRYLTVAIFASIAALGVALLTLATSLPSMRPPPCNPRS  135

Query  510  --QACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                C  A+G Q+ +LY ALY+IALG GG+KS+VSGFG+D FD
Sbjct  136  PGSHCISADGKQLAMLYAALYIIALGGGGIKSNVSGFGSDQFD  178



>ref|XP_006659845.1| PREDICTED: nitrate transporter 1.1-like [Oryza brachyantha]
Length=503

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = +3

Query  111  LKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLG  290
            L E   + +  + DA DY G P  +S+TG W  AA+IL  E+ ERL+T+GIAVNLVTYL 
Sbjct  5    LPESNAQAADVLGDAWDYGGRPPARSRTGRWGAAAMILVAELNERLTTLGIAVNLVTYLT  64

Query  291  GTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalat  470
             TMH+ ++ +AN+V++FMGTSF+LCLLGGF+ADSFLGR+ TIAIF+AVQ  G   L ++T
Sbjct  65   ATMHVGNAEAANVVTNFMGTSFMLCLLGGFVADSFLGRYLTIAIFTAVQASGVTILTIST  124

Query  471  KLPQLRPSPCNPHQACQE-ANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
              P LRP+ C    A  E A G QMG+LYLALYL ALGTGGLKSSVSGFG+D FD
Sbjct  125  AAPGLRPAACAAGSAACERAAGAQMGVLYLALYLTALGTGGLKSSVSGFGSDQFD  179



>gb|EMS53820.1| Nitrate transporter 1.4 [Triticum urartu]
Length=542

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 118/177 (67%), Gaps = 42/177 (24%)
 Frame = +3

Query  117  EMERKMSWT-----VADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVT  281
            E+ER  SW+     V DAVDY+G PA++S TG W+ AA ++GIE+ ERL+TMGIAVNLVT
Sbjct  2    EIERS-SWSEDGNLVQDAVDYRGCPANRSNTGSWLGAASVVGIELCERLATMGIAVNLVT  60

Query  282  YLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtla  461
            YL  TMHLPS+ SAN+V+DFMGTSFLLC LGGFLAD+FLGR+ TIAIF+           
Sbjct  61   YLTDTMHLPSAESANVVTDFMGTSFLLCFLGGFLADAFLGRYLTIAIFAL----------  110

Query  462  latKLPQLRPSPCNPHQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                                      M +LY+ LYLIALGTGGLKSSVSGFGTD FD
Sbjct  111  --------------------------MVVLYVCLYLIALGTGGLKSSVSGFGTDQFD  141



>gb|EYU24743.1| hypothetical protein MIMGU_mgv1a003354mg [Erythranthe guttata]
Length=590

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 127/165 (77%), Gaps = 1/165 (1%)
 Frame = +3

Query  141  TVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTYLGGTMHLPSSTS  320
            T+ DA DYKG  + +S +GGW  AA+ILG+E VERL+T+GIAVNLVTYL GTMHL ++ S
Sbjct  13   TLPDAWDYKGRSSVRSSSGGWASAAMILGVEAVERLTTLGIAVNLVTYLTGTMHLGNAMS  72

Query  321  ANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlalatKLPQLRPSPC  500
            AN V++F+GTSF+LCLLGGF+AD+FLGR+ TI IF+ VQ  G   L ++T +P LRP  C
Sbjct  73   ANNVTNFLGTSFMLCLLGGFIADTFLGRYLTIGIFATVQATGVTILTISTVIPSLRPPKC  132

Query  501  NP-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
                ++C  A+  Q+ +L+ ALYL ALGTGGLKSSVSGFG+D FD
Sbjct  133  TAGSESCIPASSKQLMVLFAALYLTALGTGGLKSSVSGFGSDQFD  177



>ref|XP_006355480.1| PREDICTED: nitrate transporter 1.1-like [Solanum tuberosum]
Length=590

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 135/179 (75%), Gaps = 4/179 (2%)
 Frame = +3

Query  99   VELPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLV  278
            + LP  + + K   T+ DA DYKG PA +S +GGW  AA+ILGIE VERL+T+GIAVNLV
Sbjct  1    MSLPETQHDTK---TLPDAWDYKGRPALRSSSGGWSSAAMILGIEAVERLTTLGIAVNLV  57

Query  279  TYLGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtl  458
            TYL GTMHL ++ SAN V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ +Q +G   L
Sbjct  58   TYLTGTMHLGNANSANNVTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFTTIQAMGVTIL  117

Query  459  alatKLPQLRPSPCNP-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
             ++T +P LRP  C P    C  A+G Q+ +LY+ALY+ ALGTGGLKSSVSGFG+D FD
Sbjct  118  TISTIIPSLRPPKCEPGSSTCIPASGKQLMVLYIALYMTALGTGGLKSSVSGFGSDQFD  176



>emb|CAC00544.1| putative low-affinity nitrate transporter [Nicotiana plumbaginifolia]
Length=590

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 135/177 (76%), Gaps = 4/177 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + + K   T+ DA DYKG PA +S +GGW  AA+ILGIE VERL+T+GIAVNLVTY
Sbjct  3    LPETQQDTK---TLPDAWDYKGRPAVRSSSGGWSSAAMILGIEAVERLTTLGIAVNLVTY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L GTMHL +++SAN V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ +Q +G   L +
Sbjct  60   LTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFTTIQAMGVTILTI  119

Query  465  atKLPQLRPSPCNP-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T +P LRP  C+P    C  A+  Q+ +LY+ALY+ ALGTGGLKSSVSGFG+D FD
Sbjct  120  STIIPSLRPPKCSPGSSTCIPASSKQLMVLYIALYMTALGTGGLKSSVSGFGSDQFD  176



>ref|XP_009798260.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana sylvestris]
 dbj|BAC56913.1| nitrate transporter [Nicotiana tabacum]
Length=590

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 135/177 (76%), Gaps = 4/177 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + + K   T+ DA DYKG PA +S +GGW  AA+ILGIE VERL+T+GIAVNLVTY
Sbjct  3    LPETQQDTK---TLPDAWDYKGRPAVRSSSGGWSSAAMILGIEAVERLTTLGIAVNLVTY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L GTMHL +++SAN V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ +Q +G   L +
Sbjct  60   LTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFTTIQAMGVTILTI  119

Query  465  atKLPQLRPSPCNP-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T +P LRP  C+P    C  A+  Q+ +LY+ALY+ ALGTGGLKSSVSGFG+D FD
Sbjct  120  STIIPSLRPPKCSPGSSTCIPASSKQLMVLYIALYMTALGTGGLKSSVSGFGSDQFD  176



>ref|XP_009611019.1| PREDICTED: protein NRT1/ PTR FAMILY 6.3-like [Nicotiana tomentosiformis]
 dbj|BAC56914.1| nitrate transporter [Nicotiana tabacum]
Length=590

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 135/177 (76%), Gaps = 4/177 (2%)
 Frame = +3

Query  105  LPLKEMERKMSWTVADAVDYKGFPADKSKTGGWVPAALILGIEIVERLSTMGIAVNLVTY  284
            LP  + + K   T+ DA DYKG PA +S +GGW  AA+ILGIE VERL+T+GIAVNLVTY
Sbjct  3    LPETQQDTK---TLPDAWDYKGRPAVRSSSGGWSSAAMILGIEAVERLTTLGIAVNLVTY  59

Query  285  LGGTMHLPSSTSANIVSDFMGTSFLLCLLGGFLADSFLGRFKTIAIFSAVQMlgtgtlal  464
            L GTMHL +++SAN V++F+GTSF+L LLGGF+AD+FLGR+ TI IF+ +Q +G   L +
Sbjct  60   LTGTMHLGNASSANNVTNFLGTSFMLTLLGGFVADTFLGRYLTIGIFTTIQAMGVTILTI  119

Query  465  atKLPQLRPSPCNP-HQACQEANGFQMgilylalylialgtgglKSSVSGFGTDPFD  632
            +T +P LRP  C+P    C  A+  Q+ +LY+ALY+ ALGTGGLKSSVSGFG+D FD
Sbjct  120  STIIPSLRPPKCSPGSSTCIPASSKQLMVLYIALYMTALGTGGLKSSVSGFGSDQFD  176



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 920235338500