BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF044N02

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    240   6e-70   Solanum lycopersicum
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    238   5e-69   Solanum pennellii
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    237   1e-68   Solanum peruvianum [Peruvian tomato]
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    236   3e-68   Solanum tuberosum [potatoes]
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    234   1e-67   Sesamum indicum [beniseed]
emb|CDP02660.1|  unnamed protein product                                232   5e-67   Coffea canephora [robusta coffee]
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    231   1e-66   Nicotiana tomentosiformis
ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    230   3e-66   Solanum tuberosum [potatoes]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    230   3e-66   Solanum lycopersicum
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    228   2e-65   Sesamum indicum [beniseed]
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    228   2e-65   Nelumbo nucifera [Indian lotus]
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    226   6e-65   Nicotiana sylvestris
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    225   2e-64   Nicotiana sylvestris
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    224   7e-64   Nelumbo nucifera [Indian lotus]
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    222   3e-63   Nicotiana tomentosiformis
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    221   4e-63   Dimocarpus longan [longan]
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    221   5e-63   Pyrus x bretschneideri [bai li]
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                221   6e-63   Erythranthe guttata [common monkey flower]
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    219   4e-62   Morus notabilis
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    218   5e-62   Pyrus x bretschneideri [bai li]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    218   5e-62   
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             217   2e-61   Prunus persica
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    216   3e-61   
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    215   8e-61   
emb|CBI35733.3|  unnamed protein product                                213   2e-60   Vitis vinifera
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    213   4e-60   Vitis vinifera
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    209   8e-59   Citrus sinensis [apfelsine]
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   209   8e-59   Citrus sinensis [apfelsine]
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             209   8e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             209   8e-59   Citrus clementina [clementine]
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           208   2e-58   
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    206   1e-57   Fragaria vesca subsp. vesca
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         204   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             204   5e-57   
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    203   2e-56   Arabis alpina [alpine rockcress]
gb|EPS74129.1|  hypothetical protein M569_00625                         202   3e-56   Genlisea aurea
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           202   4e-56   Glycine max [soybeans]
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    202   4e-56   
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             201   6e-56   Capsella rubella
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    201   6e-56   Eucalyptus grandis [rose gum]
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             200   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    200   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    199   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    199   5e-55   Camelina sativa [gold-of-pleasure]
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    198   8e-55   Cicer arietinum [garbanzo]
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    198   8e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    198   9e-55   Camelina sativa [gold-of-pleasure]
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    198   1e-54   Populus euphratica
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    197   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             197   2e-54   
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         197   2e-54   Jatropha curcas
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    197   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             197   2e-54   Capsella rubella
gb|KJB18113.1|  hypothetical protein B456_003G034400                    197   3e-54   Gossypium raimondii
gb|KJB18115.1|  hypothetical protein B456_003G034500                    197   3e-54   Gossypium raimondii
gb|KJB48795.1|  hypothetical protein B456_008G087500                    196   4e-54   Gossypium raimondii
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    196   6e-54   Cucumis sativus [cucumbers]
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    196   6e-54   Brassica rapa
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             196   7e-54   
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    196   8e-54   Gossypium arboreum [tree cotton]
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    195   1e-53   Gossypium arboreum [tree cotton]
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    194   3e-53   
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    193   6e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           192   2e-52   Glycine max [soybeans]
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    192   2e-52   Camelina sativa [gold-of-pleasure]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    191   3e-52   Arabis alpina [alpine rockcress]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    190   1e-51   Ricinus communis
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             190   1e-51   Phaseolus vulgaris [French bean]
ref|NP_001237688.1|  receptor-like protein kinase precursor             189   2e-51   Glycine max [soybeans]
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    185   5e-50   
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    184   9e-50   Brassica rapa
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    184   1e-49   Elaeis guineensis
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    184   1e-49   Elaeis guineensis
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    184   2e-49   
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    182   4e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    182   5e-49   Tarenaya hassleriana [spider flower]
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    181   1e-48   Cucumis melo [Oriental melon]
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          180   2e-48   
gb|AES94465.2|  LRR receptor-like kinase family protein                 178   1e-47   Medicago truncatula
ref|XP_003611507.1|  Receptor-like protein kinase                       179   1e-47   
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    178   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             176   6e-47   Phaseolus vulgaris [French bean]
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    176   8e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    176   9e-47   
emb|CDY08759.1|  BnaA06g24650D                                          173   8e-46   Brassica napus [oilseed rape]
gb|ADB85326.1|  putative receptor protein kinase                        164   1e-45   Phyllostachys edulis [kikko-chiku]
ref|XP_003608587.1|  Receptor-like protein kinase                       171   5e-45   Medicago truncatula
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    170   9e-45   Phoenix dactylifera
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    169   3e-44   
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    167   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010675918.1|  PREDICTED: leucine-rich repeat receptor-like...    166   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    162   7e-42   Phoenix dactylifera
dbj|BAJ84911.1|  predicted protein                                      162   8e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    162   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...    157   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    156   8e-40   Oryza brachyantha
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690          155   1e-39   Sorghum bicolor [broomcorn]
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...    155   1e-39   Zea mays [maize]
ref|NP_001058840.2|  Os07g0134200                                       155   1e-39   
ref|XP_010685023.1|  PREDICTED: receptor-like protein 12                154   1e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|EAZ02682.1|  hypothetical protein OsI_24796                          155   2e-39   Oryza sativa Indica Group [Indian rice]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)          155   2e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...    155   2e-39   Cucumis melo [Oriental melon]
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    154   4e-39   
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...    154   4e-39   Cucumis sativus [cucumbers]
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...    154   5e-39   
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...    153   1e-38   Setaria italica
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    152   2e-38   
emb|CDY02112.1|  BnaA03g40550D                                          151   3e-38   
emb|CDY23037.1|  BnaC07g31500D                                          150   1e-37   Brassica napus [oilseed rape]
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...    150   1e-37   
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450          149   3e-37   Sorghum bicolor [broomcorn]
emb|CDY45620.1|  BnaCnng13280D                                          146   2e-36   Brassica napus [oilseed rape]
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...    146   3e-36   
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470          145   5e-36   Amborella trichopoda
gb|AHJ14779.1|  CLAVATA1                                                145   5e-36   Rhododendron ovatum
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783             145   6e-36   
dbj|BAJ89729.1|  predicted protein                                      145   7e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...    143   2e-35   Populus euphratica
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...    143   2e-35   Brachypodium distachyon [annual false brome]
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1        143   4e-35   
gb|ABF99108.1|  Receptor protein kinase CLAVATA1 precursor, putat...    142   4e-35   Oryza sativa Japonica Group [Japonica rice]
gb|AAP68887.1|  putative receptor-like protein kinase 1                 143   4e-35   Oryza sativa Japonica Group [Japonica rice]
gb|EAY92008.1|  hypothetical protein OsI_13698                          142   4e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_002307734.1|  receptor protein kinase                            142   4e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...    142   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...    142   8e-35   
gb|EEE60014.1|  hypothetical protein OsJ_12761                          140   2e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AAF73373.1|AF193835_1  LRK1 protein                                  139   5e-34   Oryza sativa [red rice]
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...    139   5e-34   
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...    139   6e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...    139   7e-34   
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...    139   1e-33   
ref|XP_009399076.1|  PREDICTED: leucine-rich repeat receptor-like...    139   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...    138   1e-33   Fragaria vesca subsp. vesca
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...    138   2e-33   Phoenix dactylifera
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...    137   4e-33   
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg             137   5e-33   Prunus persica
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...    136   6e-33   
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...    136   6e-33   Brassica rapa
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...    136   9e-33   Populus euphratica
gb|KEH33614.1|  LRR receptor-like kinase family protein                 136   9e-33   Medicago truncatula
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1        135   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...    135   1e-32   Setaria italica
ref|XP_011004295.1|  PREDICTED: leucine-rich repeat receptor-like...    135   1e-32   Populus euphratica
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1        135   1e-32   Malus domestica [apple tree]
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...    135   2e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...    135   2e-32   
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...    135   2e-32   Cicer arietinum [garbanzo]
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250          135   2e-32   
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1        135   2e-32   Fragaria vesca subsp. vesca
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738             134   3e-32   
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                    134   3e-32   Arabis alpina [alpine rockcress]
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...    134   3e-32   
ref|XP_002300697.2|  receptor protein kinase                            134   3e-32   
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...    134   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...    134   4e-32   Vitis vinifera
gb|KDP36903.1|  hypothetical protein JCGZ_08194                         134   5e-32   Jatropha curcas
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg             134   5e-32   Capsella rubella
gb|KJB29653.1|  hypothetical protein B456_005G112100                    134   6e-32   Gossypium raimondii
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...    133   7e-32   Prunus mume [ume]
emb|CDX73202.1|  BnaC06g36500D                                          133   9e-32   
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...    133   9e-32   Elaeis guineensis
emb|CDX87661.1|  BnaA07g32120D                                          132   1e-31   
emb|CDP04113.1|  unnamed protein product                                132   1e-31   Coffea canephora [robusta coffee]
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg             132   1e-31   Citrus clementina [clementine]
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                   132   1e-31   Citrus sinensis [apfelsine]
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...    132   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009393965.1|  PREDICTED: leucine-rich repeat receptor-like...    130   2e-31   
ref|XP_010246813.1|  PREDICTED: receptor protein kinase CLAVATA1-...    132   2e-31   Nelumbo nucifera [Indian lotus]
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...    132   2e-31   Brachypodium distachyon [annual false brome]
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1        132   2e-31   Brassica rapa
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg             131   3e-31   Eutrema salsugineum [saltwater cress]
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...    131   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...    131   3e-31   Citrus sinensis [apfelsine]
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...    131   5e-31   Pyrus x bretschneideri [bai li]
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...    131   5e-31   Ricinus communis
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...    130   6e-31   
gb|ADD64789.1|  CLAVATA1                                                130   6e-31   Brassica napus [oilseed rape]
gb|AAP49010.1|  CLV1-like receptor kinase                               130   7e-31   Brassica napus [oilseed rape]
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...    130   7e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...    130   8e-31   Populus euphratica
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                        130   1e-30   Gossypium arboreum [tree cotton]
ref|XP_006448558.1|  hypothetical protein CICLE_v10014145mg             130   1e-30   Citrus clementina [clementine]
ref|XP_011035024.1|  PREDICTED: receptor protein kinase CLAVATA1-...    129   2e-30   Populus euphratica
ref|XP_008647500.1|  PREDICTED: uncharacterized LOC100272700 isof...    129   2e-30   
ref|XP_008647501.1|  PREDICTED: uncharacterized LOC100272700 isof...    129   2e-30   Zea mays [maize]
ref|XP_008647502.1|  PREDICTED: uncharacterized LOC100272700 isof...    129   2e-30   
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg             129   2e-30   Eutrema salsugineum [saltwater cress]
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1        129   2e-30   Vitis vinifera
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg             129   2e-30   Capsella rubella
emb|CBI19895.3|  unnamed protein product                                129   2e-30   Vitis vinifera
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...    129   2e-30   Populus euphratica
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...    129   2e-30   Elaeis guineensis
emb|CAN71863.1|  hypothetical protein VITISV_023530                     129   3e-30   Vitis vinifera
ref|XP_008349109.1|  PREDICTED: leucine-rich repeat receptor-like...    129   3e-30   Malus domestica [apple tree]
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...    129   3e-30   Vitis vinifera
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1        128   3e-30   
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729             129   3e-30   
emb|CBI29704.3|  unnamed protein product                                128   3e-30   Vitis vinifera
ref|XP_010110004.1|  Receptor protein kinase CLAVATA1                   128   4e-30   
ref|XP_002441645.1|  hypothetical protein SORBIDRAFT_09g030870          128   5e-30   Sorghum bicolor [broomcorn]
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...    128   5e-30   Phoenix dactylifera
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1        128   5e-30   Solanum lycopersicum
gb|AAB58929.1|  CLV1 receptor kinase                                    128   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAD02501.1|  receptor kinase                                         128   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177710.1|  receptor protein kinase CLAVATA1                      128   6e-30   Arabidopsis thaliana [mouse-ear cress]
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana          128   6e-30
ref|XP_006468612.1|  PREDICTED: leucine-rich repeat receptor-like...    127   7e-30   Citrus sinensis [apfelsine]
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg             127   1e-29   
ref|XP_006468613.1|  PREDICTED: leucine-rich repeat receptor-like...    127   1e-29   Citrus sinensis [apfelsine]
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...    127   1e-29   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                     126   2e-29   Eucalyptus grandis [rose gum]
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1        126   2e-29   Eucalyptus grandis [rose gum]
gb|KJB59753.1|  hypothetical protein B456_009G269700                    124   2e-29   Gossypium raimondii
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...    126   2e-29   
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143             126   2e-29   
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284             126   3e-29   
emb|CDP07377.1|  unnamed protein product                                125   4e-29   Coffea canephora [robusta coffee]
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1        125   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_007131794.1|  hypothetical protein PHAVU_011G042100g             124   5e-29   Phaseolus vulgaris [French bean]
ref|XP_003530709.1|  PREDICTED: leucine-rich repeat receptor-like...    125   5e-29   Glycine max [soybeans]
ref|XP_010449207.1|  PREDICTED: leucine-rich repeat receptor-like...    125   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_011092305.1|  PREDICTED: leucine-rich repeat receptor-like...    125   6e-29   Sesamum indicum [beniseed]
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...    125   6e-29   Pyrus x bretschneideri [bai li]
ref|XP_010439602.1|  PREDICTED: leucine-rich repeat receptor-like...    124   9e-29   Camelina sativa [gold-of-pleasure]
ref|XP_007041221.1|  Leucine-rich receptor-like protein kinase fa...    124   1e-28   
ref|XP_010676066.1|  PREDICTED: LRR receptor-like serine/threonin...    123   2e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002532709.1|  Receptor protein kinase CLAVATA1 precursor, ...    124   2e-28   Ricinus communis
ref|XP_010030176.1|  PREDICTED: leucine-rich repeat receptor-like...    123   2e-28   Eucalyptus grandis [rose gum]
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...    123   2e-28   Elaeis guineensis
ref|XP_009345734.1|  PREDICTED: putative receptor-like protein ki...    123   2e-28   Pyrus x bretschneideri [bai li]
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1        123   2e-28   Sesamum indicum [beniseed]
gb|KDP23869.1|  hypothetical protein JCGZ_27138                         123   2e-28   Jatropha curcas
ref|NP_001174552.1|  Os05g0595950                                       123   3e-28   
gb|EEC79804.1|  hypothetical protein OsI_21242                          123   3e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_004155230.1|  PREDICTED: leucine-rich repeat receptor-like...    122   4e-28   
ref|XP_010668145.1|  PREDICTED: receptor protein kinase CLAVATA1-...    121   4e-28   
gb|KJB32927.1|  hypothetical protein B456_005G268400                    122   4e-28   Gossypium raimondii
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...    122   4e-28   Tarenaya hassleriana [spider flower]
ref|XP_006655663.1|  PREDICTED: leucine-rich repeat receptor-like...    122   5e-28   Oryza brachyantha
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...    122   5e-28   
ref|XP_007131793.1|  hypothetical protein PHAVU_011G042000g             122   5e-28   Phaseolus vulgaris [French bean]
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...    122   6e-28   
gb|AIT55304.1|  nodulation autoregulation receptor kinase               122   6e-28   Phaseolus vulgaris [French bean]
gb|KJB58082.1|  hypothetical protein B456_009G193600                    122   7e-28   Gossypium raimondii
ref|XP_011028346.1|  PREDICTED: leucine-rich repeat receptor-like...    122   8e-28   Populus euphratica
ref|XP_009603651.1|  PREDICTED: leucine-rich repeat receptor-like...    121   9e-28   Nicotiana tomentosiformis
ref|XP_004230451.1|  PREDICTED: leucine-rich repeat receptor-like...    121   9e-28   Solanum lycopersicum
gb|KHG26020.1|  Receptor protein kinase CLAVATA1                        121   9e-28   Gossypium arboreum [tree cotton]
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...    121   1e-27   Glycine max [soybeans]
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                          121   1e-27   Silene latifolia
ref|XP_004150938.1|  PREDICTED: leucine-rich repeat receptor-like...    121   2e-27   Cucumis sativus [cucumbers]
ref|XP_002869943.1|  hypothetical protein ARALYDRAFT_492844             120   2e-27   
ref|XP_010671767.1|  PREDICTED: receptor protein kinase CLAVATA1        120   2e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_193760.1|  leucine-rich receptor-like protein kinase BAM3        120   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ACN59341.1|  leucine-rich repeat receptor-like protein kinase        120   2e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KHG23359.1|  Leucine-rich repeat receptor-like serine/threonin...    120   2e-27   Gossypium arboreum [tree cotton]
ref|XP_007220284.1|  hypothetical protein PRUPE_ppa000681mg             120   3e-27   Prunus persica
gb|KJB16198.1|  hypothetical protein B456_002G217000                    119   3e-27   Gossypium raimondii
ref|XP_008234497.1|  PREDICTED: leucine-rich repeat receptor-like...    120   3e-27   Prunus mume [ume]
gb|KCW62729.1|  hypothetical protein EUGRSUZ_G00319                     120   4e-27   Eucalyptus grandis [rose gum]
ref|XP_010065309.1|  PREDICTED: leucine-rich repeat receptor-like...    120   4e-27   Eucalyptus grandis [rose gum]
emb|CAD42335.1|  hypernodulation aberrant root formation protein        119   4e-27   Lotus japonicus
ref|XP_008351784.1|  PREDICTED: putative receptor-like protein ki...    119   5e-27   
ref|XP_010243899.1|  PREDICTED: leucine-rich repeat receptor-like...    119   5e-27   Nelumbo nucifera [Indian lotus]
gb|ACH59593.1|  LRR receptor-like protein kinase                        110   5e-27   Pseudotsuga menziesii
ref|XP_010243895.1|  PREDICTED: leucine-rich repeat receptor-like...    119   5e-27   Nelumbo nucifera [Indian lotus]
gb|KJB16199.1|  hypothetical protein B456_002G217000                    119   6e-27   Gossypium raimondii
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...    119   6e-27   Nicotiana sylvestris
ref|XP_010277679.1|  PREDICTED: LRR receptor-like serine/threonin...    119   7e-27   Nelumbo nucifera [Indian lotus]
ref|XP_011087678.1|  PREDICTED: leucine-rich repeat receptor-like...    119   8e-27   
gb|ACH59600.1|  LRR receptor-like protein kinase                        110   8e-27   Pseudotsuga menziesii
ref|XP_008452253.1|  PREDICTED: leucine-rich repeat receptor-like...    119   8e-27   Cucumis melo [Oriental melon]
ref|XP_010026766.1|  PREDICTED: putative receptor-like protein ki...    119   9e-27   
gb|KCW60108.1|  hypothetical protein EUGRSUZ_H02842                     118   1e-26   Eucalyptus grandis [rose gum]
gb|KHG17337.1|  Leucine-rich repeat receptor-like serine/threonin...    118   1e-26   Gossypium arboreum [tree cotton]
ref|XP_006385034.1|  hypothetical protein POPTR_0004s23260g             118   1e-26   Populus trichocarpa [western balsam poplar]
ref|NP_001238576.1|  receptor protein kinase-like protein precursor     118   1e-26   Glycine max [soybeans]
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...    118   2e-26   
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...    118   2e-26   
ref|XP_002526889.1|  serine-threonine protein kinase, plant-type,...    117   2e-26   
gb|KDO44093.1|  hypothetical protein CISIN_1g001922mg                   118   2e-26   
gb|EPS62062.1|  protein kinase                                          118   2e-26   
ref|XP_006492589.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-26   
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-26   
ref|XP_007146301.1|  hypothetical protein PHAVU_006G029000g             117   2e-26   
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-26   
gb|EYU26470.1|  hypothetical protein MIMGU_mgv1a019834mg                117   2e-26   
ref|XP_006602289.1|  PREDICTED: leucine-rich repeat receptor-like...    117   3e-26   
dbj|BAC41332.1|  LRR receptor-like kinase                               117   3e-26   
ref|XP_009340605.1|  PREDICTED: leucine-rich repeat receptor-like...    117   3e-26   
ref|XP_006663536.1|  PREDICTED: probable LRR receptor-like serine...    117   3e-26   
ref|XP_010690942.1|  PREDICTED: probable LRR receptor-like serine...    117   3e-26   
ref|NP_001238004.1|  receptor protein kinase-like protein precursor     117   3e-26   
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...    117   3e-26   
gb|EMT21473.1|  Putative LRR receptor-like serine/threonine-prote...    117   4e-26   
ref|XP_007224667.1|  hypothetical protein PRUPE_ppa026134mg             117   4e-26   
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...    117   5e-26   
emb|CDO97616.1|  unnamed protein product                                116   6e-26   
gb|KDP42443.1|  hypothetical protein JCGZ_00240                         116   6e-26   
dbj|BAJ99137.1|  predicted protein                                      116   6e-26   
ref|XP_008233100.1|  PREDICTED: receptor protein kinase CLAVATA1-...    116   6e-26   
ref|XP_006431638.1|  hypothetical protein CICLE_v10000148mg             116   8e-26   
gb|KEH37840.1|  LRR receptor-like kinase family protein                 115   9e-26   
emb|CAN71566.1|  hypothetical protein VITISV_016304                     112   1e-25   
gb|KJB47871.1|  hypothetical protein B456_008G045400                    115   1e-25   
ref|XP_006382632.1|  hypothetical protein POPTR_0005s03970g             115   1e-25   
ref|XP_009372861.1|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-25   
ref|XP_009374467.1|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-25   
ref|XP_009370509.1|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-25   
ref|XP_002529272.1|  serine-threonine protein kinase, plant-type,...    115   1e-25   
ref|XP_009787949.1|  PREDICTED: leucine-rich repeat receptor-like...    115   1e-25   
ref|XP_002962293.1|  hypothetical protein SELMODRAFT_77558              115   1e-25   
ref|XP_008355553.1|  PREDICTED: probable LRR receptor-like serine...    115   1e-25   
ref|XP_008369397.1|  PREDICTED: putative receptor-like protein ki...    114   1e-25   
ref|XP_007213482.1|  hypothetical protein PRUPE_ppa023389mg             115   2e-25   
ref|XP_008345324.1|  PREDICTED: putative receptor-like protein ki...    115   2e-25   
gb|EYU30632.1|  hypothetical protein MIMGU_mgv1a022995mg                111   2e-25   
ref|XP_008376399.1|  PREDICTED: leucine-rich repeat receptor-like...    115   2e-25   
ref|XP_008786484.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    115   2e-25   
ref|XP_009369178.1|  PREDICTED: putative receptor-like protein ki...    115   2e-25   
ref|XP_011019593.1|  PREDICTED: probably inactive leucine-rich re...    115   2e-25   
ref|XP_009403711.1|  PREDICTED: leucine-rich repeat receptor-like...    115   2e-25   
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                        115   2e-25   
ref|XP_006356981.1|  PREDICTED: leucine-rich repeat receptor-like...    115   2e-25   
ref|XP_002308597.2|  hypothetical protein POPTR_0006s25380g             114   2e-25   
ref|XP_008791706.1|  PREDICTED: putative receptor-like protein ki...    114   2e-25   
ref|XP_010687839.1|  PREDICTED: leucine-rich repeat receptor-like...    114   2e-25   
ref|XP_002965214.1|  hypothetical protein SELMODRAFT_83051              114   2e-25   
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...    114   3e-25   
ref|XP_006590881.1|  PREDICTED: receptor protein kinase CLAVATA1-...    113   3e-25   
ref|XP_009415664.1|  PREDICTED: leucine-rich repeat receptor-like...    114   3e-25   
ref|XP_008369385.1|  PREDICTED: putative receptor-like protein ki...    114   3e-25   
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...    114   4e-25   
ref|NP_001048946.2|  Os03g0145000                                       114   4e-25   
gb|KJB73883.1|  hypothetical protein B456_011G2584002                   108   4e-25   
emb|CDP18494.1|  unnamed protein product                                114   4e-25   
ref|XP_009353760.1|  PREDICTED: leucine-rich repeat receptor-like...    114   5e-25   
ref|XP_011035599.1|  PREDICTED: probable LRR receptor-like serine...    114   5e-25   
gb|EAY88517.1|  hypothetical protein OsI_09989                          113   6e-25   
ref|XP_004229499.1|  PREDICTED: leucine-rich repeat receptor-like...    113   6e-25   
ref|XP_008812886.1|  PREDICTED: probable LRR receptor-like serine...    114   6e-25   
gb|AAW71475.1|  CLV1-like receptor kinase                               113   6e-25   
gb|EYU38789.1|  hypothetical protein MIMGU_mgv1a000850mg                113   6e-25   
ref|XP_010907375.1|  PREDICTED: probable LRR receptor-like serine...    113   6e-25   
ref|XP_010269666.1|  PREDICTED: probable LRR receptor-like serine...    113   7e-25   
ref|XP_010667968.1|  PREDICTED: leucine-rich repeat receptor-like...    113   7e-25   
ref|XP_010058160.1|  PREDICTED: putative receptor-like protein ki...    112   7e-25   
ref|XP_003606987.1|  CLV1-like receptor kinase                          112   8e-25   
gb|AAX14781.1|  RLP1 leucine-rich repeat receptor-like protein          112   8e-25   
ref|XP_008803980.1|  PREDICTED: leucine-rich repeat receptor-like...    113   8e-25   
gb|KCW71731.1|  hypothetical protein EUGRSUZ_E00238                     113   8e-25   
ref|XP_008339390.1|  PREDICTED: leucine-rich repeat receptor-like...    113   8e-25   
gb|KEH29416.1|  LRR receptor-like kinase family protein                 113   8e-25   
ref|XP_008375993.1|  PREDICTED: leucine-rich repeat receptor-like...    113   9e-25   
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...    112   1e-24   
ref|XP_006645505.1|  PREDICTED: putative receptor-like protein ki...    112   1e-24   
gb|EYU40960.1|  hypothetical protein MIMGU_mgv1a018813mg                112   1e-24   
ref|XP_002305057.2|  hypothetical protein POPTR_0004s05880g             112   1e-24   
ref|XP_008218726.1|  PREDICTED: leucine-rich repeat receptor-like...    112   1e-24   
ref|XP_009409684.1|  PREDICTED: putative receptor-like protein ki...    113   1e-24   
ref|XP_008369236.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-24   
dbj|BAJ95144.1|  predicted protein                                      112   1e-24   
ref|XP_008224399.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-24   
ref|XP_010675938.1|  PREDICTED: LRR receptor-like serine/threonin...    112   1e-24   
ref|XP_003539668.1|  PREDICTED: leucine-rich repeat receptor-like...    112   1e-24   
ref|XP_007214129.1|  hypothetical protein PRUPE_ppa018020mg             112   2e-24   
ref|XP_010026767.1|  PREDICTED: probable LRR receptor-like serine...    112   2e-24   
ref|XP_009401113.1|  PREDICTED: leucine-rich repeat receptor-like...    112   2e-24   
emb|CAD42181.1|  serine-threonine protein kinase                        112   2e-24   
ref|XP_008223875.1|  PREDICTED: probable LRR receptor-like serine...    112   2e-24   
ref|XP_010064788.1|  PREDICTED: putative receptor-like protein ki...    112   2e-24   
ref|XP_004952135.1|  PREDICTED: leucine-rich repeat receptor-like...    112   2e-24   
gb|KHG13927.1|  Leucine-rich repeat receptor-like serine/threonin...    112   2e-24   
ref|XP_002268598.2|  PREDICTED: leucine-rich repeat receptor-like...    112   2e-24   
ref|XP_008369395.1|  PREDICTED: probable LRR receptor-like serine...    112   2e-24   
ref|XP_009409686.1|  PREDICTED: putative receptor-like protein ki...    112   2e-24   
gb|KCW69037.1|  hypothetical protein EUGRSUZ_F02592                     112   2e-24   
ref|XP_010911433.1|  PREDICTED: putative receptor-like protein ki...    108   2e-24   
ref|XP_006382044.1|  hypothetical protein POPTR_0006s25380g             111   2e-24   
ref|XP_002303493.2|  hypothetical protein POPTR_0003s10680g             112   2e-24   
emb|CDY26403.1|  BnaA02g23670D                                          111   2e-24   
ref|XP_010257102.1|  PREDICTED: putative receptor-like protein ki...    111   3e-24   
tpg|DAA44225.1|  TPA: putative leucine-rich repeat receptor-like ...    111   3e-24   
ref|XP_010256508.1|  PREDICTED: probable LRR receptor-like serine...    111   3e-24   
ref|XP_003625388.1|  Receptor-like protein kinase                       111   3e-24   
emb|CAN65889.1|  hypothetical protein VITISV_030571                     110   3e-24   
gb|KJB73885.1|  hypothetical protein B456_011G258600                    111   4e-24   
ref|XP_008377848.1|  PREDICTED: receptor protein kinase CLAVATA1-...    111   4e-24   
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    110   4e-24   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...    111   4e-24   
gb|EYU21706.1|  hypothetical protein MIMGU_mgv1a023669mg                111   4e-24   
ref|XP_010520745.1|  PREDICTED: putative receptor-like protein ki...    111   4e-24   
ref|XP_008223897.1|  PREDICTED: probable LRR receptor-like serine...    111   4e-24   
gb|KJB73887.1|  hypothetical protein B456_011G258900                    108   5e-24   
emb|CBI25249.3|  unnamed protein product                                111   5e-24   
ref|XP_008347921.1|  PREDICTED: leucine-rich repeat receptor-like...    110   5e-24   
ref|XP_007131359.1|  hypothetical protein PHAVU_011G007200g             110   5e-24   
ref|XP_006493473.1|  PREDICTED: putative leucine-rich repeat rece...    110   5e-24   
gb|KJB53046.1|  hypothetical protein B456_008G290200                    110   6e-24   
emb|CDY36706.1|  BnaC02g31270D                                          110   6e-24   
gb|EEC68365.1|  hypothetical protein OsI_36500                          108   7e-24   
emb|CDX92460.1|  BnaA10g14990D                                          110   7e-24   
ref|XP_008370076.1|  PREDICTED: probable LRR receptor-like serine...    110   7e-24   
ref|XP_004966471.1|  PREDICTED: leucine-rich repeat receptor-like...    110   7e-24   
ref|XP_006490053.1|  PREDICTED: probably inactive leucine-rich re...    110   7e-24   
ref|XP_003606988.1|  Receptor protein kinase CLAVATA1                   110   8e-24   
ref|XP_004955796.1|  PREDICTED: probable LRR receptor-like serine...    110   8e-24   
ref|XP_006423117.1|  hypothetical protein CICLE_v10027688mg             110   8e-24   
gb|KJB51410.1|  hypothetical protein B456_008G215400                    110   8e-24   
ref|XP_004983327.1|  PREDICTED: leucine-rich repeat receptor-like...    107   8e-24   
ref|XP_009123620.1|  PREDICTED: putative receptor-like protein ki...    110   9e-24   
gb|EPS70741.1|  hypothetical protein M569_04011                         110   9e-24   
ref|XP_006421471.1|  hypothetical protein CICLE_v10004276mg             110   9e-24   
ref|XP_009355307.1|  PREDICTED: leucine-rich repeat receptor-like...    110   9e-24   
gb|KJB51409.1|  hypothetical protein B456_008G215400                    110   9e-24   
ref|XP_009377741.1|  PREDICTED: probable LRR receptor-like serine...    110   9e-24   
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    109   1e-23   
ref|XP_010064760.1|  PREDICTED: probable leucine-rich repeat rece...    106   1e-23   
gb|EYU21721.1|  hypothetical protein MIMGU_mgv1a019783mg                110   1e-23   
gb|KHG14208.1|  Leucine-rich repeat receptor-like serine/threonin...    110   1e-23   
gb|EYU26654.1|  hypothetical protein MIMGU_mgv1a001213mg                109   1e-23   
gb|KJB32855.1|  hypothetical protein B456_005G265400                    109   1e-23   
ref|XP_010655183.1|  PREDICTED: putative receptor-like protein ki...    109   1e-23   
ref|XP_006427668.1|  hypothetical protein CICLE_v10027227mg             109   1e-23   
emb|CBI21262.3|  unnamed protein product                                107   1e-23   
ref|XP_011006423.1|  PREDICTED: probably inactive leucine-rich re...    109   1e-23   
ref|XP_010693707.1|  PREDICTED: leucine-rich repeat receptor-like...    109   1e-23   
ref|XP_006649672.1|  PREDICTED: leucine-rich repeat receptor-like...    109   1e-23   
ref|XP_004143021.1|  PREDICTED: probable LRR receptor-like serine...    109   1e-23   
ref|XP_006349327.1|  PREDICTED: leucine-rich repeat receptor-like...    109   1e-23   
gb|KJB73894.1|  hypothetical protein B456_011G259500                    109   1e-23   
ref|XP_003614937.1|  Somatic embryogenesis receptor kinase              106   2e-23   
gb|KGN62467.1|  hypothetical protein Csa_2G354930                       109   2e-23   
gb|KJB73884.1|  hypothetical protein B456_011G258500                    109   2e-23   
ref|XP_010934709.1|  PREDICTED: leucine-rich repeat receptor-like...    109   2e-23   
ref|XP_004136488.1|  PREDICTED: receptor protein kinase CLAVATA1-...    109   2e-23   
ref|XP_011027952.1|  PREDICTED: leucine-rich repeat receptor-like...    109   2e-23   
ref|XP_008466473.1|  PREDICTED: receptor protein kinase CLAVATA1        109   2e-23   
ref|XP_010262819.1|  PREDICTED: putative receptor-like protein ki...    109   2e-23   
gb|KJB45801.1|  hypothetical protein B456_007G329200                    104   2e-23   
ref|XP_011470626.1|  PREDICTED: LRR receptor-like serine/threonin...    105   2e-23   
ref|XP_010269665.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-23   
ref|XP_010939071.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-23   
ref|XP_006279948.1|  hypothetical protein CARUB_v10025818mg             108   2e-23   
gb|EEC68386.1|  hypothetical protein OsI_36534                          108   2e-23   
ref|XP_004979517.1|  PREDICTED: putative receptor-like protein ki...    108   2e-23   
ref|XP_010941424.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-23   
ref|NP_001068120.1|  Os11g0570000                                       107   3e-23   
ref|XP_006368235.1|  hypothetical protein POPTR_0001s00820g             108   3e-23   
ref|XP_007021924.1|  Serine-threonine protein kinase                    105   3e-23   
ref|XP_010536545.1|  PREDICTED: leucine-rich repeat receptor-like...    108   3e-23   
ref|XP_008225333.1|  PREDICTED: probable LRR receptor-like serine...    108   3e-23   
ref|XP_010064793.1|  PREDICTED: putative receptor-like protein ki...    107   3e-23   
ref|XP_009351379.1|  PREDICTED: probable LRR receptor-like serine...    105   3e-23   
gb|AAB82755.1|  receptor kinase-like protein                            108   3e-23   
ref|XP_010910648.1|  PREDICTED: putative receptor-like protein ki...    105   3e-23   
ref|XP_008369392.1|  PREDICTED: putative receptor-like protein ki...    108   3e-23   
ref|XP_004985730.1|  PREDICTED: leucine-rich repeat receptor-like...    108   4e-23   
ref|XP_004309032.2|  PREDICTED: probable LRR receptor-like serine...    108   4e-23   
ref|XP_010257264.1|  PREDICTED: probably inactive leucine-rich re...    108   4e-23   
ref|XP_008392992.1|  PREDICTED: putative receptor-like protein ki...    108   4e-23   
ref|XP_010050671.1|  PREDICTED: putative receptor-like protein ki...    108   4e-23   
gb|KCW80214.1|  hypothetical protein EUGRSUZ_C01568                     108   4e-23   
ref|XP_004501144.1|  PREDICTED: probably inactive leucine-rich re...    108   4e-23   
gb|EEC69970.1|  hypothetical protein OsI_00442                          108   4e-23   
ref|XP_006830605.1|  hypothetical protein AMTR_s00120p00057210          107   4e-23   
gb|KCW69044.1|  hypothetical protein EUGRSUZ_F02602                     107   4e-23   
gb|EEC66712.1|  hypothetical protein OsI_33040                          108   5e-23   
gb|KHN32430.1|  Leucine-rich repeat receptor-like protein kinase TDR    106   5e-23   
ref|XP_004507478.1|  PREDICTED: LOW QUALITY PROTEIN: receptor pro...    108   5e-23   
ref|XP_008385914.1|  PREDICTED: probable LRR receptor-like serine...    108   5e-23   
ref|XP_002527461.1|  serine-threonine protein kinase, plant-type,...    107   5e-23   
emb|CDP21987.1|  unnamed protein product                                106   5e-23   
gb|EEC70577.1|  hypothetical protein OsI_01776                          107   5e-23   
ref|XP_002324214.1|  leucine-rich repeat transmembrane protein ki...    107   6e-23   
ref|XP_011024490.1|  PREDICTED: leucine-rich repeat receptor-like...    107   6e-23   
gb|EYU36796.1|  hypothetical protein MIMGU_mgv1a020841mg                107   6e-23   
ref|XP_007028891.1|  Receptor protein kinase CLAVATA1, putative         107   6e-23   
gb|KCW80480.1|  hypothetical protein EUGRSUZ_C018221                    103   6e-23   
ref|XP_009592786.1|  PREDICTED: receptor protein kinase CLAVATA1        107   6e-23   
gb|AAB82756.1|  receptor kinase-like protein                            107   6e-23   
ref|XP_006587703.1|  PREDICTED: leucine-rich repeat receptor-like...    107   6e-23   
dbj|BAJ98758.1|  predicted protein                                      107   7e-23   
gb|AAC78595.1|  Hcr2-5B                                                 107   7e-23   
ref|XP_010664968.1|  PREDICTED: probable LRR receptor-like serine...    107   7e-23   
gb|KJB11032.1|  hypothetical protein B456_001G237400                    107   7e-23   
ref|XP_002965235.1|  hypothetical protein SELMODRAFT_82697              107   7e-23   
ref|XP_010441796.1|  PREDICTED: putative receptor-like protein ki...    107   7e-23   
ref|XP_002510975.1|  Receptor protein kinase CLAVATA1 precursor, ...    107   8e-23   
ref|XP_008385922.1|  PREDICTED: LRR receptor-like serine/threonin...    107   8e-23   
gb|AFY06667.1|  receptor protein kinase CLAVATA1                        107   8e-23   
gb|AAX19029.1|  Hcr2-p6                                                 104   8e-23   
ref|XP_010321824.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...    107   9e-23   
ref|XP_008444584.1|  PREDICTED: probable LRR receptor-like serine...    107   9e-23   
ref|NP_001058593.1|  Os06g0717200                                       107   9e-23   
gb|AAC78593.1|  Hcr2-0B                                                 107   9e-23   
ref|XP_009357702.1|  PREDICTED: probable LRR receptor-like serine...    107   1e-22   
ref|XP_002875847.1|  hypothetical protein ARALYDRAFT_347851             107   1e-22   



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   240 bits (613),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  261
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  131

Query  442  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  621
             QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+FSGRIPPEYGRFP+LEYL
Sbjct  132  SQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFSGRIPPEYGRFPSLEYL  191

Query  622  AVSGNGL  642
            AVSGN L
Sbjct  192  AVSGNAL  198


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGKIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  307  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNK  366

Query  640  L  642
            L
Sbjct  367  L  367


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  637  GL  642
             L
Sbjct  390  FL  391


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  545

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  546  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  604


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 68/146 (47%), Gaps = 25/146 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------N  408
             SG + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 N
Sbjct  174  FSGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGN  233

Query  409  LS--------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
            LS        N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N
Sbjct  234  LSQLLRFDAANCGLSGKIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNN  293

Query  565  YFSGRIPPEYGRFPNLEYLAVSGNGL  642
             FSG IPP +    N+  + +  N L
Sbjct  294  MFSGEIPPTFAELKNITLVNLFRNKL  319


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  450

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L  +  S N 
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  510

Query  640  L  642
            L
Sbjct  511  L  511


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  517

Query  517  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            E+ +   L ++ L  N  SG IP E      L YL +S N L
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHL  559


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426  LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   238 bits (607),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SLD+SG N
Sbjct  18   AGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSLDISGFN  77

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP QL +L
Sbjct  78   LTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFPSQLTRL  137

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+F GRIPPEYGRFP+LEYLAVSGN 
Sbjct  138  RNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFGGRIPPEYGRFPSLEYLAVSGNA  197

Query  640  L  642
            L
Sbjct  198  L  198


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  307  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNK  366

Query  640  L  642
            L
Sbjct  367  L  367


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  637  GL  642
             L
Sbjct  390  FL  391


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  545

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  546  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  604


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 67/146 (46%), Gaps = 25/146 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------N  408
              G + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 N
Sbjct  174  FGGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGN  233

Query  409  LS--------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
            LS        N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N
Sbjct  234  LSQLLRFDAANCGLSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNN  293

Query  565  YFSGRIPPEYGRFPNLEYLAVSGNGL  642
             FSG IPP +    N+  + +  N L
Sbjct  294  MFSGEIPPTFAELKNITLVNLFRNKL  319


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  450

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L  +  S N 
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  510

Query  640  L  642
            L
Sbjct  511  L  511


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  517

Query  517  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            E+ +   L ++ L  N  SG IP E      L YL +S N L
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHL  559


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426  LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/187 (68%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  261
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  11   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  70

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  71   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  130

Query  442  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  621
             QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+FSGRIPPEYGRF +LEYL
Sbjct  131  SQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFSGRIPPEYGRFSSLEYL  190

Query  622  AVSGNGL  642
            AVSGN L
Sbjct  191  AVSGNAL  197


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  246  LSGKIPREIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  306  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNK  365

Query  640  L  642
            L
Sbjct  366  L  366


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  269  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  328

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP      NL+ +   GN
Sbjct  329  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPPNMCSGNNLQTIITLGN  388

Query  637  GL  642
             L
Sbjct  389  FL  390


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  485  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  544

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  545  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  603


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G +  L  L +   N  +G +PP I  +S L   + +N       P ++ +
Sbjct  197  LVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLSQLLRFDAANCGLSGKIPREIGK  256

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  L L  N+L+G L  E+  + SL+ L L  N FSG IPP +    N+  + +  N
Sbjct  257  LQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRN  316

Query  637  GL  642
             L
Sbjct  317  KL  318


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  390  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L  +  S N 
Sbjct  450  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNN  509

Query  640  L  642
            L
Sbjct  510  L  510


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  457  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  516

Query  517  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            E+ +   L ++ L  N  SG IP E      L YL +S N L
Sbjct  517  EISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHL  558


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  365  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  424

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  425  LPHLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  484



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  261
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            D+SG NL+G L P+VG L FL NLS+A NQ +GP+P EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPIPVEISFIPNLGYLNLSNNIFGMEFP  131

Query  442  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  621
             QL +L NLQVLDLYNNN+TG+LP+EVY+MT+LRHLHLGGN+F GRIPPEYGRFP+LEYL
Sbjct  132  PQLTRLRNLQVLDLYNNNMTGELPLEVYQMTNLRHLHLGGNFFGGRIPPEYGRFPSLEYL  191

Query  622  AVSGNGL  642
            AVSGN L
Sbjct  192  AVSGNAL  198


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ + +S N 
Sbjct  307  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIPQGLGTKSKLKNVDLSSNK  366

Query  640  L  642
            L
Sbjct  367  L  367


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 65/122 (53%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+VL L+ NN TG +P  +   + L+++ L  N  +G +PP      NL+ +   GN
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKNVDLSSNKLTGNLPPNMCSGNNLQTIITLGN  389

Query  637  GL  642
             L
Sbjct  390  FL  391


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 67/146 (46%), Gaps = 25/146 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------N  408
              G + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 N
Sbjct  174  FGGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNITTLQQLYVGYYNTFTGGIPPAIGN  233

Query  409  LS--------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
            LS        N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N
Sbjct  234  LSQLLRFDAANCGLSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNN  293

Query  565  YFSGRIPPEYGRFPNLEYLAVSGNGL  642
             FSG IPP +    N+  + +  N L
Sbjct  294  MFSGEIPPTFAELKNITLVNLFRNKL  319


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNFSGPMAPEISQCKLLTYVDLSRNQLSGEIPSEITG  545

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  546  MRILNYLNLSRNHLVGSIPSPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  604


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPRLSQVELQNNILTGTFPDISSKS  450

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  + L NN LTG LP  +      + L L GN FSGRIP E G+   L  +  S N
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHN  509


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NN +G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNFSGPMAP  517

Query  517  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            E+ +   L ++ L  N  SG IP E      L YL +S N L
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIPSEITGMRILNYLNLSRNHL  559


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  366  KLTGNLPPNMCSGNNLQTIITLGNFLFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLS  425

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L NN LTG  P    K  SL  + L  N  +G +PP  G F   + L + GN
Sbjct  426  LPRLSQVELQNNILTGTFPDISSKSNSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGN  485



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 147/189 (78%), Gaps = 4/189 (2%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvv  255
            R+S GA  G+   + E  ALLSIKAA T D QS+L SWN STSHCTW  VTCD    HV 
Sbjct  16   RYSTGARPGR---MPEYRALLSIKAAITEDPQSTLASWNASTSHCTWEGVTCDVSGRHVT  72

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
            +LD+S L+L+G LSPDVG L FLVNLS+AAN LSGPVPP+IS I  LR+LNLSNN+F  +
Sbjct  73   ALDISNLSLTGTLSPDVGHLRFLVNLSVAANSLSGPVPPQISDIPNLRYLNLSNNVFNLS  132

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  615
            FP QL +L NLQVLDLYNNN+TGD P + Y +TSLRHLHLGGN+FSG IP E+G FPNLE
Sbjct  133  FPPQLYRLKNLQVLDLYNNNMTGDFPSQAYLLTSLRHLHLGGNFFSGEIPAEFGSFPNLE  192

Query  616  YLAVSGNGL  642
            YLAVSGN L
Sbjct  193  YLAVSGNEL  201


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N L+G + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +L+L+ N LTG +P  + ++  L+ L L  N F+G IP   G   NL  + VS N 
Sbjct  310  KNMTLLNLFRNKLTGSIPDFIGELPELQVLQLWENNFTGSIPQNLGTNGNLHEVDVSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L+P++G L  L ++ ++ N LSG +PP  + +  +  LNL  N    + P  + +L
Sbjct  274  LTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQVL L+ NN TG +P  +    +L  + +  N  +G +PP       L  L   GN 
Sbjct  334  PELQVLQLWENNFTGSIPQNLGTNGNLHEVDVSSNKLTGNLPPNLCNGKQLHTLITLGNF  393

Query  640  L  642
            L
Sbjct  394  L  394


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N LSGP+ PEIS    L F++LS N    + P ++  +
Sbjct  490  FSGRIPAEIGKLQQLSKMDFSHNNLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGM  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  550  RILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  607


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+    FP      
Sbjct  394  LFGPIPESLGQCESLSRVRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGAFPETDRPS  453

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  + L NN+L+G LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  454  TTLGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNN  513

Query  640  L  642
            L
Sbjct  514  L  514


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 58/122 (48%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +  ++G L  L  L I   N  SG +P EI  +S L   + +N       P ++  
Sbjct  201  LTGAIPREIGNLTQLKELYIGYYNTFSGGIPKEIGNLSNLVRFDAANCGLSGEIPAEIGN  260

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  L L  N LTG L  E+  + SL+ + L  N  SG +PP +    N+  L +  N
Sbjct  261  LQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRN  320

Query  637  GL  642
             L
Sbjct  321  KL  322


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 54/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N LSGP+PP I     ++ L L  N F    P ++ +L  L  +D  +NNL+
Sbjct  456  LGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNNLS  515

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ +   L  + L  N  SG +P E      L YL +S N L
Sbjct  516  GPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGMRILNYLNLSRNHL  562


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG ++P++ +   L  + ++ NQLSG VP EI+ +  L +LNLS N    + P  +A 
Sbjct  513  NLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGMRILNYLNLSRNHLVGSIPSSIAS  572

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NN +G +P
Sbjct  573  MQSLTSVDFSYNNFSGLVP  591


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 57/116 (49%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G L  LV    A   LSG +P EI  +  L  L L  N        +L  L
Sbjct  226  FSGGIPKEIGNLSNLVRFDAANCGLSGEIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNL  285

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
             +L+ +DL NN L+G+LP    ++ ++  L+L  N  +G IP   G  P L+ L +
Sbjct  286  KSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRNKLTGSIPDFIGELPELQVLQL  341


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  370  LTGNLPPNLCNGKQLHTLITLGNFLFGPIPESLGQCESLSRVRMGENYLNGSIPKGLLSL  429

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N L+G  P      T+L  + L  N+ SG +PP  G F  ++ L + GN
Sbjct  430  PKLTQVELQDNLLSGAFPETDRPSTTLGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGN  488


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG  P      +TL  ++LSNN      P  +   
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLSGAFPETDRPSTTLGQISLSNNHLSGPLPPSIGNF  477

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N  +G +P E+ K+  L  +    N  SG I PE  R   L ++ +S N 
Sbjct  478  VGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNNLSGPIAPEISRCKLLTFVDLSRNQ  537

Query  640  L  642
            L
Sbjct  538  L  538



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   232 bits (592),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 138/174 (79%), Gaps = 1/174 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSP  300
            E  ALLSIK+A TAD QSSL SWN ST+HC+W  VTCDS    V+      LNL+G LSP
Sbjct  26   EYKALLSIKSAITADPQSSLASWNDSTTHCSWSGVTCDSYGRHVTALDISGLNLTGSLSP  85

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
            DV  L  L+NLS+AANQ  GPVPPEIS+ISTLR+LNLSNNIF  TFP QL +L NL+VLD
Sbjct  86   DVSHLRLLLNLSVAANQFCGPVPPEISSISTLRYLNLSNNIFNLTFPRQLIRLKNLEVLD  145

Query  481  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             YNNN++G LPV+VY++T+LRHLHLGGNYFSG IP EYG FPNLEYLAVSGN L
Sbjct  146  FYNNNMSGPLPVDVYQLTNLRHLHLGGNYFSGGIPAEYGSFPNLEYLAVSGNEL  199


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSGP+  E+  + +L+ ++LSNN+F    P   AQL
Sbjct  248  LSGEVPPELGMLQNLDTLFLQVNALSGPLTSELGYLKSLKSMDLSNNMFTGEIPSSFAQL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNQLHGSIPDFIGDLPELEVLQLWDNNFTGSIPQGLGTNGKLQNLDLSSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 58/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              +G +  ++G+L  L  +  + N  SGP+ PEIS    L F++LS N      P ++  
Sbjct  487  KFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISECKLLTFVDLSRNQLAGEIPTEITG  546

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  547  MRILNYLNLSRNHLVGSIPSPIASMQSLTSVDFSYNNLSGMVPGT-GQFSYFNYTSFLGN  605


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +    +  N+ +GP+P EI  +  L  ++ S+N F      ++++ 
Sbjct  464  LSGPLPPSIGNFVGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISEC  523

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  524  KLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIPSPIASMQSLTSVDFSYNN  583

Query  640  L  642
            L
Sbjct  584  L  584


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +  + G  P L  L+++ N+L+G +PPEI+ ++ L+ L +   N F    P Q+  
Sbjct  175  FSGGIPAEYGSFPNLEYLAVSGNELAGRIPPEIANLTKLQHLYIGYFNTFSGGIPPQIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+  + +L  L L  N  SG +  E G   +L+ + +S N
Sbjct  235  LSQLLRFDAANCGLSGEVPPELGMLQNLDTLFLQVNALSGPLTSELGYLKSLKSMDLSNN  294


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     QL  L  L++  NQL G +P  I  +  L  L L +N F  + P  L   
Sbjct  296  FTGEIPSSFAQLKNLTLLNLFRNQLHGSIPDFIGDLPELEVLQLWDNNFTGSIPQGLGTN  355

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ LDL +N LTG+LP  +     L+ L   GN+  G IP   G+  +L  L +  N 
Sbjct  356  GKLQNLDLSSNKLTGNLPPNICTGNKLQTLITLGNFLFGTIPESLGQCESLSRLRMGENY  415

Query  640  L  642
            L
Sbjct  416  L  416


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  L +  N L+G +P  + ++  L  + L +N+   +FP      
Sbjct  392  LFGTIPESLGQCESLSRLRMGENYLNGSIPKGLLSLPQLTQVELQDNLLTGSFPETDKTS  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  + L NN L+G LP  +     ++   L GN F+G IP E G+   L  +  S N
Sbjct  452  TALGQISLSNNRLSGPLPPSIGNFVGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHN  510


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 53/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSGP+PP I     ++   L  N F    P ++ +L  L  +D  +N+ +
Sbjct  454  LGQISLSNNRLSGPLPPSIGNFVGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFS  513

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ +   L  + L  N  +G IP E      L YL +S N L
Sbjct  514  GPIAPEISECKLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHL  560


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 53/121 (44%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P      + L  ++LSNN      P  +   
Sbjct  416  LNGSIPKGLLSLPQLTQVELQDNLLTGSFPETDKTSTALGQISLSNNRLSGPLPPSIGNF  475

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q   L  N  TG +P E+ K+  L  +    N FSG I PE      L ++ +S N 
Sbjct  476  VGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISECKLLTFVDLSRNQ  535

Query  640  L  642
            L
Sbjct  536  L  536


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L    N L G +P  +    +L  L +  N    + P  L  
Sbjct  367  KLTGNLPPNICTGNKLQTLITLGNFLFGTIPESLGQCESLSRLRMGENYLNGSIPKGLLS  426

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG  P      T+L  + L  N  SG +PP  G F  ++   + GN
Sbjct  427  LPQLTQVELQDNLLTGSFPETDKTSTALGQISLSNNRLSGPLPPSIGNFVGVQKFLLDGN  486



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 146/183 (80%), Gaps = 0/183 (0%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg  273
            + A KP  + E  ALLS+K A T D QS+L SWNISTSHCTW+ VTCD   HV SL++S 
Sbjct  19   SAAAKPHFLPEYRALLSLKTAITDDPQSALISWNISTSHCTWKGVTCDKYRHVTSLNISN  78

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP QL 
Sbjct  79   LNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSLISNLRYLNLSNNIFNLSFPQQLT  138

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            QL NL+VLD+YNNNLTG+L V V+ +T+L HLHLGGN+F+GRIPPE+G+FP L+YLAVSG
Sbjct  139  QLINLEVLDIYNNNLTGELAVGVHNLTNLYHLHLGGNFFTGRIPPEFGKFPFLKYLAVSG  198

Query  634  NGL  642
            N L
Sbjct  199  NEL  201


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  177  FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ L +S N
Sbjct  237  LSELVRFDAANCGLSGNIPSEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNN  296


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 68/122 (56%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +
Sbjct  273  SLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQE  332

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+VL L+ NN TG +P+ + + + L+ L +  N  +G +PP   R  NLE L   GN
Sbjct  333  LPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNKLTGNLPPNMCRGNNLETLITLGN  392

Query  637  GL  642
             L
Sbjct  393  FL  394


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P  L++L
Sbjct  250  LSGNIPSEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  310  KNLTLLNLFRNKLYGSIPEFIQELPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  394  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVS  453

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            A+L  + L NN LTG LP  +   + ++ L L GN FSGRIP E G+   L  +  SGNG
Sbjct  454  ASLGQISLSNNRLTGRLPSSIGSFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNG  513

Query  640  L  642
             
Sbjct  514  F  514


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SGP+PPEIS    L F++LS N      P ++  
Sbjct  489  KFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNCKALTFIDLSRNKLSGEIPTEITG  548

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L++  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  549  MRILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  607


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 63/117 (54%), Gaps = 2/117 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N++ GS  P ++  
Sbjct  226  FSGGIPPEIGNLSELVRFDAANCGLSGNIPSEIGKLKKLDTLFLQVNSLSGSLIP-EIGY  284

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L +L+ LDL NN L+G++P+ + ++ +L  L+L  N   G IP      P LE L +
Sbjct  285  LKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQELPKLEVLQL  341


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN      P  +   
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPSSIGSF  477

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            + +Q L L  N  +G +P E+ K+  L  +   GN FSG IPPE      L ++ +S N 
Sbjct  478  SGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNCKALTFIDLSRNK  537

Query  640  L  642
            L
Sbjct  538  L  538


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N+ SG +P EI  +  L  ++ S N F    P +++  
Sbjct  466  LTGRLPSSIGSFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNC  525

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L++  N+  G IP       +L  +  S N 
Sbjct  526  KALTFIDLSRNKLSGEIPTEITGMRILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNN  585

Query  640  L  642
            L
Sbjct  586  L  586


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++ +   L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  428

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG  PV      SL  + L  N  +GR+P   G F  ++ L + GN
Sbjct  429  LPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPSSIGSFSGVQKLLLDGN  488



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 141/179 (79%), Gaps = 0/179 (0%)
 Frame = +1

Query  106  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS  285
            KP  V E  ALLS+K + T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL+
Sbjct  24   KPPYVPEYRALLSLKTSITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNLT  83

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L+P+VG L FL+NLS+A NQ SGP+P E+S I  L +LNLSNNIF  +FP QL  L  
Sbjct  84   GTLTPEVGHLRFLLNLSVAVNQFSGPIPIELSFIPNLSYLNLSNNIFNLSFPPQLTHLRY  143

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L+VLD+YNNN+TGDLPV VY +T+LRHLHLGGN+FSG IPPEYGRFP LEYLAVSGN L
Sbjct  144  LKVLDIYNNNMTGDLPVGVYNLTNLRHLHLGGNFFSGSIPPEYGRFPFLEYLAVSGNAL  202


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 68/122 (56%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N L G +PPEI  I+TLR L +   N F    P ++  
Sbjct  178  FSGSIPPEYGRFPFLEYLAVSGNALVGMIPPEIGNITTLRELYIGYYNTFSGGLPAEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ L +S N
Sbjct  238  LSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNN  297

Query  637  GL  642
             L
Sbjct  298  ML  299


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L  + +S N 
Sbjct  311  KNLTLLNLFRNKLYGSIPEFIEDLPKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  L
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTELKNLTLLNLFRNKLYGSIPEFIEDL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + K + L ++ +  N  +G +PP       L+ L   GN 
Sbjct  335  PKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNKLTGNLPPNMCSGNKLQTLITLGNF  394

Query  640  L  642
            L
Sbjct  395  L  395


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  S+L  + LSNN F    P  +   
Sbjct  419  LNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSNNRFTGPLPSSIGNF  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N  +G +P E+ K+  L  +   GN FSG IPPE  R   L Y+ +S N 
Sbjct  479  TGVQKLLLDGNKFSGQIPAELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNK  538

Query  640  L  642
            L
Sbjct  539  L  539


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  395  LFGPIPESLGECQSLNRIRMGENFLNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVS  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            ++L  + L NN  TG LP  +   T ++ L L GN FSG+IP E G+   L  +  SGN
Sbjct  455  SSLGQICLSNNRFTGPLPSSIGNFTGVQKLLLDGNKFSGQIPAELGKLQQLSKMDFSGN  513


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SG +PPEIS    L +++LS N      P ++  
Sbjct  490  KFSGQIPAELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITG  549

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L++  N L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  550  MRILNYLNVSRNQLVGSIPAPIAAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFIGN  608


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGNLPPNMCSGNKLQTLITLGNFLFGPIPESLGECQSLNRIRMGENFLNGSIPKGLFS  429

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG  PV     +SL  + L  N F+G +P   G F  ++ L + GN
Sbjct  430  LPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSNNRFTGPLPSSIGNFTGVQKLLLDGN  489



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 0/179 (0%)
 Frame = +1

Query  106  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS  285
            KP  V E  ALLS+K A T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL+
Sbjct  24   KPPYVPEYRALLSLKTAITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNLT  83

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L+P+VG L FL+NLS+A NQ SGP+P E+S I  LR+LNLSNNIF  +FP QL  L  
Sbjct  84   GTLTPEVGHLRFLLNLSVAVNQFSGPIPVELSFIPNLRYLNLSNNIFNLSFPPQLTHLRY  143

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L VLD+YNNN+TG+LPV  Y +T+LRHLHLGGN+FSG IPPEYGRFP LEYLAVSGN L
Sbjct  144  LNVLDIYNNNMTGELPVGFYNLTNLRHLHLGGNFFSGSIPPEYGRFPFLEYLAVSGNAL  202


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 68/122 (56%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N L G +PPEI  I+TLR L +   N F    P ++  
Sbjct  178  FSGSIPPEYGRFPFLEYLAVSGNALVGRIPPEIGNITTLRELYIGYYNTFSGGLPAEIGY  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ L +S N
Sbjct  238  LSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNN  297

Query  637  GL  642
             L
Sbjct  298  ML  299


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G+   L  + +S N 
Sbjct  311  KNLTLLNLFRNKLYGSMPEFIEDMPKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  +
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTELKNLTLLNLFRNKLYGSMPEFIEDM  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + K + L ++ +  N  +G +PP       L+ L   GN 
Sbjct  335  PKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNKLTGNLPPNMCSGNKLQTLITLGNF  394

Query  640  L  642
            L
Sbjct  395  L  395


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  ++L  + LSNN F    P  +   
Sbjct  419  LNGSIPKGLLSLPKLSQVELQDNLLTGTFPVTDSVSASLGQICLSNNRFTGPLPSSIGNF  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N  +G +P E+ K+  L  +   GN FSG IPPE  R   L Y+ +S N 
Sbjct  479  TAVQKLLLDGNKFSGQIPGELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNK  538

Query  640  L  642
            L
Sbjct  539  L  539


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 62/119 (52%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  395  LFGPIPESLGECQSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNLLTGTFPVTDSVS  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            A+L  + L NN  TG LP  +   T+++ L L GN FSG+IP E G+   L  +  SGN
Sbjct  455  ASLGQICLSNNRFTGPLPSSIGNFTAVQKLLLDGNKFSGQIPGELGKLQQLSKMDFSGN  513


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SG +PPEIS    L +++LS N      P ++  
Sbjct  490  KFSGQIPGELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITG  549

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L++  N L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  550  MRILNYLNVSRNQLVGSIPAPIAAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFIGN  608



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 148/184 (80%), Gaps = 1/184 (1%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldls  270
            + A +P  ++E  ALLSIKAA T D QS+L SWN++T+HCTW+ +TCD S  HV SLD+S
Sbjct  16   SAAARPPRMSEYRALLSIKAAITDDPQSALASWNLTTNHCTWKGITCDPSRRHVTSLDIS  75

Query  271  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
             L+L+G LSPDVGQL FLVNLS+AAN +SGPVPP+IS I  LR+LNLSNN+F  +FP +L
Sbjct  76   NLSLTGTLSPDVGQLRFLVNLSVAANFISGPVPPQISDIPNLRYLNLSNNVFNLSFPPEL  135

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  630
             +L NLQVLDLYNNN+TGD P + Y + +LRHLHLGGN+FSG IPPE+G FP LEYLAVS
Sbjct  136  YRLRNLQVLDLYNNNMTGDFPSKAYLLANLRHLHLGGNFFSGEIPPEFGSFPYLEYLAVS  195

Query  631  GNGL  642
            GN L
Sbjct  196  GNEL  199


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+F    P   A+L
Sbjct  248  LTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +L+L+ N LTG +P  + ++  L  L L  N F+G IP   G   NL+ + VS N 
Sbjct  308  KNMTLLNLFRNKLTGSIPDFIGELPELEVLQLWENNFTGIIPQSLGTNGNLQEVDVSSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (47%), Gaps = 25/146 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G  P+L  L+++ N+L+G +PPEI  ++ L+ L +   N F    P ++  
Sbjct  175  FSGEIPPEFGSFPYLEYLAVSGNELTGAIPPEIGNLTQLKELYIGYYNAFTGGMPKEIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  564
            L+ L  LD  N  LTG++P E+  +                         SL+ + L  N
Sbjct  235  LSQLVRLDAANCGLTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNN  294

Query  565  YFSGRIPPEYGRFPNLEYLAVSGNGL  642
             FSG IPP +    N+  L +  N L
Sbjct  295  MFSGEIPPSFAELKNMTLLNLFRNKL  320


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  SG +PP  + +  +  LNL  N    + P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  +    +L+ + +  N  +G +PP       L  L   GN 
Sbjct  332  PELEVLQLWENNFTGIIPQSLGTNGNLQEVDVSSNKLTGNLPPNLCNGNQLRTLITLGNF  391

Query  640  L  642
            L
Sbjct  392  L  392


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP      
Sbjct  392  LFGPIPESLGQCKSLTRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGTFPETDGLS  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L  + L +N+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N 
Sbjct  452  TSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNE  511

Query  640  L  642
            L
Sbjct  512  L  512


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G L P +G    +  L +  N+ SG +P EI  +  L  ++ S+N        +++Q
Sbjct  463  HLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNELTGLIAPEISQ  522

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  523  CKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYN  582

Query  637  GL  642
             L
Sbjct  583  NL  584


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N+L+G + PEIS    L F++LS N      P ++  
Sbjct  487  KFSGRIPAEIGKLQQLSKMDFSHNELTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEITG  546

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  547  MRILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYNNLSGLV-PGTGQFSYFNYTSFLGN  605


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 71/134 (53%), Gaps = 17/134 (13%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G+++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  512  LTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNHLVGSIPSSIASM  571

Query  460  ANLQVLDLYNNNLTGDLP----VEVYKMTS-LRHLHLGGNYF----------SGRIPPEY  594
             +L  +D   NNL+G +P       +  TS L + +L G Y           +GR P E 
Sbjct  572  QSLTSVDFSYNNLSGLVPGTGQFSYFNYTSFLGNPNLCGPYLGPCKEGIASGAGR-PHEK  630

Query  595  GRF-PNLEYLAVSG  633
            G F P+++ L V G
Sbjct  631  GTFSPSMKLLLVIG  644


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG      G    L  +S++ N L+GP+PP I     ++ L L  N F    P ++ +L
Sbjct  440  LSGTFPETDGLSTSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKL  499

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N LTG +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  500  QQLSKMDFSHNELTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNH  559

Query  640  L  642
            L
Sbjct  560  L  560


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGNLPPNLCNGNQLRTLITLGNFLFGPIPESLGQCKSLTRIRMGENYLNGSIPKGLLS  426

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L+G  P      TSL  + L  N+ +G +PP  G F  ++ L + GN
Sbjct  427  LPKLTQVELQDNLLSGTFPETDGLSTSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGN  486



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGKP+ ++E  ALLS+K A + D Q  L +WN STSHCTW  V+CDSL  VVSLDLS +N
Sbjct  23   AGKPVRISENRALLSLKTAISDDPQGFLQNWNFSTSHCTWTGVSCDSLNRVVSLDLSNMN  82

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG+LSPDVGQL  LVNL++AAN + GP+PP IS IS LR LNLSNN+F  TFP QL++L
Sbjct  83   ISGILSPDVGQLRNLVNLTVAANLIYGPIPPGISYISGLRLLNLSNNVFNGTFPSQLSRL  142

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VLDLYNNN+TGDLPVEV  M +LRHLH GGN+FSGRIPPEYGR+  LEY+A+SGN 
Sbjct  143  KYLEVLDLYNNNMTGDLPVEVSDMPNLRHLHFGGNFFSGRIPPEYGRWEFLEYMALSGNE  202

Query  640  L  642
            L
Sbjct  203  L  203


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+    FP   ++L
Sbjct  252  LSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L++L +S N 
Sbjct  312  KNLTLLNLFRNKLHGAIPDFIGDLPELEVLQLWENNFTGSIPQGLGKNGRLQFLDLSSNK  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L ++ ++ N LSG  P   S +  L  LNL  N      P  +  L
Sbjct  276  LSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSELKNLTLLNLFRNKLHGAIPDFIGDL  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP+      L+ L   GN 
Sbjct  336  PELEVLQLWENNFTGSIPQGLGKNGRLQFLDLSSNKLTGNLPPDLCFGNRLQTLIALGNF  395

Query  640  L  642
            L
Sbjct  396  L  396


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 67/146 (46%), Gaps = 25/146 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  399
             SG + P+ G+  FL  ++++ N+L+GP+PP I  ++ L+                    
Sbjct  179  FSGRIPPEYGRWEFLEYMALSGNELTGPIPPTIGNLTKLQQLYLGYYNTYESGIPAEMGN  238

Query  400  -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
                  L+++N       PH+L +L  L  L L  N L+G+L  E+ ++ SL+ + L  N
Sbjct  239  LTELVRLDMANCGLSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNN  298

Query  565  YFSGRIPPEYGRFPNLEYLAVSGNGL  642
              SG  P  +    NL  L +  N L
Sbjct  299  MLSGEFPETFSELKNLTLLNLFRNKL  324


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  396  LFGPIPESLGRCESLSRIRMGENFLNGTIPKGLFGLPMLVQVELQDNYLVGGFPETDSVA  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L G LP  +   + ++ L L GN+FSG IP E GR   L  +  S N
Sbjct  456  ENLGQISLSNNQLMGSLPRSIGNFSGVQKLLLDGNFFSGSIPAEIGRLQQLSKMDFSNN  514


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ NQL G +P  I   S ++ L L  N F  + P ++ +L  L  +D  NN  +
Sbjct  458  LGQISLSNNQLMGSLPRSIGNFSGVQKLLLDGNFFSGSIPAEIGRLQQLSKMDFSNNRFS  517

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ +   L  + L  N  SG IPPE      L YL +S N L
Sbjct  518  GSIAPEISQCKLLTFVDLSRNELSGEIPPEITGMRILNYLNLSRNHL  564


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ Q   L  + ++ N+LSG +PPEI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGSIAPEISQCKLLTFVDLSRNELSGEIPPEITGMRILNYLNLSRNHLVGSIPASISTM  575

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  576  QSLTSVDFSYNNLSGLVP  593


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP LV + +  N L G  P   S    L  ++LSNN    + P  +   
Sbjct  420  LNGTIPKGLFGLPMLVQVELQDNYLVGGFPETDSVAENLGQISLSNNQLMGSLPRSIGNF  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            + +Q L L  N  +G +P E+ ++  L  +    N FSG I PE  +   L ++ +S N 
Sbjct  480  SGVQKLLLDGNFFSGSIPAEIGRLQQLSKMDFSNNRFSGSIAPEISQCKLLTFVDLSRNE  539

Query  640  L  642
            L
Sbjct  540  L  540



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   226 bits (577),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW+ VTCD   HV SLD+SG N
Sbjct  20   AGKQPRIPEYQALLALKTAITDDPQLALASWNISTSHCTWKGVTCDRYRHVTSLDISGFN  79

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G L P+VG L FL NLS+  NQ SGP+P EIS I  L +LNLSNNIF   FP QL +L
Sbjct  80   VTGTLPPEVGNLRFLQNLSVDLNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQLTRL  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL+VLDLYNNN+TGDLPV+VY+MT+LRHLHLGGN+F GRIPPEYGRF  LEYLAVSGN 
Sbjct  140  RNLKVLDLYNNNMTGDLPVDVYQMTNLRHLHLGGNFFGGRIPPEYGRFQFLEYLAVSGNE  199

Query  640  L  642
            L
Sbjct  200  L  200


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 66/122 (54%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  
Sbjct  272  SLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGD  331

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+VL L+ NN TG +P  +   + L++L L  N  +G +PP      NL+ +   GN
Sbjct  332  LPELEVLQLWENNFTGSIPQGLGTNSKLKNLDLSSNKLTGNLPPNMCAGKNLQTIITLGN  391

Query  637  GL  642
             L
Sbjct  392  FL  393


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P   A L
Sbjct  249  LSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWENNFTGSIPQGLGTNSKLKNLDLSSNK  368

Query  640  L  642
            L
Sbjct  369  L  369


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
              G + P+ G+  FL  L+++ N+L G +PPEI  I+TL  L +   N F    P ++  
Sbjct  176  FGGRIPPEYGRFQFLEYLAVSGNELVGEIPPEIGNITTLHELYVGYYNTFSGGIPPEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+ K+ +L  L L  N  SG + PE G   +L+ L +S N
Sbjct  236  LSQLVRFDAANCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNN  295

Query  637  GL  642
             L
Sbjct  296  ML  297


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L NN+   TFP   +  
Sbjct  393  LFGPIPESLGQCESLSRIRMGENYLNGSIPKRLLSLPQLSQVELQNNLLTGTFPETKSIS  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  + L NN+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N
Sbjct  453  TSLGQISLSNNHLTGSLPTSIGNFAGVQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHN  511


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  488  KFSGRIPAEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITG  547

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  548  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  606


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G L  LV    A   LSG +P E+  +  L  L L  N    +   ++  L
Sbjct  225  FSGGIPPEIGNLSQLVRFDAANCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTL  284

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L+ LDL NN L+G++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  285  KSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWEN  343


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN    + P  +   
Sbjct  417  LNGSIPKRLLSLPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGSLPTSIGNF  476

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            A +Q L L  N  +G +P E+ K+  L  +    N FSG I PE  +   L Y+ +S N 
Sbjct  477  AGVQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQ  536

Query  640  L  642
            L
Sbjct  537  L  537


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P +L  
Sbjct  368  KLTGNLPPNMCAGKNLQTIITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKRLLS  427

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L NN LTG  P      TSL  + L  N+ +G +P   G F  ++ L + GN
Sbjct  428  LPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGSLPTSIGNFAGVQKLLLDGN  487



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 145/185 (78%), Gaps = 2/185 (1%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl  267
            + A KP  + E  ALLS+K A + D QS+L SWN ST  SHCTW+ VTCD   HV SL++
Sbjct  15   SAAAKPHFLPEYRALLSLKTAISDDPQSALISWNSSTTTSHCTWKGVTCDKYRHVTSLNI  74

Query  268  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
            S LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP Q
Sbjct  75   SNLNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSVISNLRYLNLSNNIFNLSFPQQ  134

Query  448  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L QL NL+VLD+YNNNLTG LPV V+ +T+L HLHLGGN+F+GRIPPE+G+FP L+YLAV
Sbjct  135  LTQLINLEVLDIYNNNLTGQLPVGVHNLTNLYHLHLGGNFFTGRIPPEFGKFPFLKYLAV  194

Query  628  SGNGL  642
            SGN L
Sbjct  195  SGNEL  199


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 68/120 (57%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  175  FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ L +S N
Sbjct  235  LSELVRFDAANCGLSGEIPAEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNN  294


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 68/122 (56%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +
Sbjct  271  SLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEE  330

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+VL L+ NN TG +P+ + + + L+ L +  N  +G +PP   R  NLE L   GN
Sbjct  331  LPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNKLTGNLPPNMCRGNNLETLITLGN  390

Query  637  GL  642
             L
Sbjct  391  FL  392


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P  L++L
Sbjct  248  LSGEIPAEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLYGSIPEFIEELPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  392  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVS  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            A+L  + L NN LTG LP  +   + ++ L L GN FSGRIP E G+   L  +  SGNG
Sbjct  452  ASLGQISLSNNRLTGRLPPSIGNFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNG  511

Query  640  L  642
             
Sbjct  512  F  512


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SGP+PPEIS    L F++LS N      P ++  
Sbjct  487  KFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISHCKALTFVDLSRNKLSGEIPTEITG  546

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L++  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  547  MRILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 63/117 (54%), Gaps = 2/117 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N++ GS  P ++  
Sbjct  224  FSGGIPPEIGNLSELVRFDAANCGLSGEIPAEIGKLKKLDTLFLQVNSLSGSLIP-EIGY  282

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L +L+ LDL NN L+G++P+ + ++ +L  L+L  N   G IP      P LE L +
Sbjct  283  LKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEELPKLEVLQL  339


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN      P  +   
Sbjct  416  LNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPPSIGNF  475

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            + +Q L L  N  +G +P E+ K+  L  +   GN FSG IPPE      L ++ +S N 
Sbjct  476  SGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISHCKALTFVDLSRNK  535

Query  640  L  642
            L
Sbjct  536  L  536


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++ +   L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  426

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG  PV      SL  + L  N  +GR+PP  G F  ++ L + GN
Sbjct  427  LPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPPSIGNFSGVQKLLLDGN  486



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   224 bits (570),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AG+PL + E  ALLSIK A + D Q+SL +WN+STSHCTW  V+CDS   VVSLDLS +N
Sbjct  20   AGRPLRIPEYRALLSIKTAISDDPQASLPNWNLSTSHCTWTGVSCDSFNRVVSLDLSNMN  79

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG+LSPDVGQL  L+NL+ AAN  SGP+P EIS IS LR LNLSNN+F  +FP + ++L
Sbjct  80   LSGILSPDVGQLRNLINLTAAANFFSGPIPSEISHISGLRLLNLSNNVFNGSFPSEFSRL  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VLDLYNNN+TGDLPV+V +M +LRHLHLGGN+FSGRIP EYGR+  LEYLA+SGN 
Sbjct  140  KLLEVLDLYNNNMTGDLPVDVSEMPNLRHLHLGGNFFSGRIPSEYGRWEFLEYLALSGNE  199

Query  640  L  642
            L
Sbjct  200  L  200


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G L  DV ++P L +L +  N  SG +P E      L +L LS N  G T P ++  
Sbjct  151  NMTGDLPVDVSEMPNLRHLHLGGNFFSGRIPSEYGRWEFLEYLALSGNELGGTIPPEIGN  210

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L  LQ L L Y N+  G +P E+  +T L  L +     SG IPPE+ +   L+ L +  
Sbjct  211  LTKLQQLYLGYYNSYEGGIPPELGNLTELVRLDMANCGLSGEIPPEFSKLQKLDTLFLQV  270

Query  634  NGL  642
            NGL
Sbjct  271  NGL  273


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P+  +L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   ++L
Sbjct  249  LSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  + +L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGAIPDFIGDLPALEVLQLWENNFTGSIPQGLGKNGRLQLLDLSSNK  368

Query  640  L  642
            L
Sbjct  369  L  369


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  273  LSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP+      L  L   GN 
Sbjct  333  PALEVLQLWENNFTGSIPQGLGKNGRLQLLDLSSNKLTGNLPPDLCFGNRLHTLIALGNF  392

Query  640  L  642
            L
Sbjct  393  L  393


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 59/114 (52%), Gaps = 0/114 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV L +A   LSG +PPE S +  L  L L  N        +L QL +
Sbjct  227  GGIPPELGNLTELVRLDMANCGLSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKS  286

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L+ +DL NN L G++P    ++ +L  L+L  N   G IP   G  P LE L +
Sbjct  287  LKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDLPALEVLQL  340


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 57/117 (49%), Gaps = 1/117 (1%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  ++G+L  L  +  + N+ SGP+  EIS    L F++LS N      P ++  +  
Sbjct  491  GSIPAEIGRLQQLSKMDFSNNRFSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRI  550

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+L  N+LTG +P  +  M SL  +    N  SG +P   G+F      +  GN
Sbjct  551  LNYLNLSRNHLTGSIPASIATMQSLTSVDFSYNNLSGLVPGT-GQFSYFNSTSFVGN  606


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 6/117 (5%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            ++ D+GQ+      S++ NQL+G +P  I   S ++ L L  N F  + P ++ +L  L 
Sbjct  451  IAEDLGQI------SLSNNQLTGSLPRSIGNFSGVQKLLLDGNFFFGSIPAEIGRLQQLS  504

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             +D  NN  +G +  E+ +   L  + L  N  SG IPPE      L YL +S N L
Sbjct  505  KMDFSNNRFSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRILNYLNLSRNHL  561


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGRCKSLSRIRMGENFLNGTIPKGLFSLPNLAQVELQDNYLVGGFPQTDSIA  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  + L NN LTG LP  +   + ++ L L GN+F G IP E GR   L  +  S N
Sbjct  453  EDLGQISLSNNQLTGSLPRSIGNFSGVQKLLLDGNFFFGSIPAEIGRLQQLSKMDFSNN  511


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++ ++ Q   L  + ++ N+LSG +PPE++ +  L +LNLS N    + P  +A +
Sbjct  513  FSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRILNYLNLSRNHLTGSIPASIATM  572

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGK   + E  ALL++K A   D Q +L SWN STSHCTW+ VTCD   HV SLD+SG N
Sbjct  19   AGKHPRIPEYQALLALKTAIIDDPQLALASWNNSTSHCTWKGVTCDRYRHVTSLDISGFN  78

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G L P+VG   FL NLS+A NQ SGP+P EIS I  L +LNLSNNIF   FP QL +L
Sbjct  79   VTGTLPPEVGNFRFLQNLSVALNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQLTRL  138

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL+VLDLYNNN+TGDLPV+VY+MT+LRHLHLGGN+F GRIPPEYGRF  LEYLAVSGN 
Sbjct  139  RNLKVLDLYNNNMTGDLPVDVYQMTNLRHLHLGGNFFGGRIPPEYGRFQFLEYLAVSGNE  198

Query  640  L  642
            L
Sbjct  199  L  199


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 66/122 (54%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  
Sbjct  271  SLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGD  330

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+VL L+ NN TG +P  +   + L++L L  N  +G +PP      NL+ +   GN
Sbjct  331  LPELEVLQLWENNFTGSIPHGLGTNSKLKNLDLSSNKLTGSLPPNMCAGKNLQTIITLGN  390

Query  637  GL  642
             L
Sbjct  391  FL  392


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
              G + P+ G+  FL  L+++ N+L G +PPEI  I+TL  L +   N F    P ++  
Sbjct  175  FGGRIPPEYGRFQFLEYLAVSGNELVGVIPPEIGNITTLHELYVGYYNTFSGGIPPEIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+ K+ +L  L L  N  SG + PE G   +L+ L +S N
Sbjct  235  LSQLVRFDAANCGLSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNN  294

Query  637  GL  642
             L
Sbjct  295  ML  296


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 64/121 (53%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++ +L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P   A L
Sbjct  248  LSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWENNFTGSIPHGLGTNSKLKNLDLSSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L NN+   TFP   +  
Sbjct  392  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPQLSQVELQNNLLTGTFPETKSIS  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  + L NN+LTG LP  +     ++ L L GN FSGRIP E G+   L  +  S N
Sbjct  452  TSLGQISLSNNHLTGPLPTSIGNFAGVQKLLLDGNKFSGRIPVEIGKLQQLSKIDFSHN  510


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  487  KFSGRIPVEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITG  546

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N FSG + P  G+F    Y +  GN
Sbjct  547  MRILNYLNLSRNHLVGSIPTPISSMQSLTSVDFSYNNFSGLV-PGTGQFSYFNYTSFLGN  605


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N    +   ++  L
Sbjct  224  FSGGIPPEIGNLSQLVRFDAANCGLSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTL  283

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L+ LDL NN L+G++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  284  KSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWEN  342


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN      P  +   
Sbjct  416  LNGSIPKGLLSLPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGPLPTSIGNF  475

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            A +Q L L  N  +G +PVE+ K+  L  +    N FSG I PE  +   L Y+ +S N 
Sbjct  476  AGVQKLLLDGNKFSGRIPVEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQ  535

Query  640  L  642
            L
Sbjct  536  L  536


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  +    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  367  KLTGSLPPNMCAGKNLQTIITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLS  426

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L NN LTG  P      TSL  + L  N+ +G +P   G F  ++ L + GN
Sbjct  427  LPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGPLPTSIGNFAGVQKLLLDGN  486



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V+E  ALLSIK+A +ADSQ++L+SWN +TSHCTW  VTCDS  HV SLDL  LNLSG LS
Sbjct  21   VSEYRALLSIKSALSADSQAALSSWNATTSHCTWTGVTCDSRHHVTSLDLRDLNLSGTLS  80

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             DV  L FL NL++AANQ SGP+PPEIS +S LRFLNLSNN+F  +FP QLA+LANL+V+
Sbjct  81   SDVAHLQFLRNLTVAANQFSGPIPPEISQLSALRFLNLSNNVFNGSFPSQLARLANLEVM  140

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+T +LPV V ++ +L HLHLGGN+FSG IP EYG +  LEYLAVSGN L
Sbjct  141  DLYNNNMTDELPVGVTQLRNLHHLHLGGNFFSGEIPAEYGGWEFLEYLAVSGNEL  195


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+F    P   A+L
Sbjct  244  LSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAEL  303

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  304  KNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNFTGSIPQRLGSNGMLQLLDLSSNK  363

Query  640  L  642
            L
Sbjct  364  L  364


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV L  A   LSG +P EI  +  L  L L  N    T   +L  L 
Sbjct  221  TGGLPPEIGNLSSLVRLDAANCALSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLK  280

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN  TG++P    ++ ++  L+L  N   G IP   G  P LE L +  N
Sbjct  281  SLKSMDLSNNMFTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWEN  338


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P+VG L  L  +  + N+ SG + PEIS    L F++LS N      P+++  
Sbjct  483  KFSGQIPPEVGSLKQLSKMGFSDNRFSGQIAPEISKCKLLTFVDLSRNELSGVVPNEITG  542

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  543  MKILNYLNLSRNHLVGSIPAAIASMQSLTSVDFSYNNLSGLV-PGTGQFSYFNYTSFLGN  601


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  +G +P   + +  +  LNL  N      P  + +L
Sbjct  268  LSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGEL  327

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  328  PKLEVLQLWENNFTGSIPQRLGSNGMLQLLDLSSNKLTGTLPPDMCSGNRLETLITLGNF  387

Query  640  L  642
            L
Sbjct  388  L  388


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +  + G   FL  L+++ N+L G +PPEI  ++TLR L +   N +    P ++  
Sbjct  171  FSGEIPAEYGGWEFLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNTYTGGLPPEIGN  230

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L++L  LD  N  L+G++P E+ K+  L  L L  N  SG +  E G   +L+ + +S N
Sbjct  231  LSSLVRLDAANCALSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLKSLKSMDLSNN  290


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ SG +PPE+ ++  L  +  S+N F      ++++ 
Sbjct  460  LSGSLPASIGNFSGVQKLLLDGNKFSGQIPPEVGSLKQLSKMGFSDNRFSGQIAPEISKC  519

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  520  KLLTFVDLSRNELSGVVPNEITGMKILNYLNLSRNHLVGSIPAAIASMQSLTSVDFSYNN  579

Query  640  L  642
            L
Sbjct  580  L  580


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  388  LFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTDSIS  447

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  + L NN L+G LP  +   + ++ L L GN FSG+IPPE G    L  +  S N
Sbjct  448  VSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDGNKFSGQIPPEVGSLKQLSKMGFSDN  506


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  363  KLTGTLPPDMCSGNRLETLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFG  422

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG+ PV      SL  + L  N  SG +P   G F  ++ L + GN
Sbjct  423  LPKLTQVELQDNYLTGEFPVTDSISVSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDGN  482


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  +  L++  N+L G +P  I  +  L  L L  N F  + P +L   
Sbjct  292  FTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNFTGSIPQRLGSN  351

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP ++     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  352  GMLQLLDLSSNKLTGTLPPDMCSGNRLETLITLGNFLFGPIPESLGKCQSLSRIRMGENF  411

Query  640  L  642
            L
Sbjct  412  L  412



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   221 bits (563),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPDV  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP QL+ L  L
Sbjct  80   TLSPDVAHLRFLANLTLAENQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPQLSNLTRL  139

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNEL  197


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 70/120 (58%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+NL   D  N NLTG++P EV ++ ++  L L  N  SG +  E G   +L+ + +S N
Sbjct  233  LSNLVRFDAANCNLTGEIPPEVGRLQNVDTLFLQVNALSGSLTLELGYLKSLKSMDLSNN  292


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 70/122 (57%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P+VG+L  +  L +  N LSG +  E+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEIPPEVGRLQNVDTLFLQVNALSGSLTLELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  637  GL  642
             L
Sbjct  365  KL  366


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 58/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  +  +    N+  GP+ PEIS    L F++LS N      P ++  
Sbjct  485  KFSGRIPPEIGRLQQVSKMDFKHNKFMGPITPEISHCKLLTFVDLSRNELSGEIPKEITG  544

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  545  MRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLV-PGTGQFSYFNYTSFLGN  603


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   +  +    N
Sbjct  450  GNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHN  508


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  +  ++  +N F      +++  
Sbjct  462  LSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHNKFMGPITPEISHC  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  581

Query  640  L  642
            L
Sbjct  582  L  582


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    T P  +   
Sbjct  318  LHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFG  377

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NLQ L   +N L G +P  + +  SL  + +G NY +G IP      P L  + +  N
Sbjct  378  NNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDN  436


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L+ L L  N F  + P  L + 
Sbjct  294  FTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKN  353

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP ++    +L+ L    N+  G IP   GR  +L  + +  N 
Sbjct  354  GKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNY  413

Query  640  L  642
            L
Sbjct  414  L  414


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGN  484


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 51/107 (48%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  +  +D  +N   
Sbjct  452  LGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHNKFM  511

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+     L  + L  N  SG IP E      L YL +S N L
Sbjct  512  GPITPEISHCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHL  558



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 142/186 (76%), Gaps = 1/186 (1%)
 Frame = +1

Query  88   AGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsld  264
             G+ A  P  + E  ALLSIKAA T D QS+L SWN +T HCTWR VTCD+    V SLD
Sbjct  16   GGSAAATPPHMPEYRALLSIKAAITDDPQSALASWNATTHHCTWRGVTCDASGRRVASLD  75

Query  265  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  444
            +S L+L+GVLSPDVG+L FLVN S AAN LSGP+PP+IS I  LR LNLSNN+F  +FP 
Sbjct  76   ISNLSLAGVLSPDVGRLRFLVNFSAAANFLSGPIPPQISDIPNLRHLNLSNNVFNLSFPA  135

Query  445  QLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  624
            +L  L NL+VLD+YNNN+TGD P + Y +T+LRHLHLGGN+F+G  PPE+G FP+LEYLA
Sbjct  136  ELYHLKNLEVLDVYNNNMTGDFPSQAYLLTNLRHLHLGGNFFTGVFPPEFGSFPHLEYLA  195

Query  625  VSGNGL  642
            VSGN L
Sbjct  196  VSGNEL  201


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N +SG +PPE+  + +L+ ++LSNNI     P   +QL
Sbjct  250  LSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +L+L+ N  TG +P  +  +  L+ L L  N F+G IP   G   NLE + +S N 
Sbjct  310  QNITLLNLFRNKFTGSIPDFIGDLPELQVLQLWENNFTGIIPQNLGDNGNLEEVDLSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +GV  P+ G  P L  L+++ N+L+G +PP+I  ++ L+ L +   N F    P ++  
Sbjct  177  FTGVFPPEFGSFPHLEYLAVSGNELTGAIPPQIGNLTHLKELYIGYFNTFTGGIPKEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+NL   D  N  L+G +P E+  + +L  L L  N  SG +PPE G   +L+ + +S N
Sbjct  237  LSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNN  296


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG L P++G L  L ++ ++ N LSG +PP  S +  +  LNL  N F  + P  +  L
Sbjct  274  ISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQVL L+ NN TG +P  +    +L  + L  N  +G +PP       L  L   GN 
Sbjct  334  PELQVLQLWENNFTGIIPQNLGDNGNLEEVDLSSNKLTGNLPPNLCNGNQLNTLITLGNF  393

Query  640  L  642
            L
Sbjct  394  L  394


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N  SG + PEIS    L F++LS+N      P ++  +
Sbjct  491  FSGEIPAEIGKLQQLSKIDFSRNDFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITSM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  NNL G++P  +  M SL  +    N FSG +P   G+F      +  GN
Sbjct  551  KILNYLNLSRNNLMGNIPSSISGMQSLTSVDFSYNNFSGLVPAT-GQFSYFNRTSFLGN  608


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 59/116 (51%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  ++G L  L+    A   LSG +P EI  +  L  L L  N      P +L  L
Sbjct  226  FTGGIPKEIGNLSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNL  285

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
             +L+ +DL NN L+G++P    ++ ++  L+L  N F+G IP   G  P L+ L +
Sbjct  286  KSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDLPELQVLQL  341


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  + +  N LSG  P     +ST L  ++LSNN      P  +  
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLSGEFPNTDGILSTTLGQISLSNNHLAGRLPPSIGN  477

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             A +Q L L  N  +G++P E+ K+  L  +    N FSG+I PE  R   L ++ +S N
Sbjct  478  FAAVQKLLLDGNKFSGEIPAEIGKLQQLSKIDFSRNDFSGQISPEISRCKLLTFVDLSHN  537

Query  637  GL  642
             L
Sbjct  538  RL  539


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 58/123 (47%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G        L  L +L +  N  +G  PPE  +   L +L +S N      P Q+  
Sbjct  152  NMTGDFPSQAYLLTNLRHLHLGGNFFTGVFPPEFGSFPHLEYLAVSGNELTGAIPPQIGN  211

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N  TG +P E+  +++L          SG+IP E G   NL+ L +  
Sbjct  212  LTHLKELYIGYFNTFTGGIPKEIGNLSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQV  271

Query  634  NGL  642
            NG+
Sbjct  272  NGI  274


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG +SP++ +   L  + ++ N+LSGP+P EI+++  L +LNLS N      P  ++ 
Sbjct  514  DFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITSMKILNYLNLSRNNLMGNIPSSISG  573

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NN +G +P
Sbjct  574  MQSLTSVDFSYNNFSGLVP  592



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   219 bits (557),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLS KAA T D QSSL +WN ST HCTW  +TCDS  HV SLDLSGLNLSG LS
Sbjct  26   VPEYKALLSFKAALTDDPQSSLATWNASTLHCTWFGITCDSRRHVTSLDLSGLNLSGSLS  85

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P++  L FL N+S+A NQ SGP+P EISAIS LR LNLSNN+F  TFP +L+QL NLQ+L
Sbjct  86   PELAYLRFLSNVSLADNQFSGPIPAEISAISGLRLLNLSNNVFNGTFPPELSQLKNLQIL  145

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TGDLP++V  + +LRHLHLGGNYFSG IP EYGR+  LEYLAVSGN L
Sbjct  146  DLYNNNMTGDLPLDVVDLPNLRHLHLGGNYFSGAIPKEYGRWEFLEYLAVSGNEL  200


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 71/121 (59%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+ ++++L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFTGSIPQGLGRNGKLQLLDLSSNK  368

Query  640  L  642
            L
Sbjct  369  L  369


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +PP  + +  L  LNL  N      P  + +L
Sbjct  273  LSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGEL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + +   L+ L L  N  +G +PP+      L  L   GN 
Sbjct  333  PELEVLQLWENNFTGSIPQGLGRNGKLQLLDLSSNKLTGTLPPDMCSGHRLHTLITLGNF  392

Query  640  L  642
            L
Sbjct  393  L  393


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +  + G+  FL  L+++ N+LSG +PPEI +++ LR L +   N +    P ++  
Sbjct  176  FSGAIPKEYGRWEFLEYLAVSGNELSGKIPPEIGSLTNLRELYIGYYNTYEGGLPAEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  236  LSELVRFDGANCALSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNSLKSMDLSNN  295

Query  637  GL  642
             L
Sbjct  296  ML  297


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  +  ++ S+N F      +++Q 
Sbjct  466  LSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKIDFSHNKFSGLITPEISQC  525

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  526  KVLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGNIPSSIASMQSLTSVDFSYNN  585

Query  640  L  642
            L
Sbjct  586  L  586


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  +  +  + N+ SG + PEIS    L F++LS N      P+++  
Sbjct  489  KFSGRIPPEIGRLQQVSKIDFSHNKFSGLITPEISQCKVLTFVDLSRNELSGEIPNEITG  548

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  549  MRILNYLNLSRNHLVGNIPSSIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFVGN  607


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P   +L  L  L++  N+L G +P  I  +  L  L L  N F  + P  L + 
Sbjct  297  LSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFTGSIPQGLGRN  356

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP ++     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  357  GKLQLLDLSSNKLTGTLPPDMCSGHRLHTLITLGNFLFGPIPESLGKCQSLSRIRMGENF  416

Query  640  L  642
            L
Sbjct  417  L  417


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 59/145 (41%), Gaps = 25/145 (17%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGTLPPDMCSGHRLHTLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFG  427

Query  457  LANLQVLDLYNNNLTGD-------------------------LPVEVYKMTSLRHLHLGG  561
            L  L  ++L +N L+GD                         LP  +   + ++ L L G
Sbjct  428  LPKLTQVELQDNLLSGDFPESDGTFAANLGQISLSNNQLSGSLPPSIGNFSGVQKLLLDG  487

Query  562  NYFSGRIPPEYGRFPNLEYLAVSGN  636
            N FSGRIPPE GR   +  +  S N
Sbjct  488  NKFSGRIPPEIGRLQQVSKIDFSHN  512


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (49%), Gaps = 6/119 (5%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G  + ++GQ+      S++ NQLSG +PP I   S ++ L L  N F    P ++ +L  
Sbjct  450  GTFAANLGQI------SLSNNQLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQ  503

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  504  VSKIDFSHNKFSGLITPEISQCKVLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHL  562



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L V
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPPQLSNLTRLTV  140

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L
Sbjct  141  LDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNEL  196


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSE  303

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  304  LKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  363

Query  637  GL  642
             L
Sbjct  364  KL  365


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 70/120 (58%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L G +PPEI  ++TL+ L +   N +    P ++  
Sbjct  172  FSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGMPPEIGN  231

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + PE G   +L+ + +S N
Sbjct  232  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNN  291


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE  591
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+
Sbjct  329  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPD  372


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++Q 
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISQC  520

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  521  KLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLFGSIPSSISTMQSLTSVDFSYNN  580

Query  640  L  642
            L
Sbjct  581  L  581


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFSLPKLTQVELQDNLLDGSFPETDTIS  448

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +    N
Sbjct  449  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHN  507


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 58/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P+++  
Sbjct  484  KFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISQCKLLTFVDLSRNELSGEIPNEITG  543

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  544  MRILNYLNLSRNHLFGSIPSSISTMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  602


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 52/107 (49%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  451  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFM  510

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  511  GSITPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHL  557


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  364  KLTGTLPPDMCFGNSLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFS  423

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424  LPKLTQVELQDNLLDGSFPETDTISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   218 bits (556),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 137/178 (77%), Gaps = 1/178 (1%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPXKLSNLTRL  139

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNEL  197


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 71/120 (59%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + PE G   +L+ + +S N
Sbjct  233  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNN  292


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  637  GL  642
             L
Sbjct  365  KL  366


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+     NL+ L    N 
Sbjct  330  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNF  389

Query  640  L  642
            L
Sbjct  390  L  390


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +    N
Sbjct  450  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHN  508


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  462  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHC  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E   M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  581

Query  640  L  642
            L
Sbjct  582  L  582


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P +   
Sbjct  485  KFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHCKLLTFVDLSRNELSGEIPKEXTG  544

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  545  MRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLV-PGTGQFSYFNYTSFLGN  603


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    T P  +   
Sbjct  318  LHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFG  377

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NLQ L   +N L G +P  + +  SL  + +G NY +G IP      P L  + +  N
Sbjct  378  NNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDN  436


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 51/107 (48%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  452  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFM  511

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+     L  + L  N  SG IP E      L YL +S N L
Sbjct  512  GSITPEISHCKLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHL  558


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  484



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   217 bits (552),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            +++  ALLS K++ ++D  S L+SW  +TSHCTW  VTCDS  HV SLDLS  +L G LS
Sbjct  22   MSDYRALLSFKSSISSDPNSVLSSWTPTTSHCTWTGVTCDSRRHVTSLDLSSSDLVGTLS  81

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             D+  L FL NL++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ L  L VL
Sbjct  82   SDIAHLRFLSNLTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSNLTRLAVL  141

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNNLTGDLPV V  MTSLRHLHLGGN+FSGRIPPE+GRFP LEYLA+SGN L
Sbjct  142  DLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGRIPPEFGRFPLLEYLAISGNEL  196


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 69/120 (58%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ P L  L+I+ N+L G +PPEI  +++L+ L +   NI+    P ++  
Sbjct  172  FSGRIPPEFGRFPLLEYLAISGNELGGSIPPEIGNLTSLKELYIGYYNIYEGGIPPEIGN  231

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD  N NLTG++P E+ ++ ++  L L  N  SG +  E G   +L+ + +S N
Sbjct  232  LSQLVRLDAANCNLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNN  291


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 69/122 (57%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  303

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L  L +S N
Sbjct  304  LKNLTLLNLFRNKLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSN  363

Query  637  GL  642
             L
Sbjct  364  KL  365


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  328

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQVL L+ NN TG +P  + K   L  L L  N  +G +PP+     NL+ L   GN 
Sbjct  329  PELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNF  388

Query  640  L  642
            L
Sbjct  389  L  389


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  + N+  GP+ PEIS    L F++LS N      P ++  
Sbjct  484  KFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQCKLLTFVDLSRNELAGEIPKEITG  543

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  544  MRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  602


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCGSLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDNLLAGSFPETDTIS  448

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +  S N
Sbjct  449  VNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHN  507


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N F      +++Q 
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQC  520

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  521  KLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  580

Query  640  L  642
            L
Sbjct  581  L  581


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  364  KLTGTLPPDMCFGNNLQTLITLGNFLFGPIPESLGRCGSLSRIRMGENFLNGSIPKGLFG  423

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424  LPKLSQVELQDNLLAGSFPETDTISVNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 52/107 (49%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  451  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFL  510

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ +   L  + L  N  +G IP E      L YL +S N L
Sbjct  511  GPIAPEISQCKLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHL  557


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   +G LP L  L +  N  +G +P  +     L  L+LS+N    T P  +  
Sbjct  316  KLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCF  375

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              NLQ L    N L G +P  + +  SL  + +G N+ +G IP      P L  + +  N
Sbjct  376  GNNLQTLITLGNFLFGPIPESLGRCGSLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDN  435



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L V
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPRQLSNLTRLTV  140

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNNLTG LPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L
Sbjct  141  LDLYNNNLTGKLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNEL  196


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 70/120 (58%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L G +PPEI  ++TL+ L +   N +    P ++  
Sbjct  172  FSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  231

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + PE G   +L+ + +S N
Sbjct  232  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGWLTPELGYLKSLKSMDLSNN  291


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 71/122 (58%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN++    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSE  303

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  304  LKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  363

Query  637  GL  642
             L
Sbjct  364  KL  365


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE  591
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+
Sbjct  329  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPD  372


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFXLPKLTQVELQDNLLDGSFPETDTIS  448

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +    N
Sbjct  449  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHN  507


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISLC  520

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  521  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLXGSIPSSISTMQSLTSVDFSYNN  580

Query  640  L  642
            L
Sbjct  581  L  581


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P ++  
Sbjct  484  KFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISLCKLLTFVDLSRNELSGEIPKEITG  543

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  544  MRILNYLNLSRNHLXGSIPSSISTMQSLTSVDFSYNNLSGLV-PGTGQFSYFNYTSFLGN  602


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  364  KLTGTLPPDMCFGNSLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFX  423

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  424  LPKLTQVELQDNLLDGSFPETDTISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  483


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 51/107 (48%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  451  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFM  510

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+     L  + L  N  SG IP E      L YL +S N L
Sbjct  511  GSITPEISLCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHL  557



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   215 bits (547),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 136/178 (76%), Gaps = 1/178 (1%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            + ++   ALLS+K++ T+   S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20   IAMSNYRALLSLKSSITSXPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPKLSNLTRL  139

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPPE+GRFP LEYLAVSGN L
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPPEFGRFPFLEYLAVSGNEL  197


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 71/120 (59%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + PE G   +L+ + +S N
Sbjct  233  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNN  292


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L+ L +S N
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSN  364

Query  637  GL  642
             L
Sbjct  365  KL  366


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP+     NL+ L    N 
Sbjct  330  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNF  389

Query  640  L  642
            L
Sbjct  390  L  390


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +    N
Sbjct  450  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHN  508


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  462  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHC  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E   M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  581

Query  640  L  642
            L
Sbjct  582  L  582


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P +   
Sbjct  485  KFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHCKLLTFVDLSRNELSGEIPKEXTG  544

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  545  MRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLV-PGTGQFSYFNYTSFLGN  603


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    T P  +   
Sbjct  318  LHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFG  377

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NLQ L   +N L G +P  + +  SL  + +G NY +G IP      P L  + +  N
Sbjct  378  NNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDN  436


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 51/107 (48%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  452  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFM  511

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+     L  + L  N  SG IP E      L YL +S N L
Sbjct  512  GSITPEISHCKLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHL  558


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L   +N L GP+P  +    +L  + + +N    + P  L  
Sbjct  365  KLTGTLPPDMCFGNNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLS  424

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  425  LPKLTQVELQDNLLDGSFPETDSISGNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  484



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   213 bits (543),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  39   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  98

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  99   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  158

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VLDLYNNN+TGDLP+ V +M +LRHLHLGGN+F+G IPP YG++  LEYLAVSGN 
Sbjct  159  KRLEVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPPAYGQWEFLEYLAVSGNE  218

Query  640  L  642
            L
Sbjct  219  L  219


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  268  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  327

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L+ L VS N 
Sbjct  328  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPQGLGKNGKLQLLDVSSNK  387

Query  640  L  642
            L
Sbjct  388  L  388


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 71/122 (58%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G++ P  GQ  FL  L+++ N+L GP+PPEI  +++L+ L +   N +    P ++  
Sbjct  195  FTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGN  254

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  LD+ N  L+G++P E+ K+ +L  L L  N  SG + PE G   +L+ + +S N
Sbjct  255  LTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNN  314

Query  637  GL  642
             L
Sbjct  315  VL  316


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P VG    L  L +  N+ SG +PPEI  +  L  ++ SNN F      +++Q 
Sbjct  484  LTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQC  543

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  544  KVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYNN  603

Query  640  L  642
            L
Sbjct  604  L  604


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 58/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G L  L  +  + N+ SG + PEIS    L F++LS N      P ++  
Sbjct  507  KFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITG  566

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  567  MRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYNNLSGLV-PGTGQFSYFNYTSFLGN  625


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  412  LFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTP  471

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  + L NN LTG LP  V   + L+ L L GN FSGRIPPE G    L  +  S N
Sbjct  472  DSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNN  530


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  387  KLTGNLPPDMCSGNRLQTLITLGNFLFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFD  446

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG+ P       SL  + L  N  +G +PP  G F  L+ L + GN
Sbjct  447  LPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGN  506


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 56/116 (48%), Gaps = 1/116 (1%)
 Frame = +1

Query  298  PDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P++   P  L  +S++ NQL+G +PP +   S L+ L L  N F    P ++  L  L  
Sbjct  465  PEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSK  524

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +D  NN  +G++  E+ +   L  + L  N   G IP E      L YL +S N L
Sbjct  525  MDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHL  580



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   213 bits (543),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  20   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  79

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  80   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VLDLYNNN+TGDLP+ V +M +LRHLHLGGN+F+G IPP YG++  LEYLAVSGN 
Sbjct  140  KRLEVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPPAYGQWEFLEYLAVSGNE  199

Query  640  L  642
            L
Sbjct  200  L  200


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+   L+ L VS N 
Sbjct  309  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPQGLGKNGKLQLLDVSSNK  368

Query  640  L  642
            L
Sbjct  369  L  369


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 71/122 (58%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G++ P  GQ  FL  L+++ N+L GP+PPEI  +++L+ L +   N +    P ++  
Sbjct  176  FTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  LD+ N  L+G++P E+ K+ +L  L L  N  SG + PE G   +L+ + +S N
Sbjct  236  LTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNN  295

Query  637  GL  642
             L
Sbjct  296  VL  297


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P VG    L  L +  N+ SG +PPEI  +  L  ++ SNN F      +++Q 
Sbjct  465  LTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYNN  584

Query  640  L  642
            L
Sbjct  585  L  585


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 58/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G L  L  +  + N+ SG + PEIS    L F++LS N      P ++  
Sbjct  488  KFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITG  547

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  MRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  606


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTP  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  + L NN LTG LP  V   + L+ L L GN FSGRIPPE G    L  +  S N
Sbjct  453  DSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNN  511


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGNLPPDMCSGNRLQTLITLGNFLFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFD  427

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG+ P       SL  + L  N  +G +PP  G F  L+ L + GN
Sbjct  428  LPKLTQVELQDNYLTGEFPEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGN  487


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 56/116 (48%), Gaps = 1/116 (1%)
 Frame = +1

Query  298  PDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P++   P  L  +S++ NQL+G +PP +   S L+ L L  N F    P ++  L  L  
Sbjct  446  PEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSK  505

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +D  NN  +G++  E+ +   L  + L  N   G IP E      L YL +S N L
Sbjct  506  MDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHL  561



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   209 bits (533),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPPEYG +  LEYLAVSGN L
Sbjct  140  DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNEL  194


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G    L  L +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  362

Query  640  L  642
            L
Sbjct  363  L  363


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  542  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  600


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 57/118 (48%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  220  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  279

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  280  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWEN  337


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  + +L  + L +N     FP   +  
Sbjct  387  LFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSIS  446

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  + K + ++ L L GN FSG+IP E G+   L  +  S N
Sbjct  447  VNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHN  505


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362  KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  421

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  422  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S    L  + LSNN    + P  + + 
Sbjct  411  LNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKF  470

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            + +Q L L  N  +G +P E+ K+  L  +    N FSGRI PE  +   L ++ +S N 
Sbjct  471  SGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNE  530

Query  640  L  642
            L
Sbjct  531  L  531



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   209 bits (533),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPPEYG +  LEYLAVSGN L
Sbjct  140  DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNEL  194


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G    L  L +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  362

Query  640  L  642
            L
Sbjct  363  L  363


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  542  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  600


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 57/118 (48%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  220  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  279

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  280  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWEN  337


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  + +L  + L +N     FP   +  
Sbjct  387  LFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSIS  446

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  + K + ++ L L GN FSG+IP E G+   L  +  S N
Sbjct  447  VNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHN  505


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  362  KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  421

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  422  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  481


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S    L  + LSNN    + P  + + 
Sbjct  411  LNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKF  470

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            + +Q L L  N  +G +P E+ K+  L  +    N FSGRI PE  +   L ++ +S N 
Sbjct  471  SGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNE  530

Query  640  L  642
            L
Sbjct  531  L  531



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   209 bits (533),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +TE  ALLS+K++FT D  S LTSWN+ST+ C+W  VTCD  L  V+      LNLSG L
Sbjct  25   ITELNALLSLKSSFTIDEHSPLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL  84

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
            S DV  LP L NLS+AANQ+SGP+PPEIS +  LR LNLSNN+F  ++P +L+  L NL+
Sbjct  85   SSDVSHLPLLQNLSLAANQISGPIPPEISNLYELRHLNLSNNVFNGSYPDELSSGLVNLR  144

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLDLYNNNLTGDLPV +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L
Sbjct  145  VLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNEL  201


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SG +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  250  LTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNNMFTGEIPASFSQL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + +M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGGIPHKLGENGRLVILDLSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 59/115 (51%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  230  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLK  289

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  290  SMDLSNNMFTGEIPASFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWEN  344


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  467  LSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  526

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  527  KLLTFVDLSRNELSGDIPKEITGMRILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNN  586

Query  640  L  642
            L
Sbjct  587  L  587


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  237  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNN  296


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P ++  +
Sbjct  491  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPKEITGM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  551  RILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLV-PSTGQFSYFNYTSFLGN  608


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 59/119 (50%), Gaps = 6/119 (5%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +S D+GQ+      S++ NQLSGP+P  I   S ++ L L  N F    P ++ +L  
Sbjct  451  GGVSGDLGQI------SLSNNQLSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQ  504

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  LD  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  505  LSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPKEITGMRILNYLNLSRNHL  563


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     QL  L  L++  N+L G +P  I  +  L  L L  N F    PH+L + 
Sbjct  298  FTGEIPASFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGGIPHKLGEN  357

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L +LDL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  358  GRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENF  417

Query  640  L  642
            L
Sbjct  418  L  418


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 59/144 (41%), Gaps = 25/144 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  370  LTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGL  429

Query  460  ANLQVLDLYNNNLTGDLPVE-------------------------VYKMTSLRHLHLGGN  564
              L  ++L +N LTG+LP+                          +   + ++ L L GN
Sbjct  430  PKLSQVELQDNYLTGELPISGGGVSGDLGQISLSNNQLSGPLPAAIGNFSGVQKLLLDGN  489

Query  565  YFSGRIPPEYGRFPNLEYLAVSGN  636
             F+G IPPE GR   L  L  S N
Sbjct  490  KFAGPIPPEIGRLQQLSKLDFSHN  513



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   209 bits (533),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  22   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  81

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  82   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  141

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPPEYG +  LEYLAVSGN L
Sbjct  142  DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPPEYGIWEFLEYLAVSGNEL  196


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  245  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  304

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP   G    L  L +S N 
Sbjct  305  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIPQRLGSNGKLRILDLSSNK  364

Query  640  L  642
            L
Sbjct  365  L  365


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  484  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  543

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  544  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  602


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 57/118 (48%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  222  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  281

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  282  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWEN  339


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  + +L  + L +N     FP   +  
Sbjct  389  LFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSIS  448

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  + K + ++ L L GN FSG+IP E G+   L  +  S N
Sbjct  449  VNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHN  507


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  364  KLTGTLPPDMCAGNCLQTLITLGNFLFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFG  423

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  ++L +N LTG  PV      +L  + L  N  SG +P   G+F  ++ L + GN
Sbjct  424  LPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGN  483


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S    L  + LSNN    + P  + + 
Sbjct  413  LNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKF  472

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            + +Q L L  N  +G +P E+ K+  L  +    N FSGRI PE  +   L ++ +S N 
Sbjct  473  SGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNE  532

Query  640  L  642
            L
Sbjct  533  L  533



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS+++A T  +   LTSWN ST +C+W  VTCD+  HV SLDL+GL+LSG LS
Sbjct  25   ISEYRALLSLRSAITDATPPLLTSWNSSTPYCSWLGVTCDNRRHVTSLDLTGLDLSGPLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             DV  LPFL NLS+A+N+ SGP+PP +SA+S LRFLNLSNN+F  TFP +L++L NL+VL
Sbjct  85   ADVAHLPFLSNLSLASNKFSGPIPPSLSALSGLRFLNLSNNVFNETFPSELSRLQNLEVL  144

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TG LP+ V +M +LRHLHLGGN+FSG+IPPEYGR+  L+YLAVSGN L
Sbjct  145  DLYNNNMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNEL  199


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P +G+L  L  +  + N+ SGP+ PEIS    L FL+LS N      P+++  +
Sbjct  488  FTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITGM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  RILNYLNLSRNHLVGGIPSSISSMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P +  +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +L+L+ N L G +P  + ++ +L  + L  N F+G IP   G+   L  + +S N 
Sbjct  308  KNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSGVL P +G    +  L +  N  +G +PP+I  +  L  ++ S N F      +++Q 
Sbjct  464  LSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQC  523

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  524  KLLTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGGIPSSISSMQSLTSVDFSYNN  583

Query  640  L  642
            L
Sbjct  584  L  584


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLSGEFPEVGSVA  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   +S++ L L GN F+GRIPP+ GR   L  +  SGN
Sbjct  452  VNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGN  510


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+V+ L+ NN TG +P  + K   L  + L  N  +G +P        L+ L   GN 
Sbjct  332  PALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNKLTGTLPTYLCSGNTLQTLITLGNF  391

Query  640  L  642
            L
Sbjct  392  L  392


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 62/123 (50%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++GVL   V Q+  L +L +  N  SG +PPE      L++L +S N    T P ++  
Sbjct  150  NMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELEGTIPPEIGN  209

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L++L+ L + Y N  TG +P E+  ++ L  L       SG IP   G+   L+ L +  
Sbjct  210  LSSLRELYIGYYNTYTGGIPPEIGNLSELVRLDAAYCGLSGEIPAALGKLQKLDTLFLQV  269

Query  634  NGL  642
            N L
Sbjct  270  NAL  272


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = +1

Query  298  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P+VG +   L  ++++ NQLSG +PP I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  445  PEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSK  504

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +D   N  +G +  E+ +   L  L L  N  SG IP E      L YL +S N L
Sbjct  505  IDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHL  560


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P++G L  LV L  A   LSG +P  +  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPEIGNLSELVRLDAAYCGLSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLK  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P LE + +  N
Sbjct  285  SLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGELPALEVVQLWEN  342


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 52/110 (47%), Gaps = 0/110 (0%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            LP L  + +  N LSG  P   S    L  + LSNN      P  +   +++Q L L  N
Sbjct  427  LPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGN  486

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              TG +P ++ ++  L  +   GN FSG I PE  +   L +L +S N L
Sbjct  487  MFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQCKLLTFLDLSRNEL  536


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +    G+L  +  L++  N+L G +P  I  +  L  + L  N F  + P  L + 
Sbjct  296  LSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLGKN  355

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +    +L+ L   GN+  G IP   G   +L  + +  N 
Sbjct  356  GRLNLVDLSSNKLTGTLPTYLCSGNTLQTLITLGNFLFGPIPESLGSCESLTRIRMGENF  415

Query  640  L  642
            L
Sbjct  416  L  416


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 49/105 (47%), Gaps = 0/105 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  L    N L GP+P  + +  +L  + +  N    + P  L  L  L  ++L +N L+
Sbjct  382  LQTLITLGNFLFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLS  441

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            G+ P       +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  442  GEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGN  486



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 134/170 (79%), Gaps = 1/170 (1%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  312
            ALLS+K++   D  S L+SW  +TSHCTW  VTCDS  HV SLDLSGLNLSG LSPD+  
Sbjct  38   ALLSLKSSLD-DPDSRLSSWTPNTSHCTWAGVTCDSHNHVTSLDLSGLNLSGYLSPDIAF  96

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            L +L NL++A N LSGP+PPEISA+  LR LNLSNN+F  TFP +L+ L NL+VLDLYNN
Sbjct  97   LVYLSNLTLAENNLSGPIPPEISALPALRLLNLSNNVFNRTFPPELSNLTNLRVLDLYNN  156

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            NLTG LPV V  MT+LRHLHLGGN+F G IPPEYG+FP LEYLAVSGN +
Sbjct  157  NLTGVLPVSVTHMTNLRHLHLGGNFFEGSIPPEYGQFPFLEYLAVSGNSI  206


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 71/122 (58%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+
Sbjct  254  NLSGEIPPELGRLQNVDTLFLQVNALSGSLTSELGSLKSLKSMDLSNNLFSGEIPTSFAE  313

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   GR   L+ + +S N
Sbjct  314  LKNLTLLNLFRNQLHGAIPDFIGDLPELQVLQLWENNFTGSIPQSLGRNGKLQLVDLSSN  373

Query  637  GL  642
             L
Sbjct  374  KL  375


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  +
Sbjct  495  FSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRCKVLAYVDLSRNELSGEIPKEITGM  554

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G++P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  555  RILNYLNLSRNHLVGNIPAPISAMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  612


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N+F      ++++ 
Sbjct  471  LSGPLPPAIGNFTGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRC  530

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  531  KVLAYVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGNIPAPISAMQSLTSVDFSYNN  590

Query  640  L  642
            L
Sbjct  591  L  591


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  399  LFGPIPESLGECKSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNFLNGPFPVSDSVS  458

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            A L  + L NN L+G LP  +   T ++ L L GN FSGRIPPE G    L  +  S N
Sbjct  459  AGLGQISLSNNRLSGPLPPAIGNFTGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHN  517


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 54/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSGP+PP I   + ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  461  LGQISLSNNRLSGPLPPAIGNFTGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFS  520

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ +   L ++ L  N  SG IP E      L YL +S N L
Sbjct  521  GPIAPEISRCKVLAYVDLSRNELSGEIPKEITGMRILNYLNLSRNHL  567


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +     +L  L  L++  NQL G +P  I  +  L+ L L  N F  + P  L + 
Sbjct  303  FSGEIPTSFAELKNLTLLNLFRNQLHGAIPDFIGDLPELQVLQLWENNFTGSIPQSLGRN  362

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ++DL +N LTG LP ++    +L+ L   GN+  G IP   G   +L  + +  N 
Sbjct  363  GKLQLVDLSSNKLTGALPPDMCSGNNLQTLITLGNFLFGPIPESLGECKSLSRIRMGENF  422

Query  640  L  642
            L
Sbjct  423  L  423


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+GP P   S  + L  ++LSNN      P  +   
Sbjct  423  LNGSIPKGLFGLPKLTQVELQDNFLNGPFPVSDSVSAGLGQISLSNNRLSGPLPPAIGNF  482

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N  +G +P E+  +  L  +    N FSG I PE  R   L Y+ +S N 
Sbjct  483  TGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRCKVLAYVDLSRNE  542

Query  640  L  642
            L
Sbjct  543  L  543


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 52/119 (44%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  375  LTGALPPDMCSGNNLQTLITLGNFLFGPIPESLGECKSLSRIRMGENFLNGSIPKGLFGL  434

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N L G  PV       L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  435  PKLTQVELQDNFLNGPFPVSDSVSAGLGQISLSNNRLSGPLPPAIGNFTGVQKLLLDGN  493



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 133/178 (75%), Gaps = 3/178 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGV  291
            +TE  ALLS+K++FT D  S L TSWN+ST+ C+W  VTCD  L  V+      LNLSG 
Sbjct  25   ITELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGT  84

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  468
            LS DV  LP L NLS+AANQ+SGP+PP+IS +  LR LNLSNN+F  +FP +L+  L NL
Sbjct  85   LSSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDELSSGLVNL  144

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +VLDLYNNNLTGDLPV +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L
Sbjct  145  RVLDLYNNNLTGDLPVSLTNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNEL  202


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNNMFTGEIPTSFSQL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + +M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  311  KNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGSIPQKLGENGRLVILDLSSNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 59/115 (51%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLK  290

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  291  SMDLSNNMFTGEIPTSFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWEN  345


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  178  FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  LTG++P E+ K+  L  L L  N F+G I  E G   +L+ + +S N
Sbjct  238  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNN  297


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P++L  +
Sbjct  492  FSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNELTGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  552  KILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLV-PSTGQFSYFNYTSFVGN  609


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G L  +  L +  N+ SG +PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  468  LSGSLPAAIGNLSGVQKLLLDGNKFSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNELSGDIPNELTGMKILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P E+  +  L  + L +N      P     +
Sbjct  395  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKELFGLPKLSQVELQDNYLTGELPISGGGV  454

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            + +L  + L NN L+G LP  +  ++ ++ L L GN FSG IPPE GR   L  L  S N
Sbjct  455  SGDLGQISLSNNQLSGSLPAAIGNLSGVQKLLLDGNKFSGSIPPEIGRLQQLSKLDFSHN  514


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     QL  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  299  FTGEIPTSFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGSIPQKLGEN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L +LDL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  359  GRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENF  418

Query  640  L  642
            L
Sbjct  419  L  419



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   204 bits (520),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 133/186 (72%), Gaps = 7/186 (4%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  270
            AG+P  ++E  ALLS+K++ T    D  S LTSW +STS C W  VTCD     V+    
Sbjct  31   AGRP--ISEYHALLSLKSSLTGGENDQHSPLTSWKLSTSFCLWTGVTCDVSRRHVTSLDL  88

Query  271  g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
              LNLSG LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNNIF  ++P +
Sbjct  89   SGLNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEISNLSELRHLNLSNNIFNGSYPDE  148

Query  448  L-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  624
            L A L NLQVLDLYNNNLTGDLPV +  +T LRHLHLGGNYF+G IP  YG +P LEYLA
Sbjct  149  LSAGLVNLQVLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFAGNIPAVYGTWPVLEYLA  208

Query  625  VSGNGL  642
            VSGN L
Sbjct  209  VSGNEL  214


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++ +L  L  L +  N  SGP+ PE+  IS+L+ ++LSNN+F    P    QL
Sbjct  263  LTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIPASFEQL  322

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L  L +S N 
Sbjct  323  KNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLVILDLSSNK  382

Query  640  L  642
            L
Sbjct  383  L  383


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 62/111 (56%), Gaps = 1/111 (1%)
 Frame = +1

Query  307  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQVLDL  483
            G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  L+ L   D 
Sbjct  199  GTWPVLEYLAVSGNELVGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGNLSELVRFDA  258

Query  484  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             N  LTG++P E++K+  L  L L  N FSG + PE G   +L+ + +S N
Sbjct  259  ANCGLTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNN  309


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  243  LPPEIGNLSELVRFDAANCGLTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLK  302

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  303  SMDLSNNMFTGEIPASFEQLKNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWEN  357


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 61/121 (50%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +S ++GQ+      S++ NQLSGP+PP I   S ++ L L  N F    P ++ +L
Sbjct  461  VSGGVSVNLGQI------SLSNNQLSGPLPPAIGNFSGVQKLLLDGNKFSGQIPSEIGRL  514

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LD  +N  +G +  E+     L  + L  N  SG IP E      L YL +S N 
Sbjct  515  QQLSKLDFSHNLFSGRITPEISHCKLLTFVDLSRNELSGEIPNEITSMRILNYLNISRNH  574

Query  640  L  642
            L
Sbjct  575  L  575


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  382  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGECESLTRIRMGENFLNGSIPKGLLG  441

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  442  LPKLSQVELQDNYLTGELPVSGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLDGN  501


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  407  LFGSIPDSLGECESLTRIRMGENFLNGSIPKGLLGLPKLSQVELQDNYLTGELPVSGGVS  466

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN FSG+IP E GR   L  L  S N
Sbjct  467  VNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLDGNKFSGQIPSEIGRLQQLSKLDFSHN  525


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++     L  + ++ N+LSG +P EI+++  L +LN+S N    + P  +A +
Sbjct  527  FSGRITPEISHCKLLTFVDLSRNELSGEIPNEITSMRILNYLNISRNHLVGSIPVTIASM  586

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  587  QSLTSVDFSYNNLSGLVP  604



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 141/184 (77%), Gaps = 5/184 (3%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllh-vvsldlsg  273
            A +P   TE  ALLS+K + T+  QSS LTSWN+S S C W  VTCD  L  V SLDLS 
Sbjct  17   AARP--TTELHALLSLKTSLTSGEQSSSLTSWNLSKSFCLWAGVTCDVSLRHVTSLDLSS  74

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-  450
            LNLSG LS DV  LP L NLS+AANQ+SGP+PPEI+ +S LR LNLSNN+F  ++P+QL 
Sbjct  75   LNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEIANLSELRHLNLSNNVFNGSYPNQLS  134

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  630
            A+LANLQVLDLYNNNLTGDLPV +  +T LRHLHLGGNYF+GRIP  YG +P LEYLAVS
Sbjct  135  ARLANLQVLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFTGRIPAVYGSWPVLEYLAVS  194

Query  631  GNGL  642
            GN L
Sbjct  195  GNEL  198


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P    QL
Sbjct  247  LTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIPASFEQL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L  L +S N 
Sbjct  307  KNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGRLVILDLSSNK  366

Query  640  L  642
            L
Sbjct  367  L  367


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 63/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L P +G    +  L +  N+  GP+PPEI  +  L  L+ S+N+F      +++Q
Sbjct  463  HLSGPLPPAIGNFSGVQKLLLDGNKFGGPIPPEIGRLQQLSKLDFSHNLFPGRIAPEISQ  522

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  523  CKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPVTMASMQSLTSVDFSYN  582

Query  637  GL  642
             L
Sbjct  583  NL  584


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (56%), Gaps = 1/111 (1%)
 Frame = +1

Query  307  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQVLDL  483
            G  P L  L+++ N+L G +PPEI  ++TL+ L +   N F +  P ++ +L+ L   D 
Sbjct  183  GSWPVLEYLAVSGNELVGKIPPEIGNLTTLKELYIGYYNAFENGLPPEIGKLSELVRFDA  242

Query  484  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  243  ANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNN  293


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 58/117 (50%), Gaps = 1/117 (1%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G+L  L  L  + N   G + PEIS    L F++LS N      P+++  +  
Sbjct  490  GPIPPEIGRLQQLSKLDFSHNLFPGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRI  549

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  550  LNYLNLSRNHLLGSIPVTMASMQSLTSVDFSYNNLSGLV-PSTGQFSYFNYTSFLGN  605


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 6/119 (5%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            GV+S ++GQ+      S++ N LSGP+PP I   S ++ L L  N FG   P ++ +L  
Sbjct  448  GVVSVNLGQI------SLSNNHLSGPLPPAIGNFSGVQKLLLDGNKFGGPIPPEIGRLQQ  501

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  LD  +N   G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  502  LSKLDFSHNLFPGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHL  560


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L  ++     L+ L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  367  LTGTLPVNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGL  426

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N LTG+LP+    ++ +L  + L  N+ SG +PP  G F  ++ L + GN
Sbjct  427  PKLSQVELQDNYLTGELPIGGGVVSVNLGQISLSNNHLSGPLPPAIGNFSGVQKLLLDGN  486



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   202 bits (514),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 143/188 (76%), Gaps = 1/188 (1%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvs-  258
            H     A +P  ++E  AL+SIKAA + +++ +L SWN   SHC+WR VTCDSL   V+ 
Sbjct  15   HLQRCAAVRPPRMSEYHALVSIKAAISEEARPALASWNSGASHCSWRGVTCDSLGRHVTG  74

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            LD+S L+LSG LSPDVGQL FLVNLS AAN LSGPVP EI+ I  LR+LNLSNN+F  +F
Sbjct  75   LDISNLSLSGSLSPDVGQLLFLVNLSAAANLLSGPVPAEIADIPNLRYLNLSNNVFNLSF  134

Query  439  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  618
            P +L +L NLQVLDLYNNN+TGD P   Y + +LRHLHLGGN+F+G +PPE+G FP+LEY
Sbjct  135  PTELYRLKNLQVLDLYNNNMTGDFPSRAYLLANLRHLHLGGNFFTGTMPPEFGSFPHLEY  194

Query  619  LAVSGNGL  642
            LAVSGN L
Sbjct  195  LAVSGNEL  202


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 69/122 (57%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P+ G  P L  L+++ N+LSG +PPE+  ++ L+ L +   N F    P ++  
Sbjct  178  FTGTMPPEFGSFPHLEYLAVSGNELSGTIPPELGNLTQLKELYVGYYNTFSGGLPKEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+NL  LD  +  L+GD+P E+  + +L  L L  N FSG + PE G   NL+ + +S N
Sbjct  238  LSNLLRLDAASCGLSGDIPSEIGMLQNLDTLFLQVNGFSGGLTPELGNLKNLKSMDLSNN  297

Query  637  GL  642
             L
Sbjct  298  AL  299


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N  SG + PE+  +  L+ ++LSNN      P   A+L
Sbjct  251  LSGDIPSEIGMLQNLDTLFLQVNGFSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L+ L L  N F+G IP   G   NL+ + +S N 
Sbjct  311  KNLTLLNLFRNKLNGSIPNFIGELPQLQVLQLWENNFTGSIPENLGSNGNLQEVDLSSNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L+P++G L  L ++ ++ N LSG +P   + +  L  LNL  N    + P+ + +L
Sbjct  275  FSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGEL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQVL L+ NN TG +P  +    +L+ + L  N  +G + P+      L  L   GN 
Sbjct  335  PQLQVLQLWENNFTGSIPENLGSNGNLQEVDLSSNKLTGSLSPKLCHGNQLHTLITLGNF  394

Query  640  L  642
            L
Sbjct  395  L  395


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (51%), Gaps = 6/118 (5%)
 Frame = +1

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            VLS ++GQ+      S++ N LSGP+PP I     ++   L  N F  + P ++ +L  L
Sbjct  452  VLSQNLGQI------SLSNNHLSGPLPPSIGNFVAVQKFLLDGNSFSGSIPAEIGKLQQL  505

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              +D  +N  +G +P E+ +   L  + L  N  +GR+P E      L YL +S N L
Sbjct  506  SKMDFSSNKFSGQIPPELSQCKQLAFVDLSRNQLNGRVPSEISAMKILNYLNLSRNQL  563


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  L +  N +SGP P        L  ++LSNN      P  +   
Sbjct  419  LNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVLSQNLGQISLSNNHLSGPLPPSIGNF  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q   L  N+ +G +P E+ K+  L  +    N FSG+IPPE  +   L ++ +S N 
Sbjct  479  VAVQKFLLDGNSFSGSIPAEIGKLQQLSKMDFSSNKFSGQIPPELSQCKQLAFVDLSRNQ  538

Query  640  L  642
            L
Sbjct  539  L  539


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +G    L  + +  N L+G +P  + ++  L  L L +N+    FP      
Sbjct  395  LTGPIPDSMGHCESLSRVRMGENYLNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVLS  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN+L+G LP  +    +++   L GN FSG IP E G+   L  +  S N
Sbjct  455  QNLGQISLSNNHLSGPLPPSIGNFVAVQKFLLDGNSFSGSIPAEIGKLQQLSKMDFSSN  513


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 58/123 (47%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G        L  L +L +  N  +G +PPE  +   L +L +S N    T P +L  
Sbjct  153  NMTGDFPSRAYLLANLRHLHLGGNFFTGTMPPEFGSFPHLEYLAVSGNELSGTIPPELGN  212

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L  L+ L + Y N  +G LP E+  +++L  L       SG IP E G   NL+ L +  
Sbjct  213  LTQLKELYVGYYNTFSGGLPKEIGNLSNLLRLDAASCGLSGDIPSEIGMLQNLDTLFLQV  272

Query  634  NGL  642
            NG 
Sbjct  273  NGF  275


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++ Q   L  + ++ NQL+G VP EISA+  L +LNLS N      P  ++ +
Sbjct  515  FSGQIPPELSQCKQLAFVDLSRNQLNGRVPSEISAMKILNYLNLSRNQLDGNIPSSISSM  574

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NN TG +P
Sbjct  575  QSLTSVDFSYNNFTGLVP  592


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +     +L  L  L++  N+L+G +P  I  +  L+ L L  N F  + P  L   
Sbjct  299  LSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGELPQLQVLQLWENNFTGSIPENLGSN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NLQ +DL +N LTG L  ++     L  L   GN+ +G IP   G   +L  + +  N 
Sbjct  359  GNLQEVDLSSNKLTGSLSPKLCHGNQLHTLITLGNFLTGPIPDSMGHCESLSRVRMGENY  418

Query  640  L  642
            L
Sbjct  419  L  419


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G LSP +     L  L    N L+GP+P  +    +L  + +  N      P  L  L
Sbjct  371  LTGSLSPKLCHGNQLHTLITLGNFLTGPIPDSMGHCESLSRVRMGENYLNGHIPKGLLSL  430

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L +N ++G  P       +L  + L  N+ SG +PP  G F  ++   + GN
Sbjct  431  PMLTQLELQDNLISGPFPETDVLSQNLGQISLSNNHLSGPLPPSIGNFVAVQKFLLDGN  489



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS+++  T  +   L+SWN S  +C+W  VTCD+  HV +L+L+GL+LSG LS
Sbjct  25   ISEYRALLSLRSVITDATPPVLSSWNASIPYCSWLGVTCDNRRHVTALNLTGLDLSGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             DV  LPFL NLS+AAN+ SGP+PP +SA+S LR+LNLSNN+F  TFP +L +L +L+VL
Sbjct  85   ADVAHLPFLSNLSLAANKFSGPIPPSLSALSGLRYLNLSNNVFNETFPSELWRLQSLEVL  144

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TG LP+ V +M +LRHLHLGGN+FSG+IPPEYGR+  L+YLAVSGN L
Sbjct  145  DLYNNNMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNEL  199


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+V+ L+ NNLTG +P  + K   L  + L  N  +G +PP       L+ L   GN 
Sbjct  332  PALEVVQLWENNLTGSIPEGLGKNGRLNLVDLSSNKLTGTLPPYLCSGNTLQTLITLGNF  391

Query  640  L  642
            L
Sbjct  392  L  392


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +G+L  L  +  + N+ SGP+ PEIS    L FL+LS N      P+++  +
Sbjct  488  FTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQCKLLTFLDLSRNELSGDIPNEITGM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  RILNYLNLSKNHLVGSIPSSISSMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LSP +G    +  L +  N  +G +P +I  +  L  ++ S N F      +++Q 
Sbjct  464  LSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQC  523

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  524  KLLTFLDLSRNELSGDIPNEITGMRILNYLNLSKNHLVGSIPSSISSMQSLTSVDFSYNN  583

Query  640  L  642
            L
Sbjct  584  L  584


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +L+L+ N L G +P  + ++ +L  + L  N  +G IP   G+   L  + +S N 
Sbjct  308  KNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNLTGSIPEGLGKNGRLNLVDLSSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 62/123 (50%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++GVL   V Q+  L +L +  N  SG +PPE      L++L +S N    T P ++  
Sbjct  150  NMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELDGTIPPEIGN  209

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N  TG +P E+  ++ L  L +     SG IP   G+   L+ L +  
Sbjct  210  LTSLRELYIGYYNTYTGGIPPEIGNLSELVRLDVAYCALSGEIPAALGKLQKLDTLFLQV  269

Query  634  NGL  642
            N L
Sbjct  270  NAL  272


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P++G L  LV L +A   LSG +P  +  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPEIGNLSELVRLDVAYCALSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLK  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P LE + +  N L
Sbjct  285  SLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNL  344


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGTCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGEFPEVGSVA  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G L   +   +S++ L L GN F+GRIP + GR   L  +  SGN
Sbjct  452  VNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGN  510


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 58/116 (50%), Gaps = 1/116 (1%)
 Frame = +1

Query  298  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P+VG +   L  ++++ NQLSG + P I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  445  PEVGSVAVNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSK  504

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +D   N  +G +  E+ +   L  L L  N  SG IP E      L YL +S N L
Sbjct  505  IDFSGNKFSGPIAPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSKNHL  560


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG  P   S    L  + LSNN         +   
Sbjct  416  LNGSIPKGLFGLPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLSGALSPSIGNF  475

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            +++Q L L  N  TG +P ++ ++  L  +   GN FSG I PE  +   L +L +S N 
Sbjct  476  SSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQCKLLTFLDLSRNE  535

Query  640  L  642
            L
Sbjct  536  L  536



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   202 bits (513),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS++ A T  +   L+SWN ST+HC W  VTCD+  HV +L+L+GLNLSG L+
Sbjct  23   ISEYRALLSLREAITDTNPPILSSWNPSTTHCIWLGVTCDTRRHVTALNLTGLNLSGTLA  82

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             D+  LPFL NLS+A N+ SG +PP +SA+S LR LNLSNN+F  TFP +L+QL +L+VL
Sbjct  83   ADIAHLPFLSNLSLADNKFSGEIPPSLSAVSGLRLLNLSNNVFNGTFPSELSQLKSLEVL  142

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TG LP+ V ++ +LRHLHLGGNYF+G+IPPEYG + +LEYLAVSGN L
Sbjct  143  DLYNNNMTGTLPLAVTELPNLRHLHLGGNYFTGQIPPEYGLWQHLEYLAVSGNEL  197


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   +QL
Sbjct  246  LSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  306  KNLTLLNLFRNKLHGAIPEFIGDMPALEVVQLWENNFTGNIPMGLGSNGKLTLLDLSSNK  365

Query  640  L  642
            L
Sbjct  366  L  366


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +G+L  L N+  + N+ SGP+  EIS    L F++LS N      P+++  +
Sbjct  486  FTGKIPSQIGRLQQLSNIDFSHNKFSGPIASEISQCKLLTFVDLSRNELSGVIPNEITGM  545

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P+ +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  546  RILNYLNLSRNHLVGSIPISISSMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  603


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  223  AGGIPPEIGNLTELVRLDAAYCGLSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLK  282

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE + +  N
Sbjct  283  SLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDMPALEVVQLWEN  340


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  +
Sbjct  270  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDM  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+V+ L+ NN TG++P+ +     L  L L  N  +G +PP       L+ L   GN 
Sbjct  330  PALEVVQLWENNFTGNIPMGLGSNGKLTLLDLSSNKLTGTLPPYLCSGNRLQTLITLGNF  389

Query  640  L  642
            L
Sbjct  390  L  390


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 59/123 (48%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G L   V +LP L +L +  N  +G +PPE      L +L +S N    T P  +  
Sbjct  148  NMTGTLPLAVTELPNLRHLHLGGNYFTGQIPPEYGLWQHLEYLAVSGNELDGTIPPGIGN  207

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N   G +P E+  +T L  L       SG IP E G+   L+ L +  
Sbjct  208  LTSLRELYIGYYNTYAGGIPPEIGNLTELVRLDAAYCGLSGEIPAEMGKLQKLDTLFLQV  267

Query  634  NGL  642
            N L
Sbjct  268  NAL  270


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  390  LFGPIPESLGSCESLNRIRMGDNFLNGSIPKGLFGLPKLTQVELQDNYLSGNFPETHSVS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   TS++   L GN F+G+IP + GR   L  +  S N
Sbjct  450  VNLGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGNMFTGKIPSQIGRLQQLSNIDFSHN  508


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 54/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  ++++ NQLSG +PP I   ++++   L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  452  LGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGNMFTGKIPSQIGRLQQLSNIDFSHNKFS  511

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  512  GPIASEISQCKLLTFVDLSRNELSGVIPNEITGMRILNYLNLSRNHL  558


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P +     L  L    N L GP+P  + +  +L  + + +N    + P  L  L
Sbjct  366  LTGTLPPYLCSGNRLQTLITLGNFLFGPIPESLGSCESLNRIRMGDNFLNGSIPKGLFGL  425

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F +++   + GN
Sbjct  426  PKLTQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGN  484


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 54/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     QL  L  L++  N+L G +P  I  +  L  + L  N F    P  L   
Sbjct  294  LTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDMPALEVVQLWENNFTGNIPMGLGSN  353

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L +LDL +N LTG LP  +     L+ L   GN+  G IP   G   +L  + +  N 
Sbjct  354  GKLTLLDLSSNKLTGTLPPYLCSGNRLQTLITLGNFLFGPIPESLGSCESLNRIRMGDNF  413

Query  640  L  642
            L
Sbjct  414  L  414



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 130/177 (73%), Gaps = 2/177 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +TE  ALLS+K++ T D  S L SWN+ST+ C+W  VTCD     V+      L+LSG L
Sbjct  22   ITELQALLSLKSSLTGDEHSPLNSWNLSTTFCSWTGVTCDVSRRHVTSLDLSGLDLSGTL  81

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
            S DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L NL+
Sbjct  82   SSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRHLNLSNNVFNGSYPDELSSGLVNLR  141

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLDLYNNNLTG LP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L
Sbjct  142  VLDLYNNNLTGVLPLSITNLTELRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNEL  198


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++ SNN+F    P   A+L
Sbjct  247  LTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNNMFTGEIPASFAEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  307  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGENGRLVILDLSSNK  366

Query  640  L  642
            L
Sbjct  367  L  367


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F  T   +L  +++L+
Sbjct  227  LPPEIGNLSELVRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLK  286

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +D  NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  287  SMDFSNNMFTGEIPASFAELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWEN  341


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  463  LSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  522

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  523  KLLTFVDLSRNELSGDIPNEITGMKILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNN  582

Query  640  L  642
            L
Sbjct  583  L  583


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  487  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  546

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  547  KILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLV-PSTGQFSYFNYTSFLGN  604


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  
Sbjct  174  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGN  233

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  LTG +P E+ K+ +L  L L  N F+G +  E G   +L+ +  S N
Sbjct  234  LSELVRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNN  293


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 61/121 (50%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +S D+GQ+      S++ NQLSGP+P  I   S ++ L L  N F    P ++ +L
Sbjct  445  ISGGVSGDLGQI------SLSNNQLSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRL  498

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LD  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  499  QQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGMKILNYLNLSRNH  558

Query  640  L  642
            L
Sbjct  559  L  559


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  391  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLTGGLPISGGVS  450

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  + L NN L+G LP  +   + ++ L L GN F+G IPPE GR   L  L  S N
Sbjct  451  GDLGQISLSNNQLSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHN  509


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F    P +L + 
Sbjct  295  FTGEIPASFAELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGEN  354

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L +LDL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  355  GRLVILDLSSNKLTGTLPPNMCSGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGENF  414

Query  640  L  642
            L
Sbjct  415  L  415



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 146/196 (74%), Gaps = 9/196 (5%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTS-------HCTWRRVTCd  237
            R  A A A  P  +TE  ALLSI+AA T D QS+L+SW  + +       HC+W+ VTCD
Sbjct  17   RRGAAASAA-PTRLTEPLALLSIRAAVTGDPQSALSSWTSAAAAAANGSSHCSWQGVTCD  75

Query  238  -sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS  414
                HV +LDLS L L+G LSPDV  L FL++LS+AANQLSGP+PP+ISA++ LR+LNLS
Sbjct  76   PRRRHVTALDLSSLELAGALSPDVAHLRFLISLSVAANQLSGPIPPQISALAALRYLNLS  135

Query  415  NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY  594
            NN+F  TFP +L  L NL+VLDLYNNN+TGDLPV V +M  LRHLHLGGNYF GRIPPEY
Sbjct  136  NNVFNGTFPPRLGLLRNLRVLDLYNNNMTGDLPVAVAEMPQLRHLHLGGNYFGGRIPPEY  195

Query  595  GRFPNLEYLAVSGNGL  642
            GR+  +EYLAVSG+ L
Sbjct  196  GRWEFIEYLAVSGDEL  211


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++ +L  L  L +  N  +G +P EI  +++L+ L+LSNN+F    P   +QL
Sbjct  260  LSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQL  319

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L L+ N L G++P  +  +  L+ L L  N F+G IP   G+  +L+ + +S N 
Sbjct  320  KNLTLLHLFRNKLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKNGHLQIVDLSSNK  379

Query  640  L  642
            L
Sbjct  380  L  380


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G+L  L  +  ++N+ SGP+P +IS    L F++LS N      P+++  
Sbjct  500  NFSGQIPPEIGRLQQLAKIDFSSNRYSGPIPAQISQCKLLTFVDLSGNELSGEIPNEITG  559

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L +NNL+G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  560  MRILNYLNLSSNNLSGSIPPSISTMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  618


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G + P++G L  L  L +   N   G +PPEI  +S L  L+ ++       P ++A+
Sbjct  211  LTGAIPPEIGNLTTLRELYLGYYNSYDGSLPPEIGNLSQLVRLDAASCGLSGEIPPEIAK  270

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  L L  N   G LP E+  + SL+ L L  N F+G IP  + +  NL  L +  N
Sbjct  271  LQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQLKNLTLLHLFRN  330

Query  637  GL  642
             L
Sbjct  331  KL  332


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     QL  L  L +  N+L+G +P  I+ +  L+ L L  N F  + P  L + 
Sbjct  308  FAGEIPESFSQLKNLTLLHLFRNKLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKN  367

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +LQ++DL +N LTG LP ++     L+ L    NY  G IP   G+  +LE + + GN 
Sbjct  368  GHLQIVDLSSNKLTGTLPPDLCYGNQLQILIALSNYLLGPIPESLGKCRSLERIRMGGNY  427

Query  640  L  642
            L
Sbjct  428  L  428


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 61/148 (41%), Gaps = 31/148 (21%)
 Frame = +1

Query  277  NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
             L+G L PD+    QL  L+ LS   N L GP+P  +    +L  + +  N    + P  
Sbjct  379  KLTGTLPPDLCYGNQLQILIALS---NYLLGPIPESLGKCRSLERIRMGGNYLNGSIPRG  435

Query  448  LAQLANLQVLD-------------------------LYNNNLTGDLPVEVYKMTSLRHLH  552
            L  L  L  ++                         L NN L G LP  +   + ++ L 
Sbjct  436  LFGLPELNQVEFQDNLLVGEFPVSDDSIALKLGQITLSNNKLGGSLPPTIGNFSGVQKLL  495

Query  553  LGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L GN FSG+IPPE GR   L  +  S N
Sbjct  496  LDGNNFSGQIPPEIGRLQQLAKIDFSSN  523


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G +   +  LP L  L +  N  +G +P  +     L+ ++LS+N    T P  L  
Sbjct  331  KLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKNGHLQIVDLSSNKLTGTLPPDLCY  390

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               LQ+L   +N L G +P  + K  SL  + +GGNY +G IP      P L  +    N
Sbjct  391  GNQLQILIALSNYLLGPIPESLGKCRSLERIRMGGNYLNGSIPRGLFGLPELNQVEFQDN  450


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 54/111 (49%), Gaps = 1/111 (1%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAIS-TLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
            LP L  +    N L G  P    +I+  L  + LSNN  G + P  +   + +Q L L  
Sbjct  439  LPELNQVEFQDNLLVGEFPVSDDSIALKLGQITLSNNKLGGSLPPTIGNFSGVQKLLLDG  498

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            NN +G +P E+ ++  L  +    N +SG IP +  +   L ++ +SGN L
Sbjct  499  NNFSGQIPPEIGRLQQLAKIDFSSNRYSGPIPAQISQCKLLTFVDLSGNEL  549



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   200 bits (509),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 131/176 (74%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            V+E  ALLSIK++ T D QS L++WN +T  C+W  +TCD     V+      LNLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTTPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S DV  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88   SSDVAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNN+TG LP+ V +M +LRHLHLGGNY+SG+IP EYG++  LEYLA+SGN L
Sbjct  148  LDLYNNNMTGGLPLTVVEMPNLRHLHLGGNYYSGKIPSEYGKWGFLEYLAISGNEL  203


 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 71/121 (59%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L+ L L  N F+  IP   G+   LE L +S N 
Sbjct  312  KNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQNGKLEILDLSSNK  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLVGSIPAPIATMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQVL L+ NN T  +P  + +   L  L L  N  +G +PP      NL+ L    N 
Sbjct  336  PELQVLQLWENNFTSTIPQALGQNGKLEILDLSSNKLTGTLPPNMCLGNNLQTLITLSNF  395

Query  640  L  642
            L
Sbjct  396  L  396


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  396  LFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLA  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  L L NN LTG LP  V   + ++   L GN FSG IPPE GR   L  +  S N
Sbjct  456  VNLGQLSLSNNRLTGSLPPSVGNFSGVQKFLLDGNKFSGSIPPEIGRLQQLTKMDFSHN  514


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I+ +  L+ L L  N F ST P  L Q 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L++LDL +N LTG LP  +    +L+ L    N+  G IP   G+  +L  + +  N 
Sbjct  360  GKLEILDLSSNKLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENF  419

Query  640  L  642
            L
Sbjct  420  L  420


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFD  430

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  ++L +N L G+ PV      +L  L L  N  +G +PP  G F  ++   + GN
Sbjct  431  LPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNFSGVQKFLLDGN  490



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 131/181 (72%), Gaps = 6/181 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNE  202

Query  640  L  642
            L
Sbjct  203  L  203


 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +
Sbjct  292  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL  343


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
               G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITG  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  563

Query  640  L  642
            L
Sbjct  564  L  564


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            LP L  + +  N LSG +P        L  ++LSNN      P  +     +Q L L  N
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
               G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N L
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNEL  540


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L    N L G +P  +    +L  + +  N   ++ P  L  
Sbjct  371  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNASIPKGLFG  430

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGQNF  419

Query  640  L  642
            L
Sbjct  420  L  420


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+  +P  +  +  L  + L +N      P      
Sbjct  396  LFGSIPDSLGKCESLTRIRMGQNFLNASIPKGLFGLPKLTQVELQDNYLSGELPVAGGVS  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   T ++ L L GN F G+IP E G+   L  +  S N
Sbjct  456  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHN  514



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 131/181 (72%), Gaps = 6/181 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNE  202

Query  640  L  642
            L
Sbjct  203  L  203


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +
Sbjct  292  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL  343


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
               G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITG  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  563

Query  640  L  642
            L
Sbjct  564  L  564


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  480  TGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  539

Query  640  L  642
            L
Sbjct  540  L  540


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + I  N L+G +P  +  +  L  + L +N      P      
Sbjct  396  LFGSIPDSLGKCESLTRIRIGQNFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVS  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   T ++ L L GN F G+IP E G+   L  +  S N
Sbjct  456  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHN  514


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRIGQNF  419

Query  640  L  642
            L
Sbjct  420  L  420


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRIGQNFLNGSIPKGLFG  430

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   199 bits (505),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 131/179 (73%), Gaps = 4/179 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNIS-TSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            +TE  ALLS+K++ T D  S L TSWN+S T+ C+W  V CD     V+      LNLSG
Sbjct  23   ITELNALLSLKSSLTGDDHSPLLTSWNLSSTTFCSWTGVKCDVSRRHVTSLDLSGLNLSG  82

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  465
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISKLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L+VLDLYNNNLTGDLP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L
Sbjct  143  LRVLDLYNNNLTGDLPLSITNLTELRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNEL  201


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  +GP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  466  LSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  525

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  526  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNN  585

Query  640  L  642
            L
Sbjct  586  L  586


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  
Sbjct  489  KFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITG  548

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  549  MRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNNLSGLV-PSTGQFSYFNYTSFLGN  607


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  L+    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  230  LPPEIGNLTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLK  289

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  290  SMDLSNNMFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWEN  344


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L   D  N  LTG +P E+ K+ +L  L L  N F+G +  E G   +L+ + +S N
Sbjct  237  LTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNN  296


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  394  LFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVS  453

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            ++L  + L NN L+G LP  +   + ++ L L GN F+G IPPE GR   L  L  S N
Sbjct  454  SDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHN  512


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFG  428

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG+LP+     + L  + L  N  SG +P   G F  ++ L + GN
Sbjct  429  LPKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGN  488



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   198 bits (504),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 133/177 (75%), Gaps = 2/177 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCds-llhvvsldlsglNLSGV  291
            ++E   LLS K++  T D   SL SWN ST+HC+W  +TC     HV S+DLS L L+  
Sbjct  22   ISEHKTLLSFKSSSITDDPTHSLISWNSSTTHCSWHGITCTGPHRHVTSIDLSSLTLTAT  81

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LS  +  LPFL NLS+A N+ SGP+PP  S++ +LRFLNLSNN+F  TFP QL++L+NL 
Sbjct  82   LSDHLSNLPFLSNLSLADNKFSGPIPPSFSSLYSLRFLNLSNNVFNGTFPSQLSRLSNLH  141

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLDLYNNN+TG LP+ V +M +LRHLHLGGN+F+G+IPPEYG +P+LEYLAVSGN L
Sbjct  142  VLDLYNNNMTGTLPLSVTRMQNLRHLHLGGNFFTGKIPPEYGTWPHLEYLAVSGNEL  198


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN F    P   A+L
Sbjct  247  LTGEIPPELGKLQNLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + +M +L  L +  N F+G IP   G+   L  + VS N 
Sbjct  307  KNLTLLNLFRNKLHGAIPEFIGEMPALEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNK  366

Query  640  L  642
            L
Sbjct  367  L  367


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP  ++  
Sbjct  391  LFGPIPDSLGKCESLSRIRMGENFLNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMS  450

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   TS++ L L GN F+G+IP E G+   L  +  S N
Sbjct  451  PNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGNQFTGKIPSEIGKLQQLSKIDFSHN  509


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  ++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  487  FTGKIPSEIGKLQQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPNEITGM  546

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  +    N  +G +P   G+F    Y +  GN
Sbjct  547  RILNYLNLSRNHLVGTIPGSIASMQSLTSVDFSYNNLTGLVPGT-GQFSYFNYTSFLGN  604


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 62/122 (51%), Gaps = 2/122 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N   G VP   + +  L  LNL  N      P  + ++
Sbjct  271  LSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAELKNLTLLNLFRNKLHGAIPEFIGEM  330

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN-LEYLAVSGN  636
              L+VL ++ NN TG +P  + K   L  + +  N  +G +PP Y  F N L+ L   GN
Sbjct  331  PALEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPP-YMCFGNKLQTLITLGN  389

Query  637  GL  642
             L
Sbjct  390  FL  391


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG     V   P L  ++++ N+LSGP+P  I   ++++ L L  N F    P ++ +L
Sbjct  439  LSGEFPQPVSMSPNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGNQFTGKIPSEIGKL  498

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N  +G +  E+     L  + L  N  SG IP E      L YL +S N 
Sbjct  499  QQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  558

Query  640  L  642
            L
Sbjct  559  L  559


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG  P  +S    L  + LSNN      P  +   
Sbjct  415  LNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMSPNLGQVTLSNNKLSGPLPSSIGNF  474

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             ++Q L L  N  TG +P E+ K+  L  +    N FSG I PE      L ++ +S N 
Sbjct  475  TSVQKLLLDGNQFTGKIPSEIGKLQQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNE  534

Query  640  L  642
            L
Sbjct  535  L  535



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   198 bits (504),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 131/181 (72%), Gaps = 6/181 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPPLYGSWPVIEYLAVSGNE  202

Query  640  L  642
            L
Sbjct  203  L  203


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPEKLGENGKLNLVDLSSNK  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLK  291

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +
Sbjct  292  SMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQL  343


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179  FAGKIPPLYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNN  298


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  492  FEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  552  RILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  563

Query  640  L  642
            L
Sbjct  564  L  564


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 54/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  +    N LSG +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  480  TGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  539

Query  640  L  642
            L
Sbjct  540  L  540


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +   +G+   L  + +  N L+G +P  +  +  L  +   +N      P       N
Sbjct  398  GSIPESLGKCESLTRIRMGQNFLNGSIPKGLFGLPKLTQVEFQDNYLSGELPVAGGVSVN  457

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  + L NN L+G LP  +   T ++ L L GN F G+IP E G+   L  +  S N
Sbjct  458  LGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHN  514


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPEKLGEN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFVFGSIPESLGKCESLTRIRMGQNF  419

Query  640  L  642
            L
Sbjct  420  L  420


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/119 (28%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L  L    N + G +P  +    +L  + +  N    + P  L  L
Sbjct  372  LTGTLPPNMCSGNKLETLITLGNFVFGSIPESLGKCESLTRIRMGQNFLNGSIPKGLFGL  431

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++  +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  432  PKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   198 bits (504),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 132/179 (74%), Gaps = 4/179 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  288
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  23   ITEFNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  82

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  465
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L+VLDLYNNNLTGDLP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L
Sbjct  143  LRVLDLYNNNLTGDLPLSITNLTELRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNEL  201


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + PD+G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  490  FTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  550  RILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNNLSGLV-PSTGQFSYFNYTSFLGN  607


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L   D  N  LTG +P E+ K+ +L  L L  N FSG +  E G   +L+ + +S N
Sbjct  237  LTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNN  296


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +GP+PP+I  +  L  L+ S+N+F      ++++ 
Sbjct  466  LSGSLPAAIGNFSGVQKLLLDGNKFTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEISRC  525

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  526  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNN  585

Query  640  L  642
            L
Sbjct  586  L  586


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  L+    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  230  LPPEIGNLTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLK  289

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  290  SMDLSNNMFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWEN  344


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  394  LFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPISGGVS  453

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            ++L  + L NN L+G LP  +   + ++ L L GN F+G IPP+ GR   L  L  S N
Sbjct  454  SDLGQVSLSNNKLSGSLPAAIGNFSGVQKLLLDGNKFTGPIPPDIGRLQQLSKLDFSHN  512


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  370  LTGTLPPNMCSGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFGL  429

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N LTG+LP+     + L  + L  N  SG +P   G F  ++ L + GN
Sbjct  430  PKLSQVELQDNYLTGELPISGGVSSDLGQVSLSNNKLSGSLPAAIGNFSGVQKLLLDGN  488



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 130/176 (74%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            V+E  ALLSIK++ T D QS L++WN +   C+W  +TCD     V+      LNLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTAPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S D+  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88   SSDIAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNN+TG LP+ V +M +LRHLHLGGNY+SG+IP EYG++  LEYLA+SGN L
Sbjct  148  LDLYNNNMTGGLPLTVVEMPNLRHLHLGGNYYSGKIPSEYGKWEFLEYLAISGNEL  203


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L+ L L  N F+  IP   G+   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQNGKLQILDLSSNK  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLVGSIPSPIATMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  396  LFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLA  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  L L NN LTG LP  V   + ++ L L GN FSG IPPE GR   L  +  S N
Sbjct  456  VNLGQLSLSNNRLTGSLPPSVGNFSGVQKLLLDGNKFSGSIPPEIGRLQQLTKMDFSHN  514


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQVL L+ NN T  +P  + +   L+ L L  N  +G +PP      NL+ L    N 
Sbjct  336  PELQVLQLWENNFTSTIPQALGQNGKLQILDLSSNKLTGTLPPNMCLGNNLQTLITLSNF  395

Query  640  L  642
            L
Sbjct  396  L  396


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I+ +  L+ L L  N F ST P  L Q 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP  +    +L+ L    N+  G IP   G+  +L  + +  N 
Sbjct  360  GKLQILDLSSNKLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENF  419

Query  640  L  642
            L
Sbjct  420  L  420


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  371  KLTGTLPPNMCLGNNLQTLITLSNFLFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFD  430

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  ++L +N L G+ PV      +L  L L  N  +G +PP  G F  ++ L + GN
Sbjct  431  LPNLSQVELQDNLLAGEFPVIGTLAVNLGQLSLSNNRLTGSLPPSVGNFSGVQKLLLDGN  490



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 130/180 (72%), Gaps = 5/180 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLS  285
            ++E  ALLS+K + T    D  S L+SW +STS CTW  VTCD     V+      LNLS
Sbjct  23   ISEFRALLSLKTSLTGAGDDKNSPLSSWKVSTSFCTWIGVTCDVSRRHVTSLDLSGLNLS  82

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  462
            G LSPDV  L  L NLS+A N +SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83   GTLSPDVSHLRLLQNLSLAENLISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN L
Sbjct  143  NLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNEL  202


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 59/115 (51%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  290

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  291  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWEN  345


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  238  LSELVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  297


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  526

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  527  KLLTFVDLSRNELSGEIPNEITAMKILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNN  586

Query  640  L  642
            L
Sbjct  587  L  587


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
               G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  
Sbjct  490  KFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITA  549

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  550  MKILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  608


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  449  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKL  502

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  503  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITAMKILNYLNLSRNH  562

Query  640  L  642
            L
Sbjct  563  L  563


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  419  LNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  479  TGVQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  538

Query  640  L  642
            L
Sbjct  539  L  539


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFG  429

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  430  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  299  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  359  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENF  418

Query  640  L  642
            L
Sbjct  419  L  419


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  395  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVS  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N
Sbjct  455  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHN  513



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 131/180 (73%), Gaps = 5/180 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLS  285
            ++E  ALLS+K++ T    D  S L+SW +STS CTW  VTCD     V+      LNLS
Sbjct  23   ISEFRALLSLKSSLTGAGDDINSPLSSWKVSTSFCTWTGVTCDVSRRHVTSLDLSGLNLS  82

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  462
            G LSPDV  L  L NLS+A NQ+SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83   GTLSPDVSHLRLLQNLSLADNQISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+ +IPP YG +P +EYLAVSGN L
Sbjct  143  NLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAEKIPPSYGSWPVIEYLAVSGNEL  202


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SG +  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGTIPQKLGENGKLNLVDLSSNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F  +   +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLK  290

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  291  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWEN  345


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANL  468
            + P  G  P +  L+++ N+L G +PPEI  + TLR L +   N F    P ++  L+ L
Sbjct  182  IPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLKTLRELYIGYYNAFEDGLPPEIGNLSEL  241

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               D  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  242  VRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNN  297


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  526

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N   G IP       +L  L  S N 
Sbjct  527  KLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNNLVGSIPGSISSMQSLTSLDFSYNN  586

Query  640  L  642
            L
Sbjct  587  L  587


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  491  FEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  NNL G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  551  KILNYLNLSRNNLVGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  608


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  449  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  502

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  503  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNN  562

Query  640  L  642
            L
Sbjct  563  L  563


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  419  LNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  479  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  538

Query  640  L  642
            L
Sbjct  539  L  539


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  T P +L + 
Sbjct  299  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGTIPQKLGEN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  359  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENF  418

Query  640  L  642
            L
Sbjct  419  L  419


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  371  LTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGL  430

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N L+G+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  PKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  395  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVS  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N
Sbjct  455  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHN  513



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVL  294
            ++E  ALLS+KAA   D QS+L SWN S S C+W  VTCD S  HV SLDLS LNLSG+L
Sbjct  23   MSEYQALLSVKAAID-DPQSALVSWNSSNSLCSWSGVTCDPSGRHVTSLDLSSLNLSGIL  81

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S D+  L +L NL++AANQLSGP+PP++SAI  LR LNLSNN+F  TFP QL+QL NLQV
Sbjct  82   SSDIAHLRYLQNLTLAANQLSGPIPPQLSAIPGLRSLNLSNNVFNGTFPSQLSQLKNLQV  141

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNN+T  LP+ V  M +LRHLHLGGN+FSG+IPPEYG++  LEYLA+SGN L
Sbjct  142  LDLYNNNMTDVLPLAVTDMPNLRHLHLGGNFFSGKIPPEYGKWEFLEYLAISGNEL  197


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   ++L
Sbjct  246  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSEL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+  NL  L +S N 
Sbjct  306  KNLTLLNLFRNKLYGAIPEFIGDLPKLEVLQLWENNFTGSIPQGLGKNGNLVLLDLSSNK  365

Query  640  L  642
            L
Sbjct  366  L  366


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+  FL  L+I+ N+L GP+PPEI  ++ L+ L +   N +    P ++  
Sbjct  173  FSGKIPPEYGKWEFLEYLAISGNELVGPIPPEIGNLTRLQQLYIGYYNSYEGGLPPEIGN  232

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L++L   D  N  L+G++P E+ K+  L  L L  N  SG +  E G   +L+ + +S N
Sbjct  233  LSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKSLKSMDLSNN  292

Query  637  GL  642
             L
Sbjct  293  ML  294


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P +G+L  L  +  ++N+ SGP+ PEIS    L F++LS N      P ++  +
Sbjct  486  FSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQCKLLTFVDLSRNELSGAIPTEITGM  545

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  +    N  +G +P   G+F    Y +  GN
Sbjct  546  RILNYLNLSRNHLIGSIPSSIATMQSLTSVDFSYNNLTGLVPGT-GQFSYFNYTSFLGN  603


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 58/117 (50%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L +
Sbjct  224  GGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKS  283

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  284  LKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDLPKLEVLQLWEN  340


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PP+I  +  L  ++ S+N F      +++Q 
Sbjct  462  LSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQC  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  522  KLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLIGSIPSSIATMQSLTSVDFSYNN  581

Query  640  L  642
            L
Sbjct  582  L  582


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDL  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + K  +L  L L  N  +G +PP
Sbjct  330  PKLEVLQLWENNFTGSIPQGLGKNGNLVLLDLSSNKLTGNLPP  372


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  390  LFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDNLLTGEFPVTDTIA  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN FSG IPP+ GR   L  +  S N
Sbjct  450  MNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSN  508


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  366  LTGNLPPNMCLGNRLQTLITLSNFLFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFGL  425

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N LTG+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  426  PKLSQVELQDNLLTGEFPVTDTIAMNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGN  484


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L  N F    P Q+ +L  L  +D  +N  +
Sbjct  452  LGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNKFS  511

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  512  GPITPEISQCKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHL  558


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P  L + 
Sbjct  294  LTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDLPKLEVLQLWENNFTGSIPQGLGKN  353

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +LDL +N LTG+LP  +     L+ L    N+  G IP   G+  +L  + +  N 
Sbjct  354  GNLVLLDLSSNKLTGNLPPNMCLGNRLQTLITLSNFLFGPIPESLGKCESLSRIRMGENF  413

Query  640  L  642
            L
Sbjct  414  L  414



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 134/186 (72%), Gaps = 8/186 (4%)
 Frame = +1

Query  103  GKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  270
            G+P  ++E  ALLSIK++ +      + S L +WN ST+ C W  VTCD+    V     
Sbjct  22   GRP--ISEFRALLSIKSSLSGAGDGPNSSPLATWNDSTTFCAWTGVTCDASGRHVISLDL  79

Query  271  g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
              LNLSG LSPD+  L  L NLS+A+NQ+SGP+PPE+S++S LR+LNLSNN+F  +FP +
Sbjct  80   SGLNLSGTLSPDIAHLFLLQNLSVASNQISGPIPPEVSSLSGLRYLNLSNNVFNGSFPDE  139

Query  448  L-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  624
            L A   NL+VLDLYNNNLTGDLPV V  +T LRHLHLGGNYF+GRIPP YG +P LEYLA
Sbjct  140  LSAGAVNLRVLDLYNNNLTGDLPVSVTNLTHLRHLHLGGNYFAGRIPPAYGSWPVLEYLA  199

Query  625  VSGNGL  642
            VSGN L
Sbjct  200  VSGNEL  205


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 72/121 (60%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P+VG+L  L  L +  N LSGP+  E+  +S+L+ ++LSNN+F    P   AQL
Sbjct  254  LTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNNMFTGEIPASFAQL  313

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G+   L++L +S N 
Sbjct  314  KNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQKLGQNGKLQFLDLSSNK  373

Query  640  L  642
            L
Sbjct  374  L  374


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              +G + P VG+L  L  + I+ NQLSG + PEIS    L F++LS N      P+++  
Sbjct  493  KFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNELSGEIPNEITG  552

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  V  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  553  MRILNYLNLSRNHLVGPIPASVASMQSLTSVDFSYNNLSGLVPGS-GQFSYFNYTSFLGN  611


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P  G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  181  FAGRIPPAYGSWPVLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  240

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  LTG +P EV K+  L  L L  N  SG +  E G   +L+ + +S N
Sbjct  241  LSELVRFDAANCGLTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNN  300


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ +GP+PP++  +  L  +++S+N        +++Q 
Sbjct  470  LSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQC  529

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  530  KLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGPIPASVASMQSLTSVDFSYNN  589

Query  640  L  642
            L
Sbjct  590  L  590


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 63/121 (52%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG ++ ++GQ+      S++ NQLSGP+PP I     ++ L L  N F    P Q+ +L
Sbjct  452  VSGRVAVNLGQI------SLSNNQLSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKL  505

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D+ +N L+G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  506  QQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNH  565

Query  640  L  642
            L
Sbjct  566  L  566


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP      
Sbjct  398  LFGSIPDSLGECESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLSGEFPVSGRVA  457

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL  + L NN L+G LP  +     ++ L L GN F+G IPP+ G+   L  + +S N 
Sbjct  458  VNLGQISLSNNQLSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKLQQLSKMDISHNQ  517

Query  640  L  642
            L
Sbjct  518  L  518


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L   +N L G +P  +    +L  + +  N    + P  L  
Sbjct  373  KLTGTLPPNLCSGNKLQTLITLSNFLFGSIPDSLGECESLTRIRMGENFLNGSIPKGLFG  432

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L+G+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  433  LPKLSQVELQDNYLSGEFPVSGRVAVNLGQISLSNNQLSGPLPPAIGNFYGVQKLLLDGN  492


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG  P        L  ++LSNN      P  +   
Sbjct  422  LNGSIPKGLFGLPKLSQVELQDNYLSGEFPVSGRVAVNLGQISLSNNQLSGPLPPAIGNF  481

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N  TG +P +V K+  L  + +  N  SGRI PE  +   L ++ +S N 
Sbjct  482  YGVQKLLLDGNKFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNE  541

Query  640  L  642
            L
Sbjct  542  L  542



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   197 bits (501),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 130/181 (72%), Gaps = 6/181 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+      LNL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+P EIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPTEISNLSGLRHLNLSNNVFNGSFPDELSYGL  142

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+G+IPP YG +P +EYLAVSGN 
Sbjct  143  VNLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAGKIPPSYGSWPVIEYLAVSGNE  202

Query  640  L  642
            L
Sbjct  203  L  203


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGVLPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +
Sbjct  292  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGVLPELEVLQL  343


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  298


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  468  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  528  KLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  492  FEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  552  KILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 7/119 (6%)
 Frame = +1

Query  307  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            GQLP        L  +S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L  
Sbjct  446  GQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQ  505

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  506  LSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNHL  564


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N   G +P EV K+  L  +    N FSGRI PE  R   L ++ +S N 
Sbjct  480  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNE  539

Query  640  L  642
            L
Sbjct  540  L  540


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGVLPELEVLQLWENNFTGSIPQKLGEN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENF  419

Query  640  L  642
            L
Sbjct  420  L  420


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  396  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGQLPVAGGVS  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N
Sbjct  456  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHN  514


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  372  LTGTLPPNMCSGNKLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGL  431

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N L+G LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  432  PKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            VTE +AL+++K++ T D QS L++WN +T  C++  V CD    HV S+DL+   LSG L
Sbjct  27   VTELSALIAVKSSITDDPQSYLSNWNANTPLCSFAGVACDLTGRHVTSIDLTNFTLSGTL  86

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +  L FL NLS+AAN LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87   SPSLAHLRFLQNLSVAANDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP  YGR+ +LEYLAVSGN L
Sbjct  147  LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIPSSYGRWEHLEYLAVSGNEL  202


 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 71/121 (59%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P+VG+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEVGKLQRLHTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ + 
Sbjct  468  LSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNELSGQIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G+   L  L+++ N+LSG +PPEI  ++ L+ L +   N F    P ++  
Sbjct  178  FSGQIPSSYGRWEHLEYLAVSGNELSGKIPPEIGNLTKLKQLYIGYFNSFEGGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L + D  N  L+G++P EV K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  238  LSELVLFDAANCMLSGEIPPEVGKLQRLHTLFLQVNALSGSLTPELGTLNSLKSMDLSNN  297


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  + +  N L+G  P   S+IS  L  ++LSNN      P  +  
Sbjct  419  LNGSIPKGLLGLPQLTQVELQDNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASVGN  478

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + +Q L L  N  +G +P E+ K+  L  +    N FSG IPPE  +   L ++ +S N
Sbjct  479  FSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKCKLLTFVDLSRN  538

Query  637  GL  642
             L
Sbjct  539  EL  540


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 56/121 (46%), Gaps = 1/121 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLGKCESLSRIRMGENYLNGSIPKGLLG  429

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L  L  ++L +N LTG+ PV    ++ +L  + L  N  SG +P   G F  ++ L + G
Sbjct  430  LPQLTQVELQDNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  634  N  636
            N
Sbjct  490  N  490


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG++ P++ +   L  + ++ N+LSG +P EI+++  L +LNLS N    + P  ++ 
Sbjct  515  KFSGLIPPEICKCKLLTFVDLSRNELSGQIPTEITSMRILNYLNLSRNHLLGSIPSSIST  574

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  575  MQSLTSVDFSYNNLSGLVP  593



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            VTE  AL+++K++ T D QS L++WN ST  C++  VTCD    HV S+DL+ + L+G L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNASTPLCSFAGVTCDLTGRHVTSIDLTNVTLAGTL  86

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +  L FL NLS+A N LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87   SPSLAHLRFLQNLSVAGNDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP  YGR+ +LEYLAVSGN L
Sbjct  147  LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIPSSYGRWEHLEYLAVSGNEL  202


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 71/121 (59%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGRIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ NQLSG +P  +   S ++ L L  N F    P ++ +L  L  +D  +N L+
Sbjct  458  LGQISLSNNQLSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLS  517

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +P E+ K   L  + L GN  SGRIP E      L YL +S N L
Sbjct  518  GLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHL  564


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N+LSG +PPEI     L F++LS N      P ++  
Sbjct  491  KFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITS  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  551  MRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNNLSGLVPGS-GQFSYFNYTSFLGN  609


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N      P ++ + 
Sbjct  468  LSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G+   L  L+++ N+LSG +PPEI  ++ L+ L +   N F    P ++  
Sbjct  178  FSGQIPSSYGRWEHLEYLAVSGNELSGKIPPEIGNLTKLKQLYIGYFNSFEGGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  238  LSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNN  297


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  + +  N L+G  P   S+IS  L  ++LSNN      P  +  
Sbjct  419  LNGSIPKGLLGLPQLTQVELQDNYLTGEFPVTDSSISANLGQISLSNNQLSGALPASVGN  478

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + +Q L L  N  +G +P E+ K+  L  +    N  SG IPPE  +   L ++ +SGN
Sbjct  479  FSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICKCKLLTFVDLSGN  538

Query  637  GL  642
             L
Sbjct  539  EL  540


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 56/121 (46%), Gaps = 1/121 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  370  KLTGTLPPDMCSGNTLQTLITLGNFLLGPIPESLGKCESLSRIRMGENYLNGSIPKGLLG  429

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L  L  ++L +N LTG+ PV    +++ L  + L  N  SG +P   G F  ++ L + G
Sbjct  430  LPQLTQVELQDNYLTGEFPVTDSSISANLGQISLSNNQLSGALPASVGNFSGVQKLLLDG  489

Query  634  N  636
            N
Sbjct  490  N  490



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   196 bits (499),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            V+E  ALL++K++ T D QS L++WN +T  C++  VTCD    HV SL+LS  NLSG L
Sbjct  24   VSEFQALLAVKSSITDDPQSYLSNWNATTPLCSFTGVTCDYTGRHVTSLNLSYFNLSGTL  83

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  84   SPSFSHLQFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQLSQLKNLQV  143

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNN+TG+LP+ V  + +LRHLHLGGN+F+G+IP  YGR+ +LEYLAVSGN L
Sbjct  144  LDLYNNNMTGELPISVTDLPNLRHLHLGGNFFTGQIPASYGRWEHLEYLAVSGNEL  199


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWENNFTGNIPQTLGSNRKLQLLDLSSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPEFIGEL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP+      L  L   GN 
Sbjct  332  PELEVLQLWENNFTGNIPQTLGSNRKLQLLDLSSNKLTGILPPDMCSGNTLHTLITLGNF  391

Query  640  L  642
            L
Sbjct  392  L  392


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F       +++ 
Sbjct  465  LSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFSGPVAPGISKC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTMQSLTSVDFSYNN  584

Query  640  L  642
            L
Sbjct  585  L  585


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G +    G+   L  L+++ N+L G +PPEI  +  L+ L +   N F    P ++  
Sbjct  175  FTGQIPASYGRWEHLEYLAVSGNELGGRIPPEIGNLKKLKELYIGYYNSFEGGLPPEIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  235  LSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLESLKSMDLSNN  294

Query  637  GL  642
             L
Sbjct  295  ML  296


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   + +
Sbjct  392  LFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTDSSI  451

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            + NL  + L NN L+G LP  V   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  452  SLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHN  511


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (47%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G+L PD+     L  L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  368  LTGILPPDMCSGNTLHTLITLGNFLFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFGL  427

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N LTG+ PV    ++ +L  + L  N  SG +P   G F  ++ L + GN
Sbjct  428  PKLTQVELQDNYLTGEFPVTDSSISLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGN  487


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 51/107 (48%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSGP+P  +   S ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  455  LGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFS  514

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +   + K   L  + L  N  SG IP E      L YL +S N L
Sbjct  515  GPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHL  561


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P + +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  513  FSGPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTM  572

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   196 bits (498),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V+E  ALLS+K + T D +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LS
Sbjct  26   VSEYRALLSLKTSITGDPKSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLS  85

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AAN+ SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VL
Sbjct  86   PDVAFLRFLTNLSLAANEFSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVL  145

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TGD P+ V +M+ LRHLHLGGN+F+GRIPPE GR  +LEYLAVSGN L
Sbjct  146  DLYNNNMTGDFPIVVTQMSGLRHLHLGGNFFAGRIPPEVGRMQSLEYLAVSGNEL  200


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  249  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+  IP   G+   L+ L +S N 
Sbjct  309  KNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNK  368

Query  640  L  642
            L
Sbjct  369  L  369


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  488  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  547

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  MRILNYLNLSKNHLVGGIPATIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  606


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 59/117 (50%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL +
Sbjct  227  GGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNS  286

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ LDL NN L G++PV   ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  287  LKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWEN  343


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  273  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE  591
              L+VL L+ NN T  +P  + K   L+ L L  N  +G +PP+
Sbjct  333  PKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNKLTGTLPPD  376


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGKCVSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNFLSGEFPITDSIS  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL  + L NN LTG +P  +   + ++ L L GN FSG+IPPE GR   L  +  S N 
Sbjct  453  LNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGNKFSGQIPPEIGRLQQLSKIDFSSNM  512

Query  640  L  642
            L
Sbjct  513  L  513


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 59/123 (48%), Gaps = 6/123 (5%)
 Frame = +1

Query  277  NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
             L+G L PD+    +L  L+ LS   N L GP+P  +    +L  + +  N    + P  
Sbjct  368  KLTGTLPPDMCFGNRLQILIALS---NFLFGPIPESLGKCVSLNRIRMGENFLNGSIPKG  424

Query  448  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L  L  L  ++L +N L+G+ P+      +L  + L  N  +G IPP  G F  ++ L +
Sbjct  425  LLSLPKLSQVELQDNFLSGEFPITDSISLNLGQISLSNNRLTGSIPPTIGNFSGVQKLLL  484

Query  628  SGN  636
             GN
Sbjct  485  DGN  487



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   196 bits (497),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 136/178 (76%), Gaps = 3/178 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGV  291
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTCD     V SLDLS LNLSG 
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTCDVSRRHVTSLDLSSLNLSGT  82

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANL  468
            LSPDV  LP L NLS+A NQ+SGP+PPEIS +S LR LNLSNNIF  +FP ++ A LANL
Sbjct  83   LSPDVSHLPLLQNLSLADNQISGPIPPEISNLSGLRHLNLSNNIFNGSFPGEISAGLANL  142

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP YG +P +EYLAVSGN L
Sbjct  143  RVLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPPSYGTWPEIEYLAVSGNEL  200


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  249  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  309  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  368

Query  640  L  642
            L
Sbjct  369  L  369


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  229  LPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  288

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P     + +L  L+L  N   G IP   G  P+LE L +  N
Sbjct  289  SMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWEN  343


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L G++P E+ ++  L  L L  N FSG +  E G+  +L+ + +S N
Sbjct  236  LSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  295


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  465  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRLQQLSKIDFSHNLFSGGIAPEISRC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  525  KLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNN  584

Query  640  L  642
            L
Sbjct  585  L  585


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  273  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGEL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP       LE L   GN 
Sbjct  333  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNF  392

Query  640  L  642
            L
Sbjct  393  L  393


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 56/120 (47%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
               G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P ++  
Sbjct  488  KFEGPIPSEVGRLQQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITG  547

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  548  MKILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  606


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  368  KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFG  427

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  428  LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  487


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  447  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRL  500

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  501  QQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNH  560

Query  640  L  642
            L
Sbjct  561  L  561


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P   +  
Sbjct  393  LFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVS  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  L L NN L+G LP  +   T ++ L L GN F G IP E GR   L  +  S N
Sbjct  453  VNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRLQQLSKIDFSHN  511


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +      L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  297  FTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGEN  356

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  357  GRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENF  416

Query  640  L  642
            L
Sbjct  417  L  417



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   196 bits (497),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 133/186 (72%), Gaps = 7/186 (4%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  270
            AG+P  ++E  AL+S+K++ T    D  S L SW  STS CTW  VTCD     V+    
Sbjct  19   AGRP--ISELHALISLKSSLTGAGEDPNSPLASWKSSTSFCTWTGVTCDISRRHVTSLDL  76

Query  271  g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
              LNLSG LSPDV +LP L NLS+A NQ+SGP+PPEIS +  LR LNLSNN+F  +FP +
Sbjct  77   SGLNLSGTLSPDVSRLPLLQNLSVADNQISGPIPPEISNLYGLRHLNLSNNVFNGSFPDE  136

Query  448  LAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  624
            ++  L NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IP  YG +P +EYLA
Sbjct  137  ISSGLVNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGQIPSSYGSWPVIEYLA  196

Query  625  VSGNGL  642
            VSGN L
Sbjct  197  VSGNEL  202


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGELPELEVLQLWENNFTGSIPQKLGENGKLNLVDLSSNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  290

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +
Sbjct  291  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGELPELEVLQL  342


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      +++  
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHC  526

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  527  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGTIPGSISSMQSLTSLDFSYNN  586

Query  640  L  642
            L
Sbjct  587  L  587


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178  FAGQIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  238  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNN  297


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  491  FEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  551  RILNYLNLSRNHLVGTIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  608


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 57/119 (48%), Gaps = 7/119 (6%)
 Frame = +1

Query  307  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            GQLP        L  +S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L  
Sbjct  445  GQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQ  504

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  +D  +N  +G +  E+     L  + L  N  SG IP E      L YL +S N L
Sbjct  505  LSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHL  563


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  371  LTGALPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLSRIRMGQNFLNGSIPKGLFGL  430

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N LTG LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  431  PKLTQVELQDNYLTGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  489


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  299  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGELPELEVLQLWENNFTGSIPQKLGEN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +    +L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  359  GKLNLVDLSSNKLTGALPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLSRIRMGQNF  418

Query  640  L  642
            L
Sbjct  419  L  419


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  395  LFGSIPDSLGKCESLSRIRMGQNFLNGSIPKGLFGLPKLTQVELQDNYLTGQLPVAGGVS  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N
Sbjct  455  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHN  513



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   196 bits (497),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 137/188 (73%), Gaps = 6/188 (3%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvs  258
            H +GA       V E  ALL++K++ T D QS L++WN +   C++  VTCD    HV S
Sbjct  17   HCSGART-----VLEFQALLAVKSSITGDPQSYLSNWNATIPLCSFTGVTCDYTGRHVTS  71

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            LDLS  NLSG LSP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +F
Sbjct  72   LDLSYFNLSGTLSPSFSHLRFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSF  131

Query  439  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  618
            P QL+QL NLQVLDLYNNN+TGDLP+ V  + +LRHLHLGGN+F+G+IP  YGR+ +LEY
Sbjct  132  PTQLSQLKNLQVLDLYNNNMTGDLPISVTDLPNLRHLHLGGNFFTGQIPASYGRWEHLEY  191

Query  619  LAVSGNGL  642
            LAVSGN L
Sbjct  192  LAVSGNEL  199


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLHGQIPGFIGELPELEVLQLWENNFTGSIPQTLGSNRKLQLLDLSSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G L P++G L  LV    A   LSG +PPEI  +  L  L L  N    +   +L  
Sbjct  223  SFEGGLPPEIGNLSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGT  282

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L+ +DL NN L G++P     + +L  L+L  N   G+IP   G  P LE L +  N
Sbjct  283  LKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGELPELEVLQLWEN  342


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGEL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  +     L+ L L  N  +G +PP+      L  L   GN 
Sbjct  332  PELEVLQLWENNFTGSIPQTLGSNRKLQLLDLSSNKLTGTLPPDMCSGNTLHTLITLGNF  391

Query  640  L  642
            L
Sbjct  392  L  392


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F       +++ 
Sbjct  465  LSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFSGPVAPGISKC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTMQSLTSVDFSYNN  584

Query  640  L  642
            L
Sbjct  585  L  585


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G +    G+   L  L+++ N+L G +PPEI  +  L+ L +   N F    P ++  
Sbjct  175  FTGQIPASYGRWEHLEYLAVSGNELGGRIPPEIGNLEKLQELYIGYYNSFEGGLPPEIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  235  LSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNN  294

Query  637  GL  642
             L
Sbjct  295  ML  296


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   + +
Sbjct  392  LFGSIPESLGKCESLSRIRMGENFLNGSIPKGLFRLPKLTQVELQDNYLTGEFPVTDSSI  451

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            + NL  + L NN L+G LP  V   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  452  SLNLGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHN  511


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 51/107 (48%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSGP+P  +   S ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  455  LGQISLSNNRLSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFS  514

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +   + K   L  + L  N  SG IP E      L YL +S N L
Sbjct  515  GPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHL  561


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P + +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  512  KFSGPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSIST  571

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  572  MQSLTSVDFSYNNLSGLVP  590



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            VTE  AL+++K++ T D QS L++WN +T  C++  VTCD    HV S+DL+   LSG L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNATTPLCSFAGVTCDLTGRHVTSIDLTNFTLSGTL  86

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +  L FL NLS+A N L+GP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  87   SPSLAHLRFLQNLSVADNNLTGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQV  146

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP  YGR+ +LEYLAVSGN L
Sbjct  147  LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIPSSYGRWEHLEYLAVSGNEL  202


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 71/121 (59%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWENNFTGSIPQKLGSNKKLQVLDLSSNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ + 
Sbjct  468  LSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHNKFSGLIPPEICKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G +P E+  M  L  L+L  N+  G IP       +L  +  S N 
Sbjct  528  ELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSISTMQSLTSVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 59/122 (48%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  + +  N L+G  P   S+IS  L  ++LSNN      P  +  
Sbjct  419  LNGSIPKGLLGLPQLTQVELQNNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASIGN  478

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + +Q L L  N  +G +P E+  +  L  +    N FSG IPPE  +   L ++ +S N
Sbjct  479  FSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHNKFSGLIPPEICKCELLTFVDLSRN  538

Query  637  GL  642
             L
Sbjct  539  EL  540


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 57/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L NN     FP   + +
Sbjct  395  LFGSIPESLGKCESLSRIRMGENYLNGSIPKGLLGLPQLTQVELQNNYLTGEFPVTDSSI  454

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            + NL  + L NN L+G LP  +   + ++ L L GN FSG IP E G    L  +  S N
Sbjct  455  SVNLGQISLSNNQLSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHN  514


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG++ P++ +   L  + ++ N+LSG +P EI+++  L FLNLS N    + P  ++ 
Sbjct  515  KFSGLIPPEICKCELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSIST  574

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  575  MQSLTSVDFSYNNLSGLVP  593



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   194 bits (493),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/184 (57%), Positives = 140/184 (76%), Gaps = 3/184 (2%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldls  270
            + A +P  V+E  ALL++K++FT D +S L++WN +T  C++  V CD    HV S+DLS
Sbjct  17   SSAARP--VSEFRALLAVKSSFTDDPESYLSNWNATTRFCSFTGVACDYTGRHVTSIDLS  74

Query  271  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
              NLSG LSP    L FL +LS+AANQ+SGP+P E++A+S+LR+ NLSNN+F  +FP QL
Sbjct  75   NFNLSGTLSPSFSHLRFLQSLSLAANQISGPIPTELAALSSLRYFNLSNNVFNGSFPSQL  134

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  630
            +QL NLQVLDLYNNN+TG+LP+ V ++ +L HLHLGGN+FSG+IP  YGR+  LEYLAVS
Sbjct  135  SQLKNLQVLDLYNNNMTGELPISVTELPNLLHLHLGGNFFSGQIPSSYGRWEFLEYLAVS  194

Query  631  GNGL  642
            GN L
Sbjct  195  GNEL  198


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  247  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFANL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  307  KNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWENNFTGSIPQQLGSNKKLQLLDLSSNK  366

Query  640  L  642
            L
Sbjct  367  L  367


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +    G+  FL  L+++ N+L G +PPEI  ++ L+ L +   N F    P ++  
Sbjct  174  FSGQIPSSYGRWEFLEYLAVSGNELDGKIPPEIGNLTKLQQLYIGYYNSFEGGLPPEIGN  233

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  234  LSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNN  293

Query  637  GL  642
             L
Sbjct  294  ML  295


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  + +  N L+G  P   S+IS  L  ++LSNN    T P  +  
Sbjct  415  LNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTESSISANLGQISLSNNKLSGTLPASVGN  474

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + +Q L L  N  +G +P E+ K+  L  +    N FSG I PE  +   L ++ +S N
Sbjct  475  FSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNKFSGTIAPEISKCKLLTFVDLSRN  534

Query  637  GL  642
             L
Sbjct  535  EL  536


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  511  KFSGTIAPEISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSIAT  570

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  571  MQSLTSVDFSYNNLSGLVP  589



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   193 bits (491),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 123/179 (69%), Gaps = 6/179 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl------NLS  285
            EQ ALL IK+A T D QSSL+SWN ST HCTW  + C S   +              NL+
Sbjct  24   EQKALLGIKSAITDDPQSSLSSWNTSTHHCTWDFIKCSSSSSLNHHQSVVSLNISGLNLT  83

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G+LSPD+G L  L NLS+A N  SGP+P  +S +S L  LNLSNNIF STFP  L+ L N
Sbjct  84   GILSPDIGFLTNLQNLSVAGNSFSGPIPSSLSLLSNLYHLNLSNNIFNSTFPSSLSPLQN  143

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LQ+LD+YNNNLTG LP+ V  M+ LRHLHLGGNYFSG IP EYG++  +EYLAVSGN L
Sbjct  144  LQILDVYNNNLTGPLPLSVVNMSELRHLHLGGNYFSGEIPAEYGQWRKIEYLAVSGNEL  202


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  ++N+ SG +P EIS    L F++LS N F    P ++  +
Sbjct  492  FSGSIPPEIGRLQQLSKIDFSSNKFSGEIPSEISKCKLLTFVDLSRNQFSGEIPKEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L++  N+L+G +P  +  M SL  +    N FSG I PE G+F    Y +  GN
Sbjct  552  RILNYLNISRNHLSGSIPGSISSMQSLTSVDFSYNNFSGLI-PESGQFSYFNYTSFLGN  609


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N+    FP  +  +
Sbjct  395  LLGPIPESLGSCKSLSRVRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGGFPVTVDSI  454

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            A NL  + L NN LTG+LP  +   + ++ L L GN FSG IPPE GR   L  +  S N
Sbjct  455  AVNLGQISLSNNQLTGELPSSIGNFSGVQKLLLDGNKFSGSIPPEIGRLQQLSKIDFSSN  514


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +P E   +S+L+ ++LSNN+F    P   + L
Sbjct  251  LSGEIPAELGKLKKLDTLFLQVNTLSGYLPSEFGYLSSLKSMDLSNNLFSGEIPESFSLL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  311  KNLTLLNLFRNKLHGGIPEFIGDLPQLEVLQLWENNFTGSIPEKLGFNGRLQLLDLSSNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +  + GQ   +  L+++ N+L G +P EI  +S+L+ L +   N +    P ++  
Sbjct  178  FSGEIPAEYGQWRKIEYLAVSGNELEGNIPAEIGNLSSLKELYIGYYNGYSGGIPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG +P E+G   +L+ + +S N
Sbjct  238  LSELVRFDGANCGLSGEIPAELGKLKKLDTLFLQVNTLSGYLPSEFGYLSSLKSMDLSNN  297


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 47/99 (47%), Gaps = 0/99 (0%)
 Frame = +1

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  525
            N+L G +P  I  +  L  L L  N F  + P +L     LQ+LDL +N LTG LP  + 
Sbjct  321  NKLHGGIPEFIGDLPQLEVLQLWENNFTGSIPEKLGFNGRLQLLDLSSNKLTGTLPPSLC  380

Query  526  KMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            K   L  L   GN+  G IP   G   +L  + +  N L
Sbjct  381  KGERLETLITLGNFLLGPIPESLGSCKSLSRVRMGENFL  419



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  +TCDS  HV SL+L+ L+LSG L
Sbjct  19   ISEYRALLSFKASSLTDDPTHALSSWNSSTPFCSWFGLTCDSRRHVTSLNLTSLSLSGTL  78

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S D+  LPFL +LS+A N+ SGP+P   SA+S LRFLNLSNN+F +TFP QL +LANL+V
Sbjct  79   SDDLSHLPFLSHLSLADNKFSGPIPASFSALSALRFLNLSNNVFNATFPSQLNRLANLEV  138

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNN+TG+LP+ V  M  LRHLHLGGN+FSG+IPPEYG + +L+YLA+SGN L
Sbjct  139  LDLYNNNMTGELPLSVAAMPLLRHLHLGGNFFSGQIPPEYGTWQHLQYLALSGNEL  194


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP   G    L  + +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSSNK  362

Query  640  L  642
            +
Sbjct  363  I  363


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P +G L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  483  FTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKCKLLTFIDLSGNELSGEIPNKITSM  542

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  +    N FSG +P   G+F    Y +  GN
Sbjct  543  RILNYLNLSRNHLDGSIPGNIASMQSLTSVDFSYNNFSGLVPGT-GQFGYFNYTSFLGN  600


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  267  LSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGEL  326

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  +     L  + L  N  +G +PP       L+ L   GN 
Sbjct  327  PALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSSNKITGTLPPNMCYGNRLQTLITLGNY  386

Query  640  L  642
            L
Sbjct  387  L  387


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G    L  L+++ N+L+G + PE+  +S+LR L +   N +    P ++  
Sbjct  170  FSGQIPPEYGTWQHLQYLALSGNELAGTIAPELGNLSSLRELYIGYYNTYSGGIPPEIGN  229

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+NL  LD     L+G++P E+ K+ +L  L L  N  SG + PE G   +L+ + +S N
Sbjct  230  LSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLKSLKSMDLSNN  289

Query  637  GL  642
             L
Sbjct  290  ML  291


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  220  SGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLK  279

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  280  SLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWEN  337


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP   +  
Sbjct  387  LFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGQFPEDGSIA  446

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  + L NN L+G LP  +   TS++ L L GN F+GRIPP+ G    L  +  S N
Sbjct  447  TDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNGNEFTGRIPPQIGMLQQLSKIDFSHN  505


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +G +PP+I  +  L  ++ S+N F      ++++ 
Sbjct  459  LSGSLPSTIGNFTSMQKLLLNGNEFTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKC  518

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P ++  M  L +L+L  N+  G IP
Sbjct  519  KLLTFIDLSGNELSGEIPNKITSMRILNYLNLSRNHLDGSIP  560


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P + S  + L  ++LSNN    + P  +   
Sbjct  411  LNGSIPKGLFGLPKLTQVELQDNLLTGQFPEDGSIATDLGQISLSNNQLSGSLPSTIGNF  470

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             ++Q L L  N  TG +P ++  +  L  +    N FSG I PE  +   L ++ +SGN 
Sbjct  471  TSMQKLLLNGNEFTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKCKLLTFIDLSGNE  530

Query  640  L  642
            L
Sbjct  531  L  531



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 129/179 (72%), Gaps = 4/179 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  288
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  22   ITELNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  81

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  465
             LS DV  LP L NLS+AANQ+SGP+PPE S +  LR LNLSNN+F  ++P +L+  L N
Sbjct  82   TLSSDVSHLPLLQNLSLAANQISGPIPPEFSNLYELRLLNLSNNVFNGSYPDELSSGLVN  141

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L+VLDLYNNNLTG LP+ +  +T LRHLHLGGNYFSG+IP  YG +P LEYLAVSGN L
Sbjct  142  LRVLDLYNNNLTGHLPLSITNLTQLRHLHLGGNYFSGKIPATYGTWPVLEYLAVSGNEL  200


 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  249  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  309  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGDNGRLVILDLSSNK  368

Query  640  L  642
            L
Sbjct  369  L  369


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  465  LSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  525  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNN  584

Query  640  L  642
            L
Sbjct  585  L  585


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  489  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  549  RILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNNLSGLV-PSTGQFSYFNYTSFLGN  606


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  LTG +P E+ K+ +L  L L  N FSG +  E G   +L+ + +S N
Sbjct  236  LSELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNN  295


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  L+    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  229  LPPEIGNLSELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLK  288

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  289  SMDLSNNMFTGEIPTSFSELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWEN  343


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  393  LFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFGLPKLSQVELQDNYLTGELPVSGGVS  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            ++L  + L NN L+G LP  +   + ++ L L GN F+G IPPE GR   L  L  S N
Sbjct  453  SDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHN  511


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L+ L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  369  LTGTLPPNMCAGNRLMTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPKGLFGL  428

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N LTG+LPV     + L  + L  N  SG +P   G F  ++ L + GN
Sbjct  429  PKLSQVELQDNYLTGELPVSGGVSSDLGQVSLSNNQLSGSLPAAIGNFSGVQKLLLDGN  487



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 131/187 (70%), Gaps = 8/187 (4%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl  267
             GKP  ++E  ALLS+K++ T     D  S L+SW ++TS CTW  VTCD     V+   
Sbjct  19   TGKP--ISEPRALLSLKSSLTVTGDDDKNSPLSSWKLTTSFCTWTGVTCDVSRRHVTSLD  76

Query  268  sg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  444
               LNL G LSP++  L  L NLS+A NQ+SG +PP+IS +S LR+LNLSNN+F  TFP 
Sbjct  77   LSGLNLPGTLSPEISHLRLLQNLSLAENQISGQIPPQISNLSGLRYLNLSNNVFNGTFPD  136

Query  445  QLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  621
            +++  L NL++LD+YNNNLTGDLP+ V  +T LRHLHLGGNYFSG IP  YG +P +EYL
Sbjct  137  EISSGLVNLRILDVYNNNLTGDLPISVTNLTQLRHLHLGGNYFSGSIPSSYGSWPVIEYL  196

Query  622  AVSGNGL  642
            AVSGN L
Sbjct  197  AVSGNEL  203


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP + G    L  + +S N 
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLHLVDLSSNK  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      +++  
Sbjct  468  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  528  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGAIPSSISSMQSLTSLDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FSGSIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG +  E G   +L+ + +S N
Sbjct  239  LSELVRFDGANCGLTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNN  298


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 58/115 (50%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +P EI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRFDGANCGLTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLK  291

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  292  SMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWEN  346


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  492  FEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  552  RILNYLNLSRNHLVGAIPSSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  609


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  503

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N  +G +  E+     L  + L  N  SG IP E      L YL +S N 
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNH  563

Query  640  L  642
            L
Sbjct  564  L  564


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  372  LTGTLPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGL  431

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N LTG+LPV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  432  PKLTQVELQDNYLTGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +    +L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GKLHLVDLSSNKLTGTLPPNMCSGNNLETLITLGNFLFGSIPDSLGKCESLTRIRMGENF  419

Query  640  L  642
            L
Sbjct  420  L  420


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P ++     L  ++LS+N    T P  +   
Sbjct  324  LHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLHLVDLSSNKLTGTLPPNMCSG  383

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL+ L    N L G +P  + K  SL  + +G N+ +G IP      P L  + +  N 
Sbjct  384  NNLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNY  443

Query  640  L  642
            L
Sbjct  444  L  444


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 53/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P      
Sbjct  396  LFGSIPDSLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVAGGVS  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N
Sbjct  456  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHN  514



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 136/178 (76%), Gaps = 4/178 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllh-vvsldlsglNLSG  288
            ++E  ALLS+K+A   D Q +L SWN +  +  CTW  VTCD     + SLDLS LNLSG
Sbjct  25   ISEYQALLSLKSAID-DPQGALASWNSTNKNNLCTWSFVTCDYNNRHITSLDLSSLNLSG  83

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPD+  L +L NL++AANQ+SGP+P ++SAIS LR LNLSNN+F  +FP QL+QL NL
Sbjct  84   TLSPDIAHLRYLQNLTLAANQISGPIPIQLSAISGLRCLNLSNNVFNGSFPTQLSQLKNL  143

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            QVLDLYNNN+TGDLP+ V +M +LRHLHLGGN+FSG IP EYG++  LEYLAVSGN L
Sbjct  144  QVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFSGAIPREYGKWEFLEYLAVSGNEL  201


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   AQL
Sbjct  250  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            +NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G+  NL  + +S N 
Sbjct  310  SNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQGLGKNGNLVLVDLSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  +
Sbjct  491  FSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGAIPTEITGM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  +    N  +G +P   G+F    Y +  GN
Sbjct  551  RILNYLNLSRNHLVGSIPASIATMQSLTSVDFSYNNLTGLVPGT-GQFSYFNYTSFLGN  608


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (51%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G L   +G+   +  L +  N+ SGP+PPEI  +  L  ++ S+N F      +++Q
Sbjct  466  HLTGSLPSSIGKFSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQ  525

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L  +DL  N L+G +P E+  M  L +L+L  N+  G IP       +L  +  S N
Sbjct  526  CKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLVGSIPASIATMQSLTSVDFSYN  585

Query  637  GL  642
             L
Sbjct  586  NL  587


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +  + G+  FL  L+++ N+L GP+PPEI  ++ L+ L +   N +    P ++  
Sbjct  177  FSGAIPREYGKWEFLEYLAVSGNELEGPIPPEIGNLTKLQQLYIGYYNTYEGGLPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L++L   D  N  L+G++P E+ K+  L  L L  N  SG +  E G   +L+ + +S N
Sbjct  237  LSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNN  296

Query  637  GL  642
             L
Sbjct  297  ML  298


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L +
Sbjct  228  GGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKS  287

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ +DL NN L+G++P    ++++L  L+L  N   G IP   G  P LE L +  N
Sbjct  288  LKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWEN  344


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  ++G L  L ++ ++ N LSG +P   + +S L  LNL  N      P  +  L
Sbjct  274  LSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + K  +L  + L  N  +G +PP+      L+ L    N 
Sbjct  334  PQLEVLQLWENNFTGSIPQGLGKNGNLVLVDLSSNKLTGNLPPDMCSGDRLQTLITLSNF  393

Query  640  L  642
            L
Sbjct  394  L  394


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP    ++
Sbjct  394  LFGPIPESLGKCQSLSRIRMGENFLNGSLPKGLFGLPKLTQVELQDNLLTGEFPVTDDKI  453

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            A NL  + L NN+LTG LP  + K + ++ L L GN FSG IPPE G+   L  +  S N
Sbjct  454  AVNLGQISLSNNHLTGSLPSSIGKFSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHN  513


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L PD+     L  L   +N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  370  LTGNLPPDMCSGDRLQTLITLSNFLFGPIPESLGKCQSLSRIRMGENFLNGSLPKGLFGL  429

Query  460  ANLQVLDLYNNNLTGDLPVEVYKM-TSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N LTG+ PV   K+  +L  + L  N+ +G +P   G+F  ++ L + GN
Sbjct  430  PKLTQVELQDNLLTGEFPVTDDKIAVNLGQISLSNNHLTGSLPSSIGKFSGVQKLLLDGN  489


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +     QL  L  L++  N+L G +P  I  +  L  L L  N F  + P  L + 
Sbjct  298  LSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQGLGKN  357

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL ++DL +N LTG+LP ++     L+ L    N+  G IP   G+  +L  + +  N 
Sbjct  358  GNLVLVDLSSNKLTGNLPPDMCSGDRLQTLITLSNFLFGPIPESLGKCQSLSRIRMGENF  417

Query  640  L  642
            L
Sbjct  418  L  418



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 133/176 (76%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS KA+  T D  ++L+SWN ST++C+W  +TCDS LHV +L+L+  +LSG L
Sbjct  26   ISEYRALLSFKASSITDDPTNALSSWNSSTTYCSWLGITCDSRLHVTTLNLTSSSLSGTL  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
               +  LPFL  LS+A NQ SGP+P   S++S LR LNLSNN F +TFP  L++LANLQV
Sbjct  86   YDHLSHLPFLSYLSLADNQFSGPIPASFSSLSALRHLNLSNNAFNATFPSNLSRLANLQV  145

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNN+TG LP+ V  M  LRHLHLGGN+FSG+IPPEYG + +L+YLAVSGN L
Sbjct  146  LDLYNNNMTGPLPLAVASMPLLRHLHLGGNFFSGQIPPEYGTWQHLQYLAVSGNEL  201


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  +  L +  N LSG + PE+  + +L+ ++LSNNI     P    +L
Sbjct  250  LSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP   GR   L  + +S N 
Sbjct  310  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGRNGKLTVVDLSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  274  LSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGEL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + +   L  + L  N  +G +PP+      L+ L   GN 
Sbjct  334  PALEVLQLWENNFTGSIPQSLGRNGKLTVVDLSSNKLTGMLPPDMCYGNRLQTLITLGNY  393

Query  640  L  642
            L
Sbjct  394  L  394


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+Q+  
Sbjct  489  KFSGQIPSQIGRLQQLSKIDFSRNEFSGPIAPEISRCKLLTFIDLSRNELSGEIPNQITA  548

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  549  MRILNYLNLSRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVPGT-GQFGYFNYTSFLGN  607


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 59/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L NN+    FP   +  
Sbjct  394  LFGPIPDSIGKCESLNRIRMGENFLNGSIPIGLFGLPKLTQVELQNNLLTGQFPEGGSIA  453

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   TS++ L L GN FSG+IP + GR   L  +  S N
Sbjct  454  VNLGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGNKFSGQIPSQIGRLQQLSKIDFSRN  512


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 64/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G    L  L+++ N+LSG +PPE+  ++ LR L +   N +    P ++  
Sbjct  177  FSGQIPPEYGTWQHLQYLAVSGNELSGNIPPELGNLTALRELYIGYYNAYSGGIPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D     L+G++P ++ ++ ++  L L  N  SG + PE G   +L+ + +S N
Sbjct  237  LSQLVRFDAAYCGLSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLKSLKSMDLSNN  296


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG + P++G L  LV    A   LSG +P ++  +  +  L L  N    +   +L  L 
Sbjct  227  SGGIPPEIGNLSQLVRFDAAYCGLSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLK  286

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  287  SLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWEN  344


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G+L PD+     L  L    N L GP+P  I    +L  + +  N    + P  L  
Sbjct  369  KLTGMLPPDMCYGNRLQTLITLGNYLFGPIPDSIGKCESLNRIRMGENFLNGSIPIGLFG  428

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L NN LTG  P       +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  429  LPKLTQVELQNNLLTGQFPEGGSIAVNLGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGN  488


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 53/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   ++++ L L  N F    P Q+ +L  L  +D   N  +
Sbjct  456  LGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGNKFSGQIPSQIGRLQQLSKIDFSRNEFS  515

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ +   L  + L  N  SG IP +      L YL +S N L
Sbjct  516  GPIAPEISRCKLLTFIDLSRNELSGEIPNQITAMRILNYLNLSRNHL  562



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 130/176 (74%), Gaps = 1/176 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  VTCDS  HV  L+L+ L+LS  L
Sbjct  19   ISEYRALLSFKASSITNDPTHALSSWNSSTPFCSWFGVTCDSRRHVTGLNLTSLSLSATL  78

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
               +  LPFL +LS+A NQ SGP+P   SA+S LRFLNLSNN+F  TFP QLA+L+NL+V
Sbjct  79   YDHLSHLPFLSHLSLADNQFSGPIPVSFSALSALRFLNLSNNVFNQTFPSQLARLSNLEV  138

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LDLYNNN+TG LP+ V  M  LRHLHLGGN+FSG+IPPEYG + +L YLA+SGN L
Sbjct  139  LDLYNNNMTGPLPLAVASMPLLRHLHLGGNFFSGQIPPEYGTWQHLRYLALSGNEL  194


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+Q+  +
Sbjct  483  FSGRIPPQIGRLQQLSKIDFSHNKFSGPIAPEISRCKLLTFIDLSGNELSGEIPNQITSM  542

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  +    N FSG +P   G+F    Y +  GN
Sbjct  543  RILNYLNLSRNHLDGSIPGSIASMQSLTSVDFSYNNFSGLVPGT-GQFGYFNYTSFLGN  600


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNSLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP   G+   L  + +S N 
Sbjct  303  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGKNGRLTLVDLSSNK  362

Query  640  L  642
            +
Sbjct  363  I  363


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP   +  
Sbjct  387  LFGPIPDSLGKCESLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGQFPEYGSIA  446

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  + L NN L+G LP  +   TS++ L L GN FSGRIPP+ GR   L  +  S N
Sbjct  447  TDLGQISLSNNKLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQLSKIDFSHN  505


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 61/122 (50%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+ ++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +
Sbjct  266  SLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGE  325

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+VL L+ NN TG +P  + K   L  + L  N  +G +PP       L+ L   GN
Sbjct  326  LPALEVLQLWENNFTGSIPQSLGKNGRLTLVDLSSNKITGTLPPYMCYGNRLQTLITLGN  385

Query  637  GL  642
             L
Sbjct  386  YL  387


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  220  SGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTSELGNLK  279

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  280  SLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWEN  337


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 61/123 (50%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G L   V  +P L +L +  N  SG +PPE      LR+L LS N        +L  
Sbjct  145  NMTGPLPLAVASMPLLRHLHLGGNFFSGQIPPEYGTWQHLRYLALSGNELAGYIAPELGN  204

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L+ L+ L + Y N  +G +P E+  +++L  L       SG IP E G+  NL+ L +  
Sbjct  205  LSALRELYIGYYNTYSGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQV  264

Query  634  NGL  642
            N L
Sbjct  265  NSL  267


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 61/119 (51%), Gaps = 6/119 (5%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G ++ D+GQ+      S++ N+LSGP+P  I   ++++ L L  N F    P Q+ +L  
Sbjct  443  GSIATDLGQI------SLSNNKLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQ  496

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  +D  +N  +G +  E+ +   L  + L GN  SG IP +      L YL +S N L
Sbjct  497  LSKIDFSHNKFSGPIAPEISRCKLLTFIDLSGNELSGEIPNQITSMRILNYLNLSRNHL  555


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             LSG L   +G    +  L +  N+ SG +PP+I  +  L  ++ S+N F      ++++
Sbjct  458  KLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQLSKIDFSHNKFSGPIAPEISR  517

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  +DL  N L+G++P ++  M  L +L+L  N+  G IP
Sbjct  518  CKLLTFIDLSGNELSGEIPNQITSMRILNYLNLSRNHLDGSIP  560


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  + L  ++LSNN      P  +   
Sbjct  411  LNGSIPKGLFGLPKLTQVELQDNLLTGQFPEYGSIATDLGQISLSNNKLSGPLPSTIGNF  470

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             ++Q L L  N  +G +P ++ ++  L  +    N FSG I PE  R   L ++ +SGN 
Sbjct  471  TSMQKLLLDGNEFSGRIPPQIGRLQQLSKIDFSHNKFSGPIAPEISRCKLLTFIDLSGNE  530

Query  640  L  642
            L
Sbjct  531  L  531


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +     +L  L  L++  N+L G +P  +  +  L  L L  N F  + P  L + 
Sbjct  291  LSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGKN  350

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N +TG LP  +     L+ L   GNY  G IP   G+  +L  + +  N 
Sbjct  351  GRLTLVDLSSNKITGTLPPYMCYGNRLQTLITLGNYLFGPIPDSLGKCESLNRIRMGENF  410

Query  640  L  642
            L
Sbjct  411  L  411



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   185 bits (469),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 133/187 (71%), Gaps = 5/187 (3%)
 Frame = +1

Query  85   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvvsl  261
            +A +G G+   V E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VVSL
Sbjct  19   AAASGRGR---VVEHRALLDLKAAL-GDPSGALAGWDATADHCQAWSGVACDAAGRVVSL  74

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            ++S LNLSG L   V +L  L++LS AAN+LSGP+PPE+S +S LRFLNLSNN F  T P
Sbjct  75   NISXLNLSGPLPRAVSRLRSLLHLSAAANELSGPIPPELSLLSGLRFLNLSNNAFNRTLP  134

Query  442  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  621
              L++L NL VLDLYNNNLTG LPV+V  + +LRHLHLGGN+FSG IPPEYGR+ +LEYL
Sbjct  135  SALSRLKNLHVLDLYNNNLTGVLPVQVADLPALRHLHLGGNFFSGAIPPEYGRWEHLEYL  194

Query  622  AVSGNGL  642
            A+SGN L
Sbjct  195  AISGNEL  201


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  310  KNLTLLNLFRNKLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 62/123 (50%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+GVL   V  LP L +L +  N  SG +PPE      L +L +S N  G   P +L  
Sbjct  152  NLTGVLPVQVADLPALRHLHLGGNFFSGAIPPEYGRWEHLEYLAISGNELGGPIPPELGN  211

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            +  L+ L + Y N+  G LP  +  +T+L  L       SG IPPE G   NL+ L +  
Sbjct  212  VTTLRELYIGYFNSFQGGLPAAIGNITALVRLDAANCGLSGEIPPEIGNLQNLDTLFLQV  271

Query  634  NGL  642
            NGL
Sbjct  272  NGL  274


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G+   +  L +  NQ SG +PPEI  +  L  ++ S N F      ++++ 
Sbjct  468  LSGALPPSIGKFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKMDFSGNRFSGPITPEISKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  NN +G++P E+  M  L +L+L  N+  G+IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNNFSGEIPAEITGMRILNYLNLSRNHLEGKIPASISTMQSLTAVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N F    P ++  +
Sbjct  492  FSGRIPPEIGRLQQLSKMDFSGNRFSGPITPEISKCKLLTFVDLSRNNFSGEIPAEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  RILNYLNLSRNHLEGKIPASISTMQSLTAVDFSYNNLSGLV-PSTGQFSYFNATSFVGN  609


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAELKNLTLLNLFRNKLHGAIPDLIGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP       L+ L   GN 
Sbjct  334  PRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSGDQLQVLIALGNF  393

Query  640  L  642
            L
Sbjct  394  L  394


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 58/117 (50%), Gaps = 0/117 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G L   +G +  LV L  A   LSG +PPEI  +  L  L L  N        +L +
Sbjct  225  SFQGGLPAAIGNITALVRLDAANCGLSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGK  284

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +
Sbjct  285  LRSLKSMDLSNNVLTGEIPRTFAELKNLTLLNLFRNKLHGAIPDLIGDLPRLEVLQL  341


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 58/117 (50%), Gaps = 6/117 (5%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            +SP +GQ+       ++ N+LSG +PP I   S ++ L L+ N F    P ++ +L  L 
Sbjct  454  ISPTLGQI------ILSNNRLSGALPPSIGKFSGVQKLLLNQNQFSGRIPPEIGRLQQLS  507

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             +D   N  +G +  E+ K   L  + L  N FSG IP E      L YL +S N L
Sbjct  508  KMDFSGNRFSGPITPEISKCKLLTFVDLSRNNFSGEIPAEITGMRILNYLNLSRNHL  564


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  321  KLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCS  380

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               LQVL    N L G +P    +  SL  + +G NY +G +P      P L  + +  N
Sbjct  381  GDQLQVLIALGNFLFGSIPESFGRCKSLSRIRMGENYLNGSVPSGLFGLPKLAQVELQDN  440



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   184 bits (467),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  172  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAAN  348
             S L SW++STS C W  VTCD+ L  V       LNLSG L   V  LP L NLS+AAN
Sbjct  45   HSPLASWDLSTSFCLWTGVTCDASLRHVISLDLSGLNLSGTLPSSVAHLPLLRNLSLAAN  104

Query  349  QLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVY  525
            Q+SG +PPE++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV + 
Sbjct  105  QISGHIPPEMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSIT  164

Query  526  KMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             +T LRHLHLGGNYF+GRIPP YG +P LEYLAVSGN L
Sbjct  165  NLTELRHLHLGGNYFAGRIPPAYGSWPALEYLAVSGNEL  203


 Score = 81.3 bits (199),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P +  QL
Sbjct  252  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPRFEQL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  312  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGENGRLVILDLSSNK  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +S ++GQ+      S++ NQLSGP+PP I + S ++ L L  N F    P ++ +L
Sbjct  452  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRL  505

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LD  +N  +G +P E+ +   L ++ L  N  SG IP E      L YL VS N 
Sbjct  506  QQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNH  565

Query  640  L  642
            L
Sbjct  566  L  566


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G L  ++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  228  FDGGLPAEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  287

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  288  SSLKSMDLSNNMFTGEIPPRFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWEN  346


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 69/146 (47%), Gaps = 25/146 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGGLPAEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  564
            L+ L  LD  N  L G++P E+ ++                        +SL+ + L  N
Sbjct  239  LSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNN  298

Query  565  YFSGRIPPEYGRFPNLEYLAVSGNGL  642
             F+G IPP + +  NL  L +  N L
Sbjct  299  MFTGEIPPRFEQLRNLTLLNLFRNKL  324


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 61/120 (51%), Gaps = 2/120 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  L  + N  SG +PPEIS    L +++LS N      P+++  
Sbjct  493  KFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIPNEITS  552

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP--EYGRFPNLEYLAVS  630
            +  L  L++  N+L G +PV +  M SL  +    N  SG +P   ++G F +  +L  S
Sbjct  553  MRILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYNNLSGLVPSTGQFGYFNHTSFLGNS  612


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 2/112 (2%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  486
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  431  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  490

Query  487  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             N  +G +P E+ ++  L  L    N FSG IPPE  R   L Y+ +S N L
Sbjct  491  GNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNEL  542


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (48%), Gaps = 2/122 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     LV L    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  371  KLTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNGLFG  430

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  630
            L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  431  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  490

Query  631  GN  636
            GN
Sbjct  491  GN  492



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 135/189 (71%), Gaps = 4/189 (2%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  255
            R SA A  G  +G  E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VV
Sbjct  16   RPSAAASGGGRVG--EHRALLDLKAAL-GDPSGALAGWDAAADHCQAWVGVACDAAGRVV  72

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
            SL++S LNLSG L P V +L  L+ LS AANQLSGP+PPE+S +S LRFLNLSNN F  T
Sbjct  73   SLNISNLNLSGPLPPAVSRLRSLLRLSTAANQLSGPIPPELSLLSGLRFLNLSNNAFNET  132

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  615
            FP  L++L NL VLDLYNNNLTG LP+EV ++ +LRHLHLGGN+FSG IPPEYGR+ +LE
Sbjct  133  FPSALSRLKNLHVLDLYNNNLTGVLPLEVAELPALRHLHLGGNFFSGAIPPEYGRWEHLE  192

Query  616  YLAVSGNGL  642
            YLAVSGN L
Sbjct  193  YLAVSGNEL  201


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 65/123 (53%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+GVL  +V +LP L +L +  N  SG +PPE      L +L +S N  G   P +L  
Sbjct  152  NLTGVLPLEVAELPALRHLHLGGNFFSGAIPPEYGRWEHLEYLAVSGNELGGPIPPELGN  211

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            +  L+ L + Y N+  G LP  +  +T+L  L       SG+IPPE G   NL+ L +  
Sbjct  212  VTTLRELYIGYFNSFQGSLPAAIGNITALVRLDAANCGLSGKIPPEIGNLQNLDTLFLQV  271

Query  634  NGL  642
            NGL
Sbjct  272  NGL  274


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN      P   A+L
Sbjct  250  LSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  310  KNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP      NL+ L   GN 
Sbjct  334  PRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSGNNLQVLIALGNF  393

Query  640  L  642
            L
Sbjct  394  L  394


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G+   +  L +  NQ SG +P EI  +  L  ++ S N F      ++ + 
Sbjct  468  LSGALPPSIGKFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  NNL+G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  528  KLLTFVDLSRNNLSGEIPAEITGMRILNYLNLSRNHLEGEIPASISTMQSLTAVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 57/117 (49%), Gaps = 0/117 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G L   +G +  LV L  A   LSG +PPEI  +  L  L L  N        +L  
Sbjct  225  SFQGSLPAAIGNITALVRLDAANCGLSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGM  284

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE L +
Sbjct  285  LRSLKSMDLSNNALTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQL  341


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N+ SGP+ PEI     L F++LS N      P ++  +
Sbjct  492  FSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKCKLLTFVDLSRNNLSGEIPAEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  RILNYLNLSRNHLEGEIPASISTMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  609


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 56/119 (47%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L   
Sbjct  322  LHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSG  381

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NLQVL    N L G +P  + +  SL  + +G NY +G IP      PNL  + +  N
Sbjct  382  NNLQVLIALGNFLFGSIPESLGRCKSLSRIRMGENYLNGSIPSGLFSLPNLAQVELQDN  440


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 53/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L+ N F    P ++ +L  L  +D   N  +
Sbjct  458  LGQISLSNNRLSGALPPSIGKFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFS  517

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ K   L  + L  N  SG IP E      L YL +S N L
Sbjct  518  GPITPEIRKCKLLTFVDLSRNNLSGEIPAEITGMRILNYLNLSRNHL  564


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 61/123 (50%), Gaps = 2/123 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI--SAISTLRFLNLSNNIFGSTFPHQLA  453
            L+G +   +  LP L  + +  N L+G  P     S  STL  ++LSNN      P  + 
Sbjct  418  LNGSIPSGLFSLPNLAQVELQDNLLTGGFPETAGSSISSTLGQISLSNNRLSGALPPSIG  477

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            + + +Q L L  N  +G +P+E+ ++  L  +   GN FSG I PE  +   L ++ +S 
Sbjct  478  KFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKCKLLTFVDLSR  537

Query  634  NGL  642
            N L
Sbjct  538  NNL  540


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  I  +  L  L L  N F    P +L   
Sbjct  298  LTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTN  357

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP  +    +L+ L   GN+  G IP   GR  +L  + +  N 
Sbjct  358  GRLQLLDLSSNKLTGSLPPNLCSGNNLQVLIALGNFLFGSIPESLGRCKSLSRIRMGENY  417

Query  640  L  642
            L
Sbjct  418  L  418



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 132/189 (70%), Gaps = 7/189 (4%)
 Frame = +1

Query  94   AGAGKPLG---VTEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsllhvvs  258
            AGA  P G     +QA LLS+K+A + D  ++L  WN + +  HC W  V CD+ L  V 
Sbjct  25   AGAPPPDGEASADDQATLLSLKSALS-DPGAALAGWNATAAPDHCAWHGVACDATLRRVV  83

Query  259  ldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
                  LNLSG L   VG L  L+NLS A N LSGP+PPE+S +S LR LNLSNN+F  +
Sbjct  84   SLDLSGLNLSGSLPTAVGHLRHLLNLSAATNFLSGPIPPELSFLSDLRHLNLSNNLFNGS  143

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  615
            FP  L +L NL+VLDLYNNNLTG LPVEV ++++LRHLHLGGN+FSG IPPEYGR+ ++E
Sbjct  144  FPSALRRLKNLEVLDLYNNNLTGLLPVEVAELSNLRHLHLGGNFFSGVIPPEYGRWDHIE  203

Query  616  YLAVSGNGL  642
            YLAVSGN L
Sbjct  204  YLAVSGNEL  212


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +PPE+  + +L+ L+LSNN      P   A L
Sbjct  261  LSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADL  320

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  321  WNLTLLNLFRNKLDGTVPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  380

Query  640  L  642
            L
Sbjct  381  L  381


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 68/122 (56%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SGV+ P+ G+   +  L+++ N+L G +PPEI  +S LR L +   N +    P ++  
Sbjct  188  FSGVIPPEYGRWDHIEYLAVSGNELVGAIPPEIGNLSRLRQLYVGYFNSYDGGIPPEIGN  247

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G +P E+ ++ +L  L L  N  +G +PPE GR  +L+ L +S N
Sbjct  248  LSALVRFDAANCGLSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNN  307

Query  637  GL  642
             L
Sbjct  308  AL  309


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L +   N   G +PPEI  +S L   + +N     + P +L +
Sbjct  212  LVGAIPPEIGNLSRLRQLYVGYFNSYDGGIPPEIGNLSALVRFDAANCGLSGSIPPELGR  271

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  L L  N L G+LP E+ ++ SL+ L L  N  +G IPP +    NL  L +  N
Sbjct  272  LENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRN  331

Query  637  GL  642
             L
Sbjct  332  KL  333


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++G+L  L +L ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  285  LAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDL  344

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L++NN TG +P  + +   L+ L L  N  +G +P +      L  L   GN 
Sbjct  345  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPLDLCSGNKLHTLIALGNA  404

Query  640  L  642
            L
Sbjct  405  L  405


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 59/117 (50%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L +
Sbjct  239  GGIPPEIGNLSALVRFDAANCGLSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRS  298

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ LDL NN LTG++P     + +L  L+L  N   G +P   G  P LE L +  N
Sbjct  299  LKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDLPELEVLQLWDN  355


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    L  L ++ NQ SG +PPEI  +  L  ++ S N F      ++++ 
Sbjct  479  LSGPLPLSIGNFSGLQKLLLSQNQFSGRIPPEIGRLQQLSKVDFSGNRFSGEIAPEISKC  538

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  NNL+G++P E+  +  L +L++  N+  G IPP      +L  +  S N 
Sbjct  539  KLLTFVDLSRNNLSGEIPAEIAGIRILNYLNVSRNHLEGSIPPSIATMQSLTAVDFSYNN  598

Query  640  L  642
            L
Sbjct  599  L  599


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 58/118 (49%), Gaps = 3/118 (3%)
 Frame = +1

Query  298  PDVGQLPF---LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            PD G  P    L  +S++ N+LSGP+P  I   S L+ L LS N F    P ++ +L  L
Sbjct  458  PDTGDAPISSSLGQISLSNNRLSGPLPLSIGNFSGLQKLLLSQNQFSGRIPPEIGRLQQL  517

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              +D   N  +G++  E+ K   L  + L  N  SG IP E      L YL VS N L
Sbjct  518  SKVDFSGNRFSGEIAPEISKCKLLTFVDLSRNNLSGEIPAEIAGIRILNYLNVSRNHL  575


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ SG + PEIS    L F++LS N      P ++A +
Sbjct  503  FSGRIPPEIGRLQQLSKVDFSGNRFSGEIAPEISKCKLLTFVDLSRNNLSGEIPAEIAGI  562

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L++  N+L G +P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  563  RILNYLNVSRNHLEGSIPPSIATMQSLTAVDFSYNNLSGLV-PSTGQFSYFNVTSFVGN  620


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 62/143 (43%), Gaps = 24/143 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P    L  L  L++  N+L G VP  I  +  L  L L +N F    P  + + 
Sbjct  309  LTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDLPELEVLQLWDNNFTGIIPRGIGRS  368

Query  460  ANLQVLDLYNNNLTGDLPVEVY------------------------KMTSLRHLHLGGNY  567
              LQ+LDL +N LTGDLP+++                         +  SL  + LG NY
Sbjct  369  GKLQLLDLSSNKLTGDLPLDLCSGNKLHTLIALGNALFGPIPESLGRCFSLSRVRLGQNY  428

Query  568  FSGRIPPEYGRFPNLEYLAVSGN  636
             +G IP      PNL  + +  N
Sbjct  429  LNGSIPSGLFCLPNLAQVELQDN  451



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 133/177 (75%), Gaps = 3/177 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGV  291
            ++  ALLS+KA F+  + + L++WN S    HC+W  V+CD     VVSLDL+GLNLSG 
Sbjct  30   SDVEALLSLKADFSDATSAVLSAWNSSADDDHCSWPGVSCDPLQGFVVSLDLTGLNLSGT  89

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LSP VG+L  L+NLS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  LA+L NL 
Sbjct  90   LSPAVGRLRHLLNLSAASNSLSGPIPAELSRLSDLRHLNLSNNLFNGSFPSALARLKNLL  149

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLDLYNNNLTG LP EV ++  LRHLHLGGN+F+G IPPE+GR+  LEYLAVSGN L
Sbjct  150  VLDLYNNNLTGPLPTEVAELPELRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNEL  206


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  + +  N L+G +PPE+  +  L+ ++LSNN      P   A L
Sbjct  255  LSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADL  314

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  + +L  L L  N F+G IP   G+   LE L +S N 
Sbjct  315  QNLTLLNLFRNKLHGSIPEFIADLPTLEVLQLWENNFTGGIPRRLGQSGQLELLDLSSNK  374

Query  640  L  642
            L
Sbjct  375  L  375


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 65/123 (53%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L  +V +LP L +L +  N  +G +PPE      L +L +S N  G   P +L +
Sbjct  157  NLTGPLPTEVAELPELRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGK  216

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L  L+ L L Y N+  G +P E+  + +L  L +     SG IPPE G   NL+ + +  
Sbjct  217  LTTLRQLYLGYFNSFEGRIPPEIGGLAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQV  276

Query  634  NGL  642
            NGL
Sbjct  277  NGL  279


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 70/146 (48%), Gaps = 25/146 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  399
             +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++TLR                    
Sbjct  182  FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGKLTTLRQLYLGYFNSFEGRIPPEIGG  241

Query  400  -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
                  L+++N       P +L  L NL  + L  N LTGDLP E+ ++ +L+ + L  N
Sbjct  242  LAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNN  301

Query  565  YFSGRIPPEYGRFPNLEYLAVSGNGL  642
              +G IP  +    NL  L +  N L
Sbjct  302  ALAGEIPATFADLQNLTLLNLFRNKL  327


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +A L
Sbjct  279  LTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADL  338

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + +   L  L L  N  +G +PP+      L+ L V GN 
Sbjct  339  PTLEVLQLWENNFTGGIPRRLGQSGQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNF  398

Query  640  L  642
            L
Sbjct  399  L  399


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P VG    +  L +  NQ SG +PPEI  +  L  ++ S N F      +++Q 
Sbjct  473  LSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSGNQFSGLISPEISQC  532

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  533  KLLTFVDLSRNELSGEIPSEITGMRILNYLNLSRNQLEGNIPSSIATMQSLTAIDFSYNN  592

Query  640  L  642
            L
Sbjct  593  L  593


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + NQ SG + PEIS    L F++LS N      P ++  +
Sbjct  497  FSGRIPPEIGRLQQLSKVDFSGNQFSGLISPEISQCKLLTFVDLSRNELSGEIPSEITGM  556

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G++P  +  M SL  +    N  SG +P
Sbjct  557  RILNYLNLSRNQLEGNIPSSIATMQSLTAIDFSYNNLSGLVP  598


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 62/120 (52%), Gaps = 6/120 (5%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            + ++SPD+GQ+      S++ N+LSGP+PP +   S ++ L L+ N F    P ++ +L 
Sbjct  456  AALISPDLGQI------SLSNNRLSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQ  509

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L  +D   N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N L
Sbjct  510  QLSKVDFSGNQFSGLISPEISQCKLLTFVDLSRNELSGEIPSEITGMRILNYLNLSRNQL  569


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L++  N+L G +P  I+ + TL  L L  N F    P +L Q 
Sbjct  303  LAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADLPTLEVLQLWENNFTGGIPRRLGQS  362

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L++LDL +N LTG+LP ++     L+ L + GN+  G IP   GR  +L  + +  N 
Sbjct  363  GQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNFLFGPIPDTLGRCESLSRIRMGENY  422

Query  640  L  642
            L
Sbjct  423  L  423



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 132/186 (71%), Gaps = 4/186 (2%)
 Frame = +1

Query  85   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  264
            +A  GAG      E  ALLS+KA  + D  ++L  W+ +T HC+W  VTCD    VVSLD
Sbjct  20   AADDGAGY---AEEHRALLSLKAQLS-DPGAALGPWDATTDHCSWPGVTCDDAGAVVSLD  75

Query  265  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  444
            LSG NLSG+L P VG+L  L+ LS AAN  SGP+P E++ +  LR LNLSNNIF  +FP 
Sbjct  76   LSGRNLSGLLPPAVGRLRSLLRLSAAANSFSGPIPSELALLPALRHLNLSNNIFNGSFPA  135

Query  445  QLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLA  624
             LA+LA+L+VLDLYNNNLTG LP E+  +  LRH+HLGGN+FSG IPPEYG +  LEYLA
Sbjct  136  PLARLADLRVLDLYNNNLTGPLPRELAALPQLRHIHLGGNFFSGSIPPEYGSWQFLEYLA  195

Query  625  VSGNGL  642
            +SGN L
Sbjct  196  ISGNEL  201


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L G +PPE+S + +L+ ++LSNN      P   A L
Sbjct  250  LSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAAL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            +NL +L+L+ N L G +P  V  +  L  L +  N F+G IP   G    L+ L +S N 
Sbjct  310  SNLTLLNLFRNKLFGAIPEFVGDLPELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 63/117 (54%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N  G   P +L++L +
Sbjct  228  GGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRS  287

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ +DL NN LTG++P     +++L  L+L  N   G IP   G  P LE L V  N
Sbjct  288  LKSMDLSNNALTGEIPPSFAALSNLTLLNLFRNKLFGAIPEFVGDLPELEVLQVWEN  344


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G + P+VG+L  L  L +++N+ SGP+ PE+S    L F++LS N      P  +A 
Sbjct  491  SFTGKIPPEVGRLQQLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAA  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +PV +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  551  MRILNYLNLSRNHLEGPIPVAISTMQSLTAVDFSYNNLSGVV-PSTGQFSYFNATSFVGN  609


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L I   N   G +PPEI  +STL  L+ +N       P ++  
Sbjct  201  LGGPIPPEIGNLSALRELYIGYYNSYDGGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGN  260

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  L L  N L G++P E+ ++ SL+ + L  N  +G IPP +    NL  L +  N
Sbjct  261  LRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRN  320

Query  637  GL  642
             L
Sbjct  321  KL  322


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++ +L  L ++ ++ N L+G +PP  +A+S L  LNL  N      P  +  L
Sbjct  274  LGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRNKLFGAIPEFVGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL ++ NN TG +P  +     L+ L L  N  +G +PP+      L+ L   GN 
Sbjct  334  PELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCYGNKLQTLIALGNF  393

Query  640  L  642
            L
Sbjct  394  L  394


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 6/120 (5%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            S  +SP++GQ+       ++ N+L+GP+PP I   S L+ L L+ N F    P ++ +L 
Sbjct  451  SSSISPNLGQV------CLSNNRLAGPLPPSIGNYSGLQKLLLNQNSFTGKIPPEVGRLQ  504

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L  LDL +N  +G +  EV K   L  + L  N  SG +P +      L YL +S N L
Sbjct  505  QLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAAMRILNYLNLSRNHL  564


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 55/122 (45%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   VG LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  321  KLFGAIPEFVGDLPELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCY  380

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               LQ L    N L G +P  + +  SL  + +G NY +G IP      PNL  + +  N
Sbjct  381  GNKLQTLIALGNFLFGQIPESLGRCESLSRIRMGDNYLNGTIPQGLLSLPNLSQVELQDN  440

Query  637  GL  642
             L
Sbjct  441  YL  442


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 59/146 (40%), Gaps = 26/146 (18%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L G +P  +    +L  + + +N    T P  L  
Sbjct  369  KLTGSLPPDLCYGNKLQTLIALGNFLFGQIPESLGRCESLSRIRMGDNYLNGTIPQGLLS  428

Query  457  LANLQVLDLYNNNLTGD--------------------------LPVEVYKMTSLRHLHLG  558
            L NL  ++L +N LTG                           LP  +   + L+ L L 
Sbjct  429  LPNLSQVELQDNYLTGGFPDTGSSSISPNLGQVCLSNNRLAGPLPPSIGNYSGLQKLLLN  488

Query  559  GNYFSGRIPPEYGRFPNLEYLAVSGN  636
             N F+G+IPPE GR   L  L +S N
Sbjct  489  QNSFTGKIPPEVGRLQQLSKLDLSSN  514



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   182 bits (462),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = +1

Query  163  ADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSI  339
            A   S+L +W  STS C W  VTCD+    V       LNLSG LS D+  L  L N S+
Sbjct  40   AGDDSALATWTDSTSFCGWAGVTCDASRRHVISLDLSGLNLSGTLSSDIAHLRLLQNFSV  99

Query  340  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPV  516
            +ANQ+SGP+PPEIS++  LR+LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV
Sbjct  100  SANQISGPIPPEISSLFGLRYLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPV  159

Query  517  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             V  +T LRHLHLGGNYF+GRIP  YG +P +EYLAVSGN L
Sbjct  160  SVTNLTQLRHLHLGGNYFAGRIPAAYGSWPVIEYLAVSGNEL  201


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSGP+ PE+  +  L  ++LSNN+F    P   AQL
Sbjct  250  LTGQIPPEIGKLQKLDTLFLQVNGLSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP + G    L+ L +S N 
Sbjct  310  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNK  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G +    G  P +  L+++ N+L G +PPEI  +STLR L +   N F    P ++  
Sbjct  177  FAGRIPAAYGSWPVIEYLAVSGNELVGKIPPEIGNLSTLRELYIGYYNAFEDGLPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  LTG +P E+ K+  L  L L  N  SG + PE G  P LE + +S N
Sbjct  237  LSELVRFDAANCGLTGQIPPEIGKLQKLDTLFLQVNGLSGPLTPELGTLPILESMDLSNN  296


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G LP L ++ ++ N   G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQLKNLTLLNLFRNKLHGAIPEFIGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P ++ +   L+ L L  N  +G +PP      NL+ L    N 
Sbjct  334  PELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNKLTGTLPPNMCSGNNLQTLITLSNF  393

Query  640  L  642
            L
Sbjct  394  L  394


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = +1

Query  298  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P  G++ F L  +S++ NQLSGP+PP I   S ++ L L  N F    P Q+ +L  L  
Sbjct  447  PVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGNKFTGLIPQQIGKLQQLSK  506

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +D  +N  +G +  E+ +   L  + L  N  +G IP E      L YL +S N L
Sbjct  507  MDFSHNRFSGRIAPEISQCKLLTFVDLSRNELAGEIPNEITGMRILNYLNLSRNHL  562


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L   +N L GP+P  +    +L  + +  N    + P  L  
Sbjct  369  KLTGTLPPNMCSGNNLQTLITLSNFLFGPIPDSLGECESLTRIRMGENFLNGSIPKGLFG  428

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG+ PV      +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  429  LPKLTQVELQDNYLTGEFPVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGN  488


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 57/122 (47%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   +G LP L  L +  N  +G +P ++     L+ L+LS+N    T P  +  
Sbjct  321  KLHGAIPEFIGDLPELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNKLTGTLPPNMCS  380

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              NLQ L   +N L G +P  + +  SL  + +G N+ +G IP      P L  + +  N
Sbjct  381  GNNLQTLITLSNFLFGPIPDSLGECESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDN  440

Query  637  GL  642
             L
Sbjct  441  YL  442


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP      
Sbjct  394  LFGPIPDSLGECESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTGRVA  453

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN F+G IP + G+   L  +  S N
Sbjct  454  FNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGNKFTGLIPQQIGKLQQLSKMDFSHN  512


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ Q   L  + ++ N+L+G +P EI+ +  L +LNLS N      P  ++ +
Sbjct  514  FSGRIAPEISQCKLLTFVDLSRNELAGEIPNEITGMRILNYLNLSRNHLVGPIPASISSM  573

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  574  QSLTSVDFSYNNLSGLVP  591



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = +1

Query  172  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  351
            +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LSPDV  L FL NLS+AAN+
Sbjct  2    KSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLSPDVAFLRFLTNLSLAANE  61

Query  352  LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  531
             SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VLDLYNNN+TGD P+ V +M
Sbjct  62   FSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVLDLYNNNMTGDFPIVVTEM  121

Query  532  TSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +SLRHLHLGGN+F+GRIPPE GR  +LEYLAVSGN L
Sbjct  122  SSLRHLHLGGNFFAGRIPPEVGRMQSLEYLAVSGNEL  158


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  207  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  266

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+  IP   G+   L+ L +S N 
Sbjct  267  KNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNK  326

Query  640  L  642
            L
Sbjct  327  L  327


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 71/122 (58%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P+VG++  L  L+++ N+LSGP+PPE+  ++ LR L +   N +    P ++  
Sbjct  134  FAGRIPPEVGRMQSLEYLAVSGNELSGPIPPELGNLTNLRELYIGYFNAYDGGLPAEIGN  193

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD  N  L+G +P E+ K+ +L  L L  N  SG + PE G+  +L+ L +S N
Sbjct  194  LSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNN  253

Query  637  GL  642
             L
Sbjct  254  ML  255


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  446  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  505

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  506  MRILNYLNLSKNHLVGGIPATIASMQSLTSVDFSYNNLSGLV-PGTGQFSYFNYTSFLGN  564


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 59/117 (50%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL +
Sbjct  185  GGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNS  244

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ LDL NN L G++PV   ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  245  LKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWEN  301


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  231  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  290

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE  591
              L+VL L+ NN T  +P  + K   L+ L L  N  +G +PP+
Sbjct  291  PKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNKLTGTLPPD  334


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  351  LFGPIPESLGKCASLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNFLSGEFPITDSIS  410

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL  + L NN LTG +P  +   + ++ L L GN FSG+IPPE GR   L  +  S N 
Sbjct  411  LNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGNKFSGQIPPEIGRLQQLSKIDFSSNM  470

Query  640  L  642
            L
Sbjct  471  L  471


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 60/123 (49%), Gaps = 6/123 (5%)
 Frame = +1

Query  277  NLSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
             L+G L PD+    +L  L+ LS   N L GP+P  +   ++L  + +  N    + P  
Sbjct  326  KLTGTLPPDMCFGNRLQILIALS---NFLFGPIPESLGKCASLNRIRMGENFLNGSIPKG  382

Query  448  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L  L  L  ++L +N L+G+ P+      +L  + L  N  +G IPP  G F  ++ L +
Sbjct  383  LLSLPKLSQVELQDNFLSGEFPITDSISLNLGQISLSNNRLTGSIPPTIGNFSGVQKLLL  442

Query  628  SGN  636
             GN
Sbjct  443  DGN  445



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   180 bits (457),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 130/174 (75%), Gaps = 2/174 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLSP  300
            E   LLS+KAA   D  +SL SWN ST +C+W  V CD+  + VVSLDLS  NL+G L+P
Sbjct  28   EYRYLLSLKAAII-DPDNSLQSWNSSTDYCSWSGVACDASSNHVVSLDLSARNLNGTLAP  86

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
            ++G+L  LVN+++A NQ +G +P EIS I+ L+ LNLSNN F + FP   + L NL+VLD
Sbjct  87   EIGRLRSLVNITVAENQFAGGIPLEISQINGLKLLNLSNNYFSANFPANFSGLKNLEVLD  146

Query  481  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LYNNNLTG LP+EV +M +LRHLHLGGN+F+G IPPEYG++  +EYLAVSGN L
Sbjct  147  LYNNNLTGPLPLEVTEMEALRHLHLGGNFFTGTIPPEYGKWGFIEYLAVSGNEL  200


 Score = 77.4 bits (189),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P+  +L  L  L +  N LSGP+ PE+ ++ +L+ ++LSNN+     P + ++L
Sbjct  249  LSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L+ L L  N F+G +P + G   NL  L +S N 
Sbjct  309  KNLTLLNLFRNRLHGSIPGFIGDLPELQVLQLWENNFTGSVPQQLGMNGNLILLDISSNK  368

Query  640  L  642
            L
Sbjct  369  L  369


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G+   L  L +  N  SG +PP+I  +  L  L+ S+N F      ++   
Sbjct  465  LSGQLPASIGKFSSLQKLLLDGNGFSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L V+DL  N L G +P E+ KM  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  525  KLLTVVDLSGNELNGTIPSEITKMRILNYLNLSRNHLMGGIPPSIQTMQSLTSVDFSYNN  584

Query  640  L  642
            L
Sbjct  585  L  585


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P+ G+  F+  L+++ N+L+G +P E+  ++ L+ L L   NI+    P +L  
Sbjct  176  FTGTIPPEYGKWGFIEYLAVSGNELTGKIPGELGNLTKLQQLYLGYYNIYEGGIPPELGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD+ N  L+G +P E  K+  L  L L  N  SG I PE G   +L+ + +S N
Sbjct  236  LSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNN  295

Query  637  GL  642
             L
Sbjct  296  ML  297


 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L ++ ++ N L G +P E S +  L  LNL  N    + P  +  L
Sbjct  273  LSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE  591
              LQVL L+ NN TG +P ++    +L  L +  N  +G +PP+
Sbjct  333  PELQVLQLWENNFTGSVPQQLGMNGNLILLDISSNKLTGSVPPQ  376


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 58/114 (51%), Gaps = 0/114 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV L +A   LSG +PPE   +  L  L L  N        +L  L +
Sbjct  227  GGIPPELGNLSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKS  286

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L+ +DL NN L G +PVE  ++ +L  L+L  N   G IP   G  P L+ L +
Sbjct  287  LKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDLPELQVLQL  340


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L  N      P      
Sbjct  393  LFGPIPESLGECVSLARIRMGENYLNGSIPKGLLSLPNLVQVELQANYLTGNLPDSGKAS  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  L L NN L+G LP  + K +SL+ L L GN FSG+IPP+ G+   L  L  S N
Sbjct  453  ENLGQLSLSNNRLSGQLPASIGKFSSLQKLLLDGNGFSGQIPPDIGKLQQLSKLDFSDN  511


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + PD+G+L  L  L  + N+ SG + PEI+    L  ++LS N    T P ++ ++
Sbjct  489  FSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNCKLLTVVDLSGNELNGTIPSEITKM  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  549  RILNYLNLSRNHLMGGIPPSIQTMQSLTSVDFSYNNLSGLVP  590


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP LV + + AN L+G +P    A   L  L+LSNN      P  + + 
Sbjct  417  LNGSIPKGLLSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNNRLSGQLPASIGKF  476

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            ++LQ L L  N  +G +P ++ K+  L  L    N FSG I PE      L  + +SGN 
Sbjct  477  SSLQKLLLDGNGFSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNCKLLTVVDLSGNE  536

Query  640  L  642
            L
Sbjct  537  L  537


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 61/124 (49%), Gaps = 6/124 (5%)
 Frame = +1

Query  280  LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
            L+G + P +   G+L  L+ L    N L GP+P  +    +L  + +  N    + P  L
Sbjct  369  LTGSVPPQLCYGGKLTTLITLD---NFLFGPIPESLGECVSLARIRMGENYLNGSIPKGL  425

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  630
              L NL  ++L  N LTG+LP       +L  L L  N  SG++P   G+F +L+ L + 
Sbjct  426  LSLPNLVQVELQANYLTGNLPDSGKASENLGQLSLSNNRLSGQLPASIGKFSSLQKLLLD  485

Query  631  GNGL  642
            GNG 
Sbjct  486  GNGF  489



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TG LP+ V ++ +LRHLHLGGNY +G+IPPEYG + +L+YLAVSGN L
Sbjct  145  DLYNNNMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNEL  199


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  308  KNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G L   V +LP L +L +  N L+G +PPE  +   L++L +S N    T P ++  
Sbjct  150  NMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIPPEIGN  209

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N  TG +P ++  +T L  L       SG IP E G+  NL+ L +  
Sbjct  210  LTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQV  269

Query  634  NGL  642
            N L
Sbjct  270  NAL  272


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L I   N+ +G +PP+I  ++ L  L+ +        PH++ +
Sbjct  199  LDGTIPPEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGK  258

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  L L  N L+G L  E+  + SL+ + L  N  +G IP  +G   NL  L +  N
Sbjct  259  LQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRN  318

Query  637  GL  642
             L
Sbjct  319  KL  320


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P +G L  L+ L  A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLK  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE + +  N
Sbjct  285  SLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWEN  342


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 54/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  ++++ NQLSGP+PP I   S ++ L L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  454  LGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHNRFS  513

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ K   L  + L  N  SG IP E      L Y  +S N L
Sbjct  514  GPIAPEISKCKLLTFVDLSRNELSGIIPNEITHMKILNYFNISRNHL  560


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  488  FEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L   ++  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  KILNYFNISRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N L+G +P     +  L  LNL  N      P  +  +
Sbjct  272  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDM  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+V+ L+ NN TG++P+ +     L  L +  N  +G +PP       L+ L   GN 
Sbjct  332  PALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNF  391

Query  640  L  642
            L
Sbjct  392  L  392


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P +     L  L    N L GP+P  +    +L  + +  N F  + P  L  
Sbjct  367  KLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFG  426

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  427  LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N  +G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDNYLSGNFPETHSVS  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN F G+IP + GR   L  +  S N
Sbjct  452  VNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHN  510


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +    G+L  L  L++  N+L G +P  I  +  L  + L  N F    P  L   
Sbjct  296  LTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTN  355

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L +LD+ +N LTG LP  +     L+ L   GN+  G IP   G   +L  + +  N
Sbjct  356  GKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGEN  414



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TG LP+ V ++ +LRHLHLGGNY +G+IPPEYG + +L+YLAVSGN L
Sbjct  145  DLYNNNMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNEL  199


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP   G    L  L +S N 
Sbjct  308  KNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G L   V +LP L +L +  N L+G +PPE  +   L++L +S N    T P ++  
Sbjct  150  NMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIPPEIGN  209

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N  TG +P ++  +T L  L       SG IP E G+  NL+ L +  
Sbjct  210  LTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQV  269

Query  634  NGL  642
            N L
Sbjct  270  NAL  272


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L I   N+ +G +PP+I  ++ L  L+ +        PH++ +
Sbjct  199  LDGTIPPEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGK  258

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  L L  N L+G L  E+  + SL+ + L  N  +G IP  +G   NL  L +  N
Sbjct  259  LQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRN  318

Query  637  GL  642
             L
Sbjct  319  KL  320


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 54/107 (50%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  ++++ NQLSGP+PP I   S ++ L L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  454  LGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHNRFS  513

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ K   L  + L  N  SG IP E      L Y  +S N L
Sbjct  514  GPIAPEISKCKLLTFVDLSRNELSGIIPNEITHMKILNYFNISRNHL  560


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P +G L  L+ L  A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLK  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP   G  P LE + +  N
Sbjct  285  SLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWEN  342


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  488  FEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L   ++  N+L G +P  +  M SL  +    N  SG +P   G+F    Y +  GN
Sbjct  548  KILNYFNISRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  605


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N L+G +P     +  L  LNL  N      P  +  +
Sbjct  272  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDM  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+V+ L+ NN TG++P+ +     L  L +  N  +G +PP       L+ L   GN 
Sbjct  332  PALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNF  391

Query  640  L  642
            L
Sbjct  392  L  392


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P +     L  L    N L GP+P  +    +L  + +  N F  + P  L  
Sbjct  367  KLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFG  426

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L+G+ P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  427  LPKLSQVELQDNYLSGNFPETHSVSVNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGN  486


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N  +G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGGCESLTRIRMGENFFNGSIPKGLFGLPKLSQVELQDNYLSGNFPETHSVS  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   + ++ L L GN F G+IP + GR   L  +  S N
Sbjct  452  VNLGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHN  510


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +    G+L  L  L++  N+L G +P  I  +  L  + L  N F    P  L   
Sbjct  296  LTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIPMSLGTN  355

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L +LD+ +N LTG LP  +     L+ L   GN+  G IP   G   +L  + +  N
Sbjct  356  GKLSLLDISSNKLTGTLPPYLCSGNMLQTLITLGNFLFGPIPESLGGCESLTRIRMGEN  414



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 119/173 (69%), Gaps = 2/173 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  303
            E  ALLSIK+  + D  ++LT+W+ +T HC W  VTCD    V        NLSG LSP 
Sbjct  30   EHHALLSIKSQLS-DPGAALTAWDPATDHCAWPGVTCDRAAVVELDLSGR-NLSGPLSPA  87

Query  304  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  483
             G L  L+ LS A N LSGP+PP ++ ++ LR LNLSNN+F  +FP  LA LA+L+VLDL
Sbjct  88   FGSLRSLLRLSAAENSLSGPIPPALALLTVLRHLNLSNNLFDGSFPPALAGLADLRVLDL  147

Query  484  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            YNNNLTG LP EV  +  LRHLHLGGN+FSG IP EYGR+  LEYLAVSGN L
Sbjct  148  YNNNLTGPLPREVAALHQLRHLHLGGNFFSGSIPSEYGRWQFLEYLAVSGNEL  200


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L +L +  N L G +P E+  + +L+ ++LSNN      P   A L
Sbjct  249  LSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V  +  L  L L  N F+G +P   G+   L+ L +S N 
Sbjct  309  GNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKNGRLQSLDLSSNK  368

Query  640  L  642
            L
Sbjct  369  L  369


 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +  + G+  FL  L+++ N+L GP+PPEI  +S+LR L +   N +    P ++  
Sbjct  176  FSGSIPSEYGRWQFLEYLAVSGNELGGPIPPEIGNLSSLRELYIGYYNSYEGGLPPEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD+ N  L+G +P E+  +  L  L L  N   G IP E GR  +L+ + +S N
Sbjct  236  LSTLLRLDVANCGLSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNN  295

Query  637  GL  642
             L
Sbjct  296  AL  297


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G + P+VG+L  L  L  + N+ +GP+ PEIS    L F++LS N      P ++A 
Sbjct  490  SFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAA  549

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  550  MRILNYLNLSRNHLEGQIPAAISTMQSLTQVDFSYNNLSGVVP  592


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 61/117 (52%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L P++G L  L+ L +A   LSG +PPEI  +  L  L L  N      P +L +L +
Sbjct  227  GGLPPEIGNLSTLLRLDVANCGLSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLRS  286

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  287  LKSMDLSNNALTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWEN  343


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L I   N   G +PPEI  +STL  L+++N       P ++  
Sbjct  200  LGGPIPPEIGNLSSLRELYIGYYNSYEGGLPPEIGNLSTLLRLDVANCGLSGRIPPEIGN  259

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  L L  N L G++P+E+ ++ SL+ + L  N  +G IPP +    NL  L +  N
Sbjct  260  LRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADLGNLTLLNLFRN  319

Query  637  GL  642
             L
Sbjct  320  KL  321


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +  ++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  273  LVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP+      L+ L   GN 
Sbjct  333  PELEVLQLWENNFTGSVPRRLGKNGRLQSLDLSSNKLTGSLPPDLCYGNKLQTLIALGNF  392

Query  640  L  642
            L
Sbjct  393  L  393


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P +     L  L +  N  +G +PPE+  +  L  L+ S N F      ++++ 
Sbjct  467  LTGPLPPSIANFFGLQKLLLNQNSFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKC  526

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G+IP       +L  +  S N 
Sbjct  527  KLLTFVDLSRNELSGDIPEEIAAMRILNYLNLSRNHLEGQIPAAISTMQSLTQVDFSYNN  586

Query  640  L  642
            L
Sbjct  587  L  587


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 57/118 (48%), Gaps = 3/118 (3%)
 Frame = +1

Query  298  PDVGQLPFLVNL---SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            PD G+ P   NL    ++ N+L+GP+PP I+    L+ L L+ N F    P ++ +L  L
Sbjct  446  PDTGRSPISPNLGQICLSNNRLTGPLPPSIANFFGLQKLLLNQNSFTGGIPPEVGRLQQL  505

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              LD   N   G +  E+ K   L  + L  N  SG IP E      L YL +S N L
Sbjct  506  SKLDFSGNRFAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAAMRILNYLNLSRNHL  563


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F  + P +L + 
Sbjct  297  LTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKN  356

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ LDL +N LTG LP ++     L+ L   GN+  G IP   GR  +L  + ++ N 
Sbjct  357  GRLQSLDLSSNKLTGSLPPDLCYGNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENY  416

Query  640  L  642
            L
Sbjct  417  L  417


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 58/146 (40%), Gaps = 26/146 (18%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + ++ N    + P  L  
Sbjct  368  KLTGSLPPDLCYGNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENYLNGSIPRGLFS  427

Query  457  LANLQVLDLY--------------------------NNNLTGDLPVEVYKMTSLRHLHLG  558
            L NL  ++L                           NN LTG LP  +     L+ L L 
Sbjct  428  LPNLSQVELQDNLLTGGFPDTGRSPISPNLGQICLSNNRLTGPLPPSIANFFGLQKLLLN  487

Query  559  GNYFSGRIPPEYGRFPNLEYLAVSGN  636
             N F+G IPPE GR   L  L  SGN
Sbjct  488  QNSFTGGIPPEVGRLQQLSKLDFSGN  513


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 53/120 (44%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   VG LP L  L +  N  +G VP  +     L+ L+LS+N    + P  L  
Sbjct  320  KLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKNGRLQSLDLSSNKLTGSLPPDLCY  379

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               LQ L    N L G +P  + +  SL  + +  NY +G IP      PNL  + +  N
Sbjct  380  GNKLQTLIALGNFLFGPIPESLGRCKSLSRIRMAENYLNGSIPRGLFSLPNLSQVELQDN  439



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGV  291
            L  +E  ALLS+++A T  +   L+SWN STS+C+W  VTCDS  HV++L+L+GL+LSG 
Sbjct  18   LPFSEYTALLSLRSAITDATPPVLSSWNASTSYCSWLGVTCDSHRHVIALNLTGLDLSGT  77

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LS D+  LPFL NLS+A N+ SGP+PP +S++S+LR LNLSNN F  TFP +L++L +L+
Sbjct  78   LSADIAHLPFLSNLSLATNKFSGPIPPALSSLSSLRLLNLSNNGFNQTFPPELSRLQSLE  137

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLDLYNNN+TG LP+   +M +LRHLHLGGN+FSGRIPPEYG++  LEYLAVSGN L
Sbjct  138  VLDLYNNNMTGALPLAAAQMLNLRHLHLGGNFFSGRIPPEYGQWQRLEYLAVSGNEL  194


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++  +G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   ++L
Sbjct  243  LSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSEL  302

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +L+L+ N L G +P  + ++ SL  + L  N F+G IP   G+   L  L +S N 
Sbjct  303  KNITLLNLFRNKLHGAIPEFIGELPSLEVVQLWENNFTGSIPEGLGKNGRLSVLDISSNK  362

Query  640  L  642
            L
Sbjct  363  L  363


 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N  SGP+PP+I  +  L  ++ S N F      +++Q 
Sbjct  459  LSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNKFSGRIEPEISQC  518

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  N+L+G++P E+  M  L  L+L  N+  G IP       +L  +  S N 
Sbjct  519  KLLTFLDLSRNDLSGEIPNEITGMRILNCLNLSSNHLVGSIPSSISSMQSLTSVDFSYNN  578

Query  640  L  642
            L
Sbjct  579  L  579


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +P   S +  +  LNL  N      P  + +L
Sbjct  267  LSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSELKNITLLNLFRNKLHGAIPEFIGEL  326

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+V+ L+ NN TG +P  + K   L  L +  N  +G +PP
Sbjct  327  PSLEVVQLWENNFTGSIPEGLGKNGRLSVLDISSNKLTGALPP  369


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  387  LFGPIPEALGSCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGGFPEAGSVA  446

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   +S++ L L GN FSG IPP+ GR   L  +  SGN
Sbjct  447  VNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGN  505


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 64/122 (52%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ GQ   L  L+++ N+L G +PPEI  +++LR L +   N +    P ++  
Sbjct  170  FSGRIPPEYGQWQRLEYLAVSGNELEGKIPPEIGNLTSLRELYIGYYNTYEGGIPPEIGN  229

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD     L+G++   + K+  L  L L  N  SG + PE G   +L+ + +S N
Sbjct  230  LSELVRLDAAYCGLSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKSLKSMDLSNN  289

Query  637  GL  642
             L
Sbjct  290  ML  291


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 58/116 (50%), Gaps = 1/116 (1%)
 Frame = +1

Query  298  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P+ G +   L  ++++ NQLSGP+PP I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  440  PEAGSVAVNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSK  499

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +D   N  +G +  E+ +   L  L L  N  SG IP E      L  L +S N L
Sbjct  500  IDFSGNKFSGRIEPEISQCKLLTFLDLSRNDLSGEIPNEITGMRILNCLNLSSNHL  555


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG  P   S    L  + LSNN      P  +   
Sbjct  411  LNGSIPKGLFGLPKLTQVELQDNYLSGGFPEAGSVAVNLGQITLSNNQLSGPLPPSIGNF  470

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            +++Q L L  N  +G +P ++ ++  L  +   GN FSGRI PE  +   L +L +S N 
Sbjct  471  SSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNKFSGRIEPEISQCKLLTFLDLSRND  530

Query  640  L  642
            L
Sbjct  531  L  531


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 57/117 (49%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV L  A   LSG +   +  +  L  L L  N        +L  L +
Sbjct  221  GGIPPEIGNLSELVRLDAAYCGLSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKS  280

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ +DL NN L+G++P    ++ ++  L+L  N   G IP   G  P+LE + +  N
Sbjct  281  LKSMDLSNNMLSGEIPATFSELKNITLLNLFRNKLHGAIPEFIGELPSLEVVQLWEN  337


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++ Q   L  L ++ N LSG +P EI+ +  L  LNLS+N    + P  ++ 
Sbjct  506  KFSGRIEPEISQCKLLTFLDLSRNDLSGEIPNEITGMRILNCLNLSSNHLVGSIPSSISS  565

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  566  MQSLTSVDFSYNNLSGLVP  584


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P +     L  L    N L GP+P  + +  +L  + +  N    + P  L  
Sbjct  362  KLTGALPPYLCSGNTLQTLITLENFLFGPIPEALGSCESLTRIRMGENFLNGSIPKGLFG  421

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L+G  P       +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  422  LPKLTQVELQDNYLSGGFPEAGSVAVNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGN  481



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   176 bits (446),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 131/177 (74%), Gaps = 4/177 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGV  291
            TE  ALL +KAA  +D  ++L++WN S    HC+W  V CD     VVSLDLSGLNLSG 
Sbjct  29   TEVEALLELKAA-VSDPSAALSAWNSSDGVDHCSWPGVACDPLRGSVVSLDLSGLNLSGT  87

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LSP VG+L  L+NLS+A+N LSGP+P ++S ++ LR LNLS+N+   +FP  LA L NL 
Sbjct  88   LSPAVGRLRHLLNLSVASNSLSGPIPADLSRLADLRHLNLSDNLLNGSFPSALAHLKNLL  147

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLDLYNNNLTG LP EV ++ +LRHLHLGGN+F+G IPPE+G +  LEYLAVSGN L
Sbjct  148  VLDLYNNNLTGPLPAEVAELPNLRHLHLGGNFFTGVIPPEFGGWEFLEYLAVSGNDL  204


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 65/123 (53%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L  +V +LP L +L +  N  +G +PPE      L +L +S N  G   P +L  
Sbjct  155  NLTGPLPAEVAELPNLRHLHLGGNFFTGVIPPEFGGWEFLEYLAVSGNDLGGPIPPELGN  214

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L  L+ L + Y N+  G +P E+ ++ +L  L +     SG IPPE G   NL+ L +  
Sbjct  215  LTRLRQLYVGYFNSFVGGIPPEIGRLAALVRLDMANCGLSGAIPPELGNLQNLDTLFLQV  274

Query  634  NGL  642
            NGL
Sbjct  275  NGL  277


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 61/117 (52%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G+L  LV L +A   LSG +PPE+  +  L  L L  N      P  L +L +
Sbjct  231  GGIPPEIGRLAALVRLDMANCGLSGAIPPELGNLQNLDTLFLQVNGLAGDIPSALGRLRS  290

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ +D+ NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  291  LKSMDISNNALTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDLPALEVLQLWEN  347


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 60/117 (51%), Gaps = 6/117 (5%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            +SPD+G    L+NLS   N+LSGP+P  I   S ++ L L+ N F    P +  +L  L 
Sbjct  457  ISPDLG----LINLS--NNRLSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQELC  510

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             LDL  N  +G +  E+ +   L  + L  N  SG IPP+      L YL +S N L
Sbjct  511  KLDLSGNRFSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHL  567


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P+ G+L  L  L ++ N+ SGP+ PEIS    L F++LS N      P  +A +
Sbjct  495  FSGRIPPETGRLQELCKLDLSGNRFSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGM  554

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
              L  L+L  N+L G +P  +  + SL  +    N  SG +
Sbjct  555  RILNYLNLSRNHLEGSIPQSLATIQSLTAVDFSYNNLSGLV  595


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 64/146 (44%), Gaps = 26/146 (18%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L +  N L GP+P  +    +L  + +  N   ++ P  L  
Sbjct  372  KLTGNLPPDLCSGNRLQTLIVLRNFLFGPIPETLGRCESLGRIRMGQNYLNASIPDALFS  431

Query  457  L--------------------------ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  558
            L                           +L +++L NN L+G LP  + K + ++ L L 
Sbjct  432  LPKLSQIELEDNLLTGGFPDTGNAAISPDLGLINLSNNRLSGPLPRSIGKYSGVQKLLLN  491

Query  559  GNYFSGRIPPEYGRFPNLEYLAVSGN  636
             N FSGRIPPE GR   L  L +SGN
Sbjct  492  QNQFSGRIPPETGRLQELCKLDLSGN  517


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G+   +  L +  NQ SG +PPE   +  L  L+LS N F      ++++ 
Sbjct  471  LSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQELCKLDLSGNRFSGPIAPEISRC  530

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N ++G++P ++  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  531  KLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHLEGSIPQSLATIQSLTAVDFSYNN  590

Query  640  L  642
            L
Sbjct  591  L  591


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +G+L  L ++ I+ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  277  LAGDIPSALGRLRSLKSMDISNNALTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDL  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + +   L+ L +  N  +G +PP+      L+ L V  N 
Sbjct  337  PALEVLQLWENNFTGGIPQRLGESARLQLLDVSSNKLTGNLPPDLCSGNRLQTLIVLRNF  396

Query  640  L  642
            L
Sbjct  397  L  397


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L++  N+L G +P  +  +  L  L L  N F    P +L + 
Sbjct  301  LTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDLPALEVLQLWENNFTGGIPQRLGES  360

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            A LQ+LD+ +N LTG+LP ++     L+ L +  N+  G IP   GR  +L  + +  N 
Sbjct  361  ARLQLLDVSSNKLTGNLPPDLCSGNRLQTLIVLRNFLFGPIPETLGRCESLGRIRMGQNY  420

Query  640  L  642
            L
Sbjct  421  L  421



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   176 bits (445),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L G LS D+  L FL N ++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ 
Sbjct  26   DLVGTLSSDIAHLRFLSNGTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSN  85

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSGRIPPE+GRFP LEYLAVSGN
Sbjct  86   LTRLAVLDLYNNNLTGDLPVAVTHMTSLRHLHLGGNFFSGRIPPEFGRFPLLEYLAVSGN  145

Query  637  GL  642
             L
Sbjct  146  EL  147


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 69/120 (58%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ P L  L+++ N+L G +PPEI  +++L+ L +   N++    P ++  
Sbjct  123  FSGRIPPEFGRFPLLEYLAVSGNELGGSIPPEIGNLTSLKELYIGYYNVYEGGIPPEIGN  182

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD  N NLTG++P E+ ++ ++  L L  N  SG +  E G   +L+ + +S N
Sbjct  183  LSQLVRLDAANCNLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNN  242


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 69/122 (57%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  195  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  254

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP   G+   L  L +S N
Sbjct  255  LKNLTLLNLFRNKLHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSN  314

Query  637  GL  642
             L
Sbjct  315  KL  316


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  220  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  279

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQVL L+ NN TG +P  + K   L  L L  N  +G +PP+     NL+ L   GN 
Sbjct  280  PELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLGNF  339

Query  640  L  642
            L
Sbjct  340  L  340


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  340  LFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLAGSFPETETIS  399

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            ANL  + L NN L+G LP  +   + ++ L L GN FSGRIPPE GR   L  +  S N
Sbjct  400  ANLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHN  458


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  + N+  GP+ PEIS    L F++LS N      P ++  
Sbjct  435  KFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQCKLLTFVDLSRNELAGEIPKEITG  494

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F    Y +  GN
Sbjct  495  MRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLV-PGTGQFSYFNYTSFLGN  553


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N F      +++Q 
Sbjct  412  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQC  471

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  472  KLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNN  531

Query  640  L  642
            L
Sbjct  532  L  532


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  315  KLTGTLPPDMCFGNNLQTLITLGNFLFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFG  374

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N L G  P       +L  + L  N  SG +PP  G F  ++ L + GN
Sbjct  375  LPKLTQVELQDNLLAGSFPETETISANLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGN  434


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 52/107 (49%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  402  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFL  461

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+ +   L  + L  N  +G IP E      L YL +S N L
Sbjct  462  GPIAPEISQCKLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHL  508


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 72/169 (43%), Gaps = 8/169 (5%)
 Frame = +1

Query  130  AALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  309
            A L S+K+  + D  +++ S  I  S    + +T  +L            L G +   +G
Sbjct  226  AELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRN--------KLHGAIPEFIG  277

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
             LP L  L +  N  +G +P  +     L  L+LS+N    T P  +    NLQ L    
Sbjct  278  DLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLG  337

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            N L G +P  + K  SL  + +G N+ +G IP      P L  + +  N
Sbjct  338  NFLFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDN  386



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 93/177 (53%), Positives = 119/177 (67%), Gaps = 27/177 (15%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC                    
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTC--------------------  62

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
              DV +     NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +++  LANL+
Sbjct  63   --DVSRRH---NLSLADNQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDKISSGLANLR  117

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP YG +P +EYLAVSGN L
Sbjct  118  VLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPPSYGTWPEIEYLAVSGNEL  174


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  223  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  282

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  283  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  342

Query  640  L  642
            L
Sbjct  343  L  343


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  203  LPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  262

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P     + +L  L+L  N   G IP   G  P+LE L +  N
Sbjct  263  SMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWEN  317


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  150  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  209

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L G++P E+ ++  L  L L  N FSG +  E G+  +L+ + +S N
Sbjct  210  LSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  269


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  439  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGGIAPEISRC  498

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  499  KLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNN  558

Query  640  L  642
            L
Sbjct  559  L  559


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  247  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP       LE L   GN 
Sbjct  307  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNF  366

Query  640  L  642
            L
Sbjct  367  L  367


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 56/120 (47%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
               G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P ++  
Sbjct  462  KFEGPIPSEVGKLQQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITG  521

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  522  MKILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  580


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  342  KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGRCESLTRIRMGENFLNGSIPKGLFG  401

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  402  LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  461


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  421  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  474

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  475  QQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNH  534

Query  640  L  642
            L
Sbjct  535  L  535


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P   +  
Sbjct  367  LFGSIPESLGRCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVS  426

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  L L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N
Sbjct  427  VNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHN  485


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +      L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  271  FTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGEN  330

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +     L  L   GN+  G IP   GR  +L  + +  N 
Sbjct  331  GRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGRCESLTRIRMGENF  390

Query  640  L  642
            L
Sbjct  391  L  391



>gb|ADB85326.1| putative receptor protein kinase [Phyllostachys edulis]
Length=265

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 114/161 (71%), Gaps = 1/161 (1%)
 Frame = +1

Query  163  ADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSI  339
            +D   +L SW N + SHC W  VTC +   VV LD++GLNLSG L P + +L  L  LS+
Sbjct  36   SDPTGALASWANGTASHCAWAGVTCSTRGTVVGLDVAGLNLSGALPPALSRLRGLFRLSV  95

Query  340  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  519
            AAN  SGP+P  ++ +  L  LNLSNN F  +FP  LA+L +L+VLDLYNNNLT  LP+E
Sbjct  96   AANAFSGPIPASLARLQFLVHLNLSNNAFDGSFPAPLARLRSLRVLDLYNNNLTSPLPLE  155

Query  520  VYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            V +M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN L
Sbjct  156  VVQMPQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNEL  196


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 59/116 (51%), Gaps = 1/116 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      L++L +S N      P +L  
Sbjct  147  NLTSPLPLEVVQMPQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIPPELGN  206

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  621
            L +L+ L + Y N+ +G LP E+  +T L          SG IPPE G+   L+ L
Sbjct  207  LTSLRELYIGYYNSYSGGLPPELGNLTELVRFDAANCGLSGEIPPELGKLQTLDTL  262



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   171 bits (433),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 133/175 (76%), Gaps = 2/175 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  +LLS K++ T D Q+ LTSWN  T +C+W  + C    HV+SL+L+ L+L+G LS
Sbjct  25   ISEYHSLLSFKSSITNDPQNILTSWNPKTPYCSWYGIKCSQHRHVISLNLTSLSLTGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
              +  LPFL NLS+A N+ SGP+P  +S++S+LRFLNLSNNIF  T P +L+ L NLQVL
Sbjct  85   --LSNLPFLTNLSLADNKFSGPIPSSLSSLSSLRFLNLSNNIFNGTLPQELSNLFNLQVL  142

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            DLYNNN+TG LPV V  ++ LRHLHLGGN+F+G+IPPEYG + +LEYLAVSGN L
Sbjct  143  DLYNNNMTGSLPVSVTHLSFLRHLHLGGNFFTGKIPPEYGSWTHLEYLAVSGNEL  197


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN F    P   A+L
Sbjct  246  LTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAEL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + +M SL  L +  N F+G IP   G+   L  + VS N 
Sbjct  306  KNLTLLNLFRNKLHGAIPEFIGEMPSLEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNK  365

Query  640  L  642
            L
Sbjct  366  L  366


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  +V    A   L+G VPPE+  +  L  L L  N    +   +L  L +
Sbjct  224  GGIPPEIGNLSEMVRFDAAYCGLTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKS  283

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ +DL NN  TG++PV   ++ +L  L+L  N   G IP   G  P+LE L +  N
Sbjct  284  LKSMDLSNNAFTGEVPVSFAELKNLTLLNLFRNKLHGAIPEFIGEMPSLEVLQIWEN  340


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++ ++
Sbjct  486  FSGKIPAEIGKLHQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPKEITKM  545

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G +P  +  M SL  +    N  +G +P   G+F    Y +  GN
Sbjct  546  KILNYLNLSRNHLVGTIPGSIASMQSLTSVDFSYNNLTGLVPGT-GQFSYFNYTSFLGN  603


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP  ++  
Sbjct  390  LFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPELTQVELQDNLLSGNFPQPVSMS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +   TS++ L L GN FSG+IP E G+   L  +  S N
Sbjct  450  INLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHN  508


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 55/107 (51%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  ++++ N+LSGP+PP I   ++++ L L  N F    P ++ +L  L  +D  +N  +
Sbjct  452  LGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNKFS  511

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +  E+     L  + L  N  SG IP E  +   L YL +S N L
Sbjct  512  GPIAPEISHCKLLTFVDLSRNELSGEIPKEITKMKILNYLNLSRNHL  558


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  +G VP   + +  L  LNL  N      P  + ++
Sbjct  270  LSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAELKNLTLLNLFRNKLHGAIPEFIGEM  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL ++ NN TG +P  + K   L  + +  N  +G +PP       L+ L   GN 
Sbjct  330  PSLEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPPFMCFGNKLQTLIALGNF  389

Query  640  L  642
            L
Sbjct  390  L  390


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG  P  +S    L  + LSNN      P  +   
Sbjct  414  LNGSIPKGLFGLPELTQVELQDNLLSGNFPQPVSMSINLGQVTLSNNKLSGPLPPSIGNF  473

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             ++Q L L  N  +G +P E+ K+  L  +    N FSG I PE      L ++ +S N 
Sbjct  474  TSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNE  533

Query  640  L  642
            L
Sbjct  534  L  534


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P +     L  L    N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  366  LTGSLPPFMCFGNKLQTLIALGNFLFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGL  425

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  ++L +N L+G+ P  V    +L  + L  N  SG +PP  G F +++ L + GN
Sbjct  426  PELTQVELQDNLLSGNFPQPVSMSINLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGN  484



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   170 bits (431),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 124/171 (73%), Gaps = 5/171 (3%)
 Frame = +1

Query  142  SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl--lhvvsldlsglNLSGVLSPDVG  309
            S+K+A + D  ++L  WN S    HC+W  V CD+     V+SLDL+GLNLSG L P V 
Sbjct  42   SLKSALS-DPGAALAGWNASAYPDHCSWPGVACDNAPLRRVISLDLTGLNLSGSLPPAVA  100

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
             L  L+NLS AAN LSGP+PPE+S +  LR LNLSNN+F  +FP  L +L +L+VLDLYN
Sbjct  101  HLRHLLNLSAAANLLSGPIPPELSLLFDLRHLNLSNNVFNGSFPSALRRLKHLEVLDLYN  160

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            NNLTG LP E   + +LRHLHLGGN+FSG IPPEYGR+ +LEYLAVSGN L
Sbjct  161  NNLTGVLPAEAADLPNLRHLHLGGNFFSGVIPPEYGRWEHLEYLAVSGNEL  211


 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN F    P   A L
Sbjct  260  LSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADL  319

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  320  RNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  379

Query  640  L  642
            L
Sbjct  380  L  380


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 63/123 (51%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+GVL  +   LP L +L +  N  SG +PPE      L +L +S N  G   P ++  
Sbjct  162  NLTGVLPAEAADLPNLRHLHLGGNFFSGVIPPEYGRWEHLEYLAVSGNELGGAIPPEIGN  221

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L  L+ L + Y N+  G +P E  K+++L          SG IPPE GR  NL+ L +  
Sbjct  222  LTRLRQLYIGYFNSYDGGIPPEFGKLSALVRFDAANCGLSGEIPPELGRLENLDTLFLQV  281

Query  634  NGL  642
            NGL
Sbjct  282  NGL  284


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 64/121 (53%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P++G+L  L ++ ++ N  +G +PP  + +  L  LNL  N    T P  +  L
Sbjct  284  LSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  343

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L++NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  344  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPPELCSGNKLQTLIALGNA  403

Query  640  L  642
            L
Sbjct  404  L  404


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L I   N   G +PPE   +S L   + +N       P +L +
Sbjct  211  LGGAIPPEIGNLTRLRQLYIGYFNSYDGGIPPEFGKLSALVRFDAANCGLSGEIPPELGR  270

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  L L  N L+G+LP E+ ++ SL+ + L  N F+G IPP +    NL  L +  N
Sbjct  271  LENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRN  330

Query  637  GL  642
             L
Sbjct  331  KL  332


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  NQ SG +P EI  +  L  ++ S+N F    P ++++ 
Sbjct  478  LSGPLPPCIGNFSGVQKLLLNQNQFSGRIPTEIGRLQQLSKVDFSSNSFSGGIPPEMSKC  537

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  NNL+G++P E+  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  538  KLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEGSIPPSIATMQSLTAVDFSYNN  597

Query  640  L  642
            L
Sbjct  598  L  598


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 62/118 (53%), Gaps = 3/118 (3%)
 Frame = +1

Query  298  PDVGQL---PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            PD G     P L  +S++ N+LSGP+PP I   S ++ L L+ N F    P ++ +L  L
Sbjct  457  PDTGNASISPSLGQISLSNNRLSGPLPPCIGNFSGVQKLLLNQNQFSGRIPTEIGRLQQL  516

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              +D  +N+ +G +P E+ K   L  + LG N  SG IP E      L YL +S N L
Sbjct  517  SKVDFSSNSFSGGIPPEMSKCKLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHL  574


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 58/117 (50%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G+L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L +
Sbjct  238  GGIPPEFGKLSALVRFDAANCGLSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLRS  297

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ +DL NN  TG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  298  LKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDN  354


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG + P++ +   L  + +  N LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  525  SFSGGIPPEMSKCKLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEGSIPPSIAT  584

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  585  MQSLTAVDFSYNNLSGLVP  603



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   169 bits (427),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 130/177 (73%), Gaps = 5/177 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsl--lhvvsldlsglNLSGV  291
            E+ ALLS+K+A + D  ++L  WN S +  HC+W  V CD      V++LDLSGLNLSG 
Sbjct  33   ERVALLSLKSALS-DPGAALAGWNASANPDHCSWPGVACDDAPLRRVIALDLSGLNLSGS  91

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P V  L  L+NLS AAN LSGP+P ++S +S LR+LNLSNN+F  +FP  L +L NL+
Sbjct  92   LPPAVAHLRHLLNLSTAANLLSGPIPLDLSLLSDLRYLNLSNNVFNGSFPSALRRLKNLE  151

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLDLYNNNLTG LP EV  + +LRHLHLGGN+FSG IP EYGR+ +LEYLAVSGN L
Sbjct  152  VLDLYNNNLTGILPAEVADLHNLRHLHLGGNFFSGVIPREYGRWEHLEYLAVSGNEL  208


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  NQ SG +PPEI  +  L  ++ S+N F S  P ++++ 
Sbjct  475  LSGPLPPSIGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSSNRFSSGIPPEISKC  534

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  NNL+GD+P E+  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  535  KLLTFVDLSRNNLSGDIPAEIAGMRILNYLNLSRNHLEGSIPPSISTMQSLTAVDFSYNN  594

Query  640  L  642
            L
Sbjct  595  L  595


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  257  LSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADL  316

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP   GR   L+ L +S N 
Sbjct  317  RNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNK  376

Query  640  L  642
            L
Sbjct  377  L  377


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 64/121 (53%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  281  LSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  340

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L++NN TG +P  + +   L+ L L  N  +G +PPE      L+ L    N 
Sbjct  341  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPPELCSGNKLQTLIALANA  400

Query  640  L  642
            L
Sbjct  401  L  401


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SGV+  + G+   L  L+++ N+LSG +PPEI  ++ LR L +   N +    P ++  
Sbjct  184  FSGVIPREYGRWEHLEYLAVSGNELSGAIPPEIGNLTRLRQLYVGYFNSYDGGIPPEIGH  243

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L+G +P E+  +  L  L L  N  SG +PPE GR  +L+ + +S N
Sbjct  244  LSALVRFDAANCGLSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNN  303

Query  637  GL  642
             L
Sbjct  304  AL  305


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG + P++G L  L  L +   N   G +PPEI  +S L   + +N       P +L  
Sbjct  208  LSGAIPPEIGNLTRLRQLYVGYFNSYDGGIPPEIGHLSALVRFDAANCGLSGQIPPELGH  267

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  L L  N L+G+LP E+ ++ SL+ + L  N  +G IPP +    NL  L +  N
Sbjct  268  LEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRN  327

Query  637  GL  642
             L
Sbjct  328  KL  329


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 59/117 (50%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L +
Sbjct  235  GGIPPEIGHLSALVRFDAANCGLSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRS  294

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  295  LKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDN  351


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  ++N+ S  +PPEIS    L F++LS N      P ++A +
Sbjct  499  FSGRIPPEIGRLQQLSKVDFSSNRFSSGIPPEISKCKLLTFVDLSRNNLSGDIPAEIAGM  558

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  559  RILNYLNLSRNHLEGSIPPSISTMQSLTAVDFSYNNLSGLVP  600


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 2/121 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH--QLA  453
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+    FP    ++
Sbjct  401  LFGPIPQSLGECLSLSRVRLGENYLNGSIPRGLFSLPNLAQVELQDNLLAGEFPDTGDVS  460

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
                L  + L NN L+G LP  +   + ++ L L  N FSGRIPPE GR   L  +  S 
Sbjct  461  ISLGLGQISLSNNRLSGPLPPSIGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSS  520

Query  634  N  636
            N
Sbjct  521  N  521



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 118/160 (74%), Gaps = 1/160 (1%)
 Frame = +1

Query  166  DSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  342
            D   +L +WN +  HC+W  V CD   + V+SLDL+GLNLSG LSP VG+L  LVNLS A
Sbjct  46   DPSGALYAWNSADGHCSWPGVACDPIRVFVLSLDLTGLNLSGTLSPAVGRLHHLVNLSTA  105

Query  343  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  522
            +N LSGP+P E+S +S LR LNLSNN+F  +FP   ++L NL VLDLYNNNL G LP EV
Sbjct  106  SNSLSGPLPAELSHLSNLRHLNLSNNLFNGSFPSAFSRLKNLLVLDLYNNNLAGTLPPEV  165

Query  523  YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             ++ +L HLHLGGN+FSG IPPE+G +  LEYLAVSGN L
Sbjct  166  SELPNLLHLHLGGNFFSGVIPPEFGHWEFLEYLAVSGNEL  205


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 72/122 (59%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SGV+ P+ G   FL  L+++ N+L GP+PPE+  ++ LR L +   N F    P ++  
Sbjct  181  FSGVIPPEFGHWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIGG  240

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD+ N  LTGD+P E+ K+ +L  L L  N  SGR+PPE G   +L+ + +S N
Sbjct  241  LSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNN  300

Query  637  GL  642
             L
Sbjct  301  AL  302


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  254  LTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADL  313

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   G+   L+ L +S N 
Sbjct  314  QNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQSGRLQILDISSNK  373

Query  640  L  642
            L
Sbjct  374  L  374


 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G L  LV L +A   L+G +PPE+  +  L  L L  N      P +L  
Sbjct  229  SFEGGIPPEIGGLSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGG  288

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  289  LRSLKSMDLSNNALTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWEN  348


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + NQ SGP+ PEIS    L F++LS N        ++A +
Sbjct  496  FSGGIPPEIGRLQQLSKVDFSGNQFSGPIAPEISRCKLLTFVDLSRNKLSGEILPEIAGM  555

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G +P  +  M SL  +    N FSG +P
Sbjct  556  RILNYLNLSRNQLEGSIPPSISTMQSLTAVDFSYNNFSGLVP  597


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P++G L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  278  LSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDL  337

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + +   L+ L +  N  +G +PP       L+ L   GN 
Sbjct  338  PALEVLQLWENNFTGGIPRRLGQSGRLQILDISSNKLTGTLPPNLCFGNRLQTLIALGNF  397

Query  640  L  642
            L
Sbjct  398  L  398


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 60/120 (50%), Gaps = 6/120 (5%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +  +SPD+GQ    +NLS   N+L GP+PP I   S L+ L L+ N F    P ++ +L 
Sbjct  455  AAAISPDLGQ----INLS--NNRLLGPLPPSIGNFSGLQKLLLNQNQFSGGIPPEIGRLQ  508

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L  +D   N  +G +  E+ +   L  + L  N  SG I PE      L YL +S N L
Sbjct  509  QLSKVDFSGNQFSGPIAPEISRCKLLTFVDLSRNKLSGEILPEIAGMRILNYLNLSRNQL  568


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 51/107 (48%), Gaps = 0/107 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L++  N+L G +P  +  +  L  L L  N F    P +L Q 
Sbjct  302  LTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQS  361

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGR  600
              LQ+LD+ +N LTG LP  +     L+ L   GN+  G IP   G+
Sbjct  362  GRLQILDISSNKLTGTLPPNLCFGNRLQTLIALGNFLFGSIPETLGQ  408



>ref|XP_010675918.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=940

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            ++E+ ALLSIK+A T D Q+ L+SWN +T HC+W  +TC SL   V       L L+G+L
Sbjct  51   LSEEKALLSIKSAITDDPQNYLSSWNTTTHHCSWPFITCSSLSSSVISLDISGLELTGIL  110

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+G L  L NL+IA N  S P+PP +S ++ LR+LNLS N F +TFP   + L  L +
Sbjct  111  SPDIGSLTHLQNLNIAENSFSDPIPPSLSLLTQLRYLNLSYNDF-TTFPSTFSSLKKLTI  169

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  630
            LD+ +NN TG LP+ V +M+ LR+L LGGN+F G +PPEYG++ NLEYL+ S
Sbjct  170  LDILSNNFTGLLPLSVVEMSELRYLDLGGNHFYGEVPPEYGQWENLEYLSFS  221


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 58/119 (49%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G L  L  L  +    SG +P E+  +  L  L+   N      P +L  +
Sbjct  236  FSGGIPPELGNLTKLTTLYGSTCNFSGKIPTELGKLKKLEVLSFYENKLSGGLPFELGSM  295

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L+ +D +NN L+G +P     + ++ H  LG N   G IP   G FP LE L +S N
Sbjct  296  KSLKHMDFFNNTLSGVIPESYSLLQNITHFDLGNNKLHGSIPDFIGDFPELEELDLSSN  354


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 63/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG +  ++G+L  L  LS   N+LSG +P E+ ++ +L+ ++  NN      P   + 
Sbjct  259  NFSGKIPTELGKLKKLEVLSFYENKLSGGLPFELGSMKSLKHMDFFNNTLSGVIPESYSL  318

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+   DL NN L G +P  +     L  L L  N F+G IPP+ G    L+++ +  N
Sbjct  319  LQNITHFDLGNNKLHGSIPDFIGDFPELEELDLSSNNFTGSIPPKLGTNGRLQFVRMDRN  378

Query  637  GL  642
             L
Sbjct  379  NL  380


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 60/130 (46%), Gaps = 11/130 (8%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIA-----------ANQLSGPVPPEISAISTLRFLNLSNNIFGS  432
            G + P+ GQ   L  LS +            N  SG +PPE+  ++ L  L  S   F  
Sbjct  203  GEVPPEYGQWENLEYLSFSWPNYYLDYVDYNNIFSGGIPPELGNLTKLTTLYGSTCNFSG  262

Query  433  TFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNL  612
              P +L +L  L+VL  Y N L+G LP E+  M SL+H+    N  SG IP  Y    N+
Sbjct  263  KIPTELGKLKKLEVLSFYENKLSGGLPFELGSMKSLKHMDFFNNTLSGVIPESYSLLQNI  322

Query  613  EYLAVSGNGL  642
             +  +  N L
Sbjct  323  THFDLGNNKL  332


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G  P L  L +++N  +G +PP++     L+F+ +  N      P  L + 
Sbjct  332  LHGSIPDFIGDFPELEELDLSSNNFTGSIPPKLGTNGRLQFVRMDRNNLTGILPVSLCKG  391

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ L ++NN L G +P  +    SL+ + +G N+ +G IP      PN+  + ++ N 
Sbjct  392  DRLQDLTIFNNRLVGPIPESLGSCKSLQIVEMGYNFLNGLIPKGLFGLPNISLIQLNDNH  451

Query  640  L  642
            L
Sbjct  452  L  452


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (45%), Gaps = 27/147 (18%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G+L   + +   L +L+I  N+L GP+P  + +  +L+ + +  N      P  L  
Sbjct  379  NLTGILPVSLCKGDRLQDLTIFNNRLVGPIPESLGSCKSLQIVEMGYNFLNGLIPKGLFG  438

Query  457  LANLQV---------------------------LDLYNNNLTGDLPVEVYKMTSLRHLHL  555
            L N+ +                           LDL NN LTG+LP  +   + LR+L L
Sbjct  439  LPNISLIQLNDNHLTGRGFDENTTHPFSVSLIWLDLSNNQLTGELPASIGNFSILRYLLL  498

Query  556  GGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             GN F+G IP E  +   L  L +S N
Sbjct  499  DGNKFTGSIPSEISKCQALIQLDLSSN  525


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSGV+      L  + +  +  N+L G +P  I     L  L+LS+N F  + P +L   
Sbjct  308  LSGVIPESYSLLQNITHFDLGNNKLHGSIPDFIGDFPELEELDLSSNNFTGSIPPKLGTN  367

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ + +  NNLTG LPV + K   L+ L +  N   G IP   G   +L+ + +  N 
Sbjct  368  GRLQFVRMDRNNLTGILPVSLCKGDRLQDLTIFNNRLVGPIPESLGSCKSLQIVEMGYNF  427

Query  640  L  642
            L
Sbjct  428  L  428


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 49/94 (52%), Gaps = 6/94 (6%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L+ L ++ NQL+G +P  I   S LR+L L  N F  + P ++++   L  LDL +N  +
Sbjct  469  LIWLDLSNNQLTGELPASIGNFSILRYLLLDGNKFTGSIPSEISKCQALIQLDLSSNQFS  528

Query  502  GDLPVE------VYKMTSLRHLHLGGNYFSGRIP  585
             ++P E      +  +  +R L L  N  +G IP
Sbjct  529  DEIPNEITGNKSICNLDEIRFLDLSNNTLTGEIP  562


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/152 (28%), Positives = 64/152 (42%), Gaps = 31/152 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISA------ISTLRFLNLSNNIFGSTFP  441
             +G +  ++ +   L+ L +++NQ S  +P EI+       +  +RFL+LSNN      P
Sbjct  503  FTGSIPSEISKCQALIQLDLSSNQFSDEIPNEITGNKSICNLDEIRFLDLSNNTLTGEIP  562

Query  442  HQL----------------------AQLAN---LQVLDLYNNNLTGDLPVEVYKMTSLRH  546
            H L                      A  +N   L  LDL +N L G +P  + K  SL  
Sbjct  563  HCLGNTSASLVVLKLQLNKLNGTIPANFSNCDSLTFLDLGDNQLEGVVPKSLSKCRSLNV  622

Query  547  LHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L+L  N   G  P      P L+ L++  NG 
Sbjct  623  LNLENNKLMGIFPSWLESLPQLQVLSLRFNGF  654


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 47/109 (43%), Gaps = 4/109 (4%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  +      L  L +  NQL G VP  +S   +L  LNL NN     FP  L  L
Sbjct  582  LNGTIPANFSNCDSLTFLDLGDNQLEGVVPKSLSKCRSLNVLNLENNKLMGIFPSWLESL  641

Query  460  ANLQVLDLYNNNLTGDL----PVEVYKMTSLRHLHLGGNYFSGRIPPEY  594
              LQVL L  N   G +    P        L+ L +  N F G++P  Y
Sbjct  642  PQLQVLSLRFNGFYGHITSSSPKVKRSFPRLQILDISNNNFGGKLPGRY  690



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 117/189 (62%), Gaps = 27/189 (14%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  255
            R SA A AG+   V E  ALL +KAA +     S   W+ +  HC +W  V CD+     
Sbjct  15   RPSAAADAGEVTAV-EHRALLDVKAA-SGSPSGSFAGWDATADHCRSWAGVACDAAGR--  70

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
                                  +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71   ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  615
            FP  L+ L NL+VLD+YNNNLTG LPV+V  + +LRHLHLGGN+FSG IPPEYGR+ ++E
Sbjct  109  FPSALSSLKNLRVLDIYNNNLTGVLPVDVADLPALRHLHLGGNFFSGAIPPEYGRWEHIE  168

Query  616  YLAVSGNGL  642
            YLA+SGN L
Sbjct  169  YLAISGNEL  177


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P + ++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLGQNQFSGCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKC  500

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  NNL+G++PVE+ +M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  501  KLLTFIDLSRNNLSGEIPVEITEMRILNYLNLSRNHLEGEIPTSISTMQSLTAVDFSYNN  560

Query  640  L  642
            L
Sbjct  561  L  561


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 63/123 (51%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+GVL  DV  LP L +L +  N  SG +PPE      + +L +S N  G     +L  
Sbjct  128  NLTGVLPVDVADLPALRHLHLGGNFFSGAIPPEYGRWEHIEYLAISGNELGGPITPELGN  187

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N+  G LP  +  +TSL  L       SG IPPE G   NL+ L +  
Sbjct  188  LTSLRELYIGYFNSYQGSLPAAIGNLTSLVRLDAANCGLSGEIPPEMGNLQNLDTLFLQV  247

Query  634  NGL  642
            NGL
Sbjct  248  NGL  250


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L G + PE+  + +L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGNLQNLDTLFLQVNGLFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADL  285

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  286  KNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  345

Query  640  L  642
            L
Sbjct  346  L  346


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP+      L+ L   GN 
Sbjct  310  PQLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCSGDKLQTLIALGNF  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ S P+P E S    L F++LS N      P ++ ++
Sbjct  465  FSGCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKCKLLTFIDLSRNNLSGEIPVEITEM  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  525  RILNYLNLSRNHLEGEIPTSISTMQSLTAVDFSYNNLSGLV-PGTGQFSYFNQTSFVGN  582


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP + A  
Sbjct  370  LFGSIPESLGRCKSLSRIRLGENYLTGSIPIGLFSLRNLVQVELQDNLLNGSFPEK-ASS  428

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  + L NN L+G LP  +     L+ L LG N FSG IPPE G+   L  +  SGN
Sbjct  429  PTLGQISLSNNRLSGALPSSIGNFPGLQKLLLGQNQFSGCIPPEIGKLQQLSKMDFSGN  487


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 60/118 (51%), Gaps = 2/118 (2%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQLA  462
            G L   +G L  LV L  A   LSG +PPE+  +  L  L L  N +FG   P +L +L 
Sbjct  204  GSLPAAIGNLTSLVRLDAANCGLSGEIPPEMGNLQNLDTLFLQVNGLFGEITP-ELGKLR  262

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L+ +DL NN L G++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  263  SLKSMDLSNNALAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWEN  320


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F    P +L   
Sbjct  274  LAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWENNFTGEIPRRLGTN  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP ++     L+ L   GN+  G IP   GR  +L  + +  N 
Sbjct  334  GRLQLLDLSSNKLTGSLPPDLCSGDKLQTLIALGNFLFGSIPESLGRCKSLSRIRLGENY  393

Query  640  L  642
            L
Sbjct  394  L  394


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  453
            N +G +   +G    L  L +++N+L+G +PP++ +   L+  + L N +FGS  P  L 
Sbjct  321  NFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCSGDKLQTLIALGNFLFGS-IPESLG  379

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            +  +L  + L  N LTG +P+ ++ + +L  + L  N  +G   PE    P L  +++S 
Sbjct  380  RCKSLSRIRLGENYLTGSIPIGLFSLRNLVQVELQDNLLNGSF-PEKASSPTLGQISLSN  438

Query  634  NGL  642
            N L
Sbjct  439  NRL  441



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score =   162 bits (409),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 106/161 (66%), Gaps = 2/161 (1%)
 Frame = +1

Query  166  DSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSI  339
            D   SL SW N ST  C W  V+CD     V        NLSG +     +LP+L  L++
Sbjct  37   DPTGSLASWSNASTGPCAWSGVSCDGRSGAVVGVDLSGRNLSGAVPRAFSRLPYLARLNL  96

Query  340  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  519
            AAN LSGP+PP +S +  L +LNLS+N+   +FP  LA+L  L+VLDLYNNN TG LP+E
Sbjct  97   AANSLSGPIPPSLSRLGLLTYLNLSSNLLNGSFPPPLARLRALRVLDLYNNNFTGSLPLE  156

Query  520  VYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            V  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN L
Sbjct  157  VVGMAQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNEL  197


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIS-TLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   + +LP L  + +  N LSG  P  +SA    L  ++LSNN    + P  +  
Sbjct  414  LNGSIPEGLFELPNLTQVELQDNLLSGSFPAVVSAGGPNLGGISLSNNQLTGSLPASIGS  473

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + LQ L L  N  TG +P E+ ++  L    L GN F G +P E G+   L YL VS N
Sbjct  474  FSGLQKLLLDQNAFTGAIPPEIGRLQQLSKADLSGNSFDGGVPSEIGKCRLLTYLDVSQN  533

Query  637  GL  642
             L
Sbjct  534  KL  535


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +PP +  + +L  L+LSNN      P     L
Sbjct  246  LSGEIPPELGNLAKLDTLFLQVNGLTGGIPPVLGRLGSLSSLDLSNNALSGEIPATFVAL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL + +L+ N L GD+P  V  +  L  L L  N F+G IP   GR    + L +S N 
Sbjct  306  KNLTLFNLFRNRLRGDIPQFVGDLPGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  365

Query  640  L  642
            L
Sbjct  366  L  366


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P +G+L  L +L ++ N LSG +P    A+  L   NL  N      P  +  L
Sbjct  270  LTGGIPPVLGRLGSLSSLDLSNNALSGEIPATFVALKNLTLFNLFRNRLRGDIPQFVGDL  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + +    + L L  N  +G +PPE      LE L   GN 
Sbjct  330  PGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPELCAGGKLETLIALGNS  389

Query  640  L  642
            L
Sbjct  390  L  390


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G +  ++G+   L  L ++ N+LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  510  SFDGGVPSEIGKCRLLTYLDVSQNKLSGDIPPAISGMRILNYLNLSRNQLDGEIPVTIAA  569

Query  457  LANLQVLDLYNNNLTGDLPV  516
            + +L  +D   NNL+G +PV
Sbjct  570  MQSLTAVDFSYNNLSGLVPV  589



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = +1

Query  160  TADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  330
             +D   +L++WN S S  HC+W  V CD     VVSLDL+G NLSG LS  V +L  L+N
Sbjct  43   VSDPSDALSAWNNSASGGHCSWPGVACDPLRGFVVSLDLTGFNLSGTLSLAVVRLRHLLN  102

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            LS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  + +L NL VLD+YNNNLTG L
Sbjct  103  LSAASNSLSGPIPAELSRLSNLRHLNLSNNLFNGSFPSAIVRLKNLLVLDIYNNNLTGPL  162

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            P EV ++ +LRHLHLGGN+FSG IPP +GR+  LEYLAVSGN L
Sbjct  163  PAEVSELPNLRHLHLGGNFFSGVIPPVFGRWEFLEYLAVSGNEL  206


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 70/122 (57%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SGV+ P  G+  FL  L+++ N+L GP+PPE+  ++ LR L L   N F    P ++  
Sbjct  182  FSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYLGYFNNFEGGIPPEIGG  241

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  LD+ N  LTG++P E+  + +L  L L  N  SGR+P E GR  +L+ + +S N
Sbjct  242  LPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNN  301

Query  637  GL  642
             L
Sbjct  302  AL  303


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  230  NFEGGIPPEIGGLPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGR  289

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  290  LRSLKSMDLSNNALTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWEN  349


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 62/123 (50%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L  +V +LP L +L +  N  SG +PP       L +L +S N  G   P +L  
Sbjct  157  NLTGPLPAEVSELPNLRHLHLGGNFFSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGN  216

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L  L+ L L Y NN  G +P E+  +  L  L +     +G IPPE G   NL+ L +  
Sbjct  217  LTRLRQLYLGYFNNFEGGIPPEIGGLPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQV  276

Query  634  NGL  642
            NGL
Sbjct  277  NGL  279


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L  L +  N LSG +P E+  + +L+ ++LSNN      P   A L
Sbjct  255  LTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADL  314

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   G+   L+ + +S N 
Sbjct  315  QNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQSGRLQIVDLSSNK  374

Query  640  L  642
            L
Sbjct  375  L  375


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (53%), Gaps = 6/120 (5%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +  +SPD+GQ+      S++ N+LSGP+PP I  ++ L+ L L+ N F    P ++ +L 
Sbjct  456  AAAISPDLGQI------SLSNNRLSGPLPPSIGNLTGLQKLLLNQNQFSGRIPPEMGRLQ  509

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L  LD   N  +G +  E+ +   L  + L  N  SG +PPE      L YL +S N L
Sbjct  510  QLSKLDFSGNRFSGPIAPEISRCKLLTFVDLSRNELSGELPPEIAGMRILNYLNLSRNQL  569


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G L  L  L +  NQ SG +PPE+  +  L  L+ S N F      ++++ 
Sbjct  473  LSGPLPPSIGNLTGLQKLLLNQNQFSGRIPPEMGRLQQLSKLDFSGNRFSGPIAPEISRC  532

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G+LP E+  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  533  KLLTFVDLSRNELSGELPPEIAGMRILNYLNLSRNQLEGSIPASIATMQSLTAVDFSYNN  592

Query  640  L  642
            L
Sbjct  593  L  593


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  L  + N+ SGP+ PEIS    L F++LS N      P ++A +
Sbjct  497  FSGRIPPEMGRLQQLSKLDFSGNRFSGPIAPEISRCKLLTFVDLSRNELSGELPPEIAGM  556

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G +P  +  M SL  +    N  SG +P
Sbjct  557  RILNYLNLSRNQLEGSIPASIATMQSLTAVDFSYNNLSGLVP  598


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 60/146 (41%), Gaps = 26/146 (18%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + PH L  
Sbjct  374  KLTGTLPPDLCFGNKLQTLIALGNFLFGPIPETLGRCESLGRIRMGENYLNGSIPHGLFS  433

Query  457  LANLQVLDLY--------------------------NNNLTGDLPVEVYKMTSLRHLHLG  558
            L  L  L+L                           NN L+G LP  +  +T L+ L L 
Sbjct  434  LPKLSQLELQDNLLTGGFPDTGAAAISPDLGQISLSNNRLSGPLPPSIGNLTGLQKLLLN  493

Query  559  GNYFSGRIPPEYGRFPNLEYLAVSGN  636
             N FSGRIPPE GR   L  L  SGN
Sbjct  494  QNQFSGRIPPEMGRLQQLSKLDFSGN  519


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  ++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  279  LSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDL  338

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P  + +   L+ + L  N  +G +PP+      L+ L   GN 
Sbjct  339  PALEVLQLWENNFTGGIPRRLGQSGRLQIVDLSSNKLTGTLPPDLCFGNKLQTLIALGNF  398

Query  640  L  642
            L
Sbjct  399  L  399


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L++  N+L G +P  +  +  L  L L  N F    P +L Q 
Sbjct  303  LTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQS  362

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ++DL +N LTG LP ++     L+ L   GN+  G IP   GR  +L  + +  N 
Sbjct  363  GRLQIVDLSSNKLTGTLPPDLCFGNKLQTLIALGNFLFGPIPETLGRCESLGRIRMGENY  422

Query  640  L  642
            L
Sbjct  423  L  423



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 123/164 (75%), Gaps = 3/164 (2%)
 Frame = +1

Query  160  TADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  330
             +D  +SL++WN S    HC+W  V CD     VVSLDL+G NLSG L P VG+L  L+N
Sbjct  41   VSDPSASLSAWNSSAGVGHCSWPGVGCDPIQGSVVSLDLTGFNLSGSLFPAVGRLRHLLN  100

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            LS A+N LSGP+P EIS +++LR LNLSNN+   +FP  LA+L NL VLDLYNNNLTG L
Sbjct  101  LSAASNSLSGPIPAEISRLASLRHLNLSNNLLNGSFPSALARLKNLLVLDLYNNNLTGPL  160

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            PVEV ++ +LRHLHLGGN+F+G IPPE+GR+  LEYLAVSGN L
Sbjct  161  PVEVAQLPNLRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNEL  204


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 72/122 (59%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++ LR L +   N F    P ++  
Sbjct  180  FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIGS  239

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  LD+ N  L G++P E++K+ +L  L L  N  +G IPPE GR  +L+ + +S N
Sbjct  240  LPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNN  299

Query  637  GL  642
             L
Sbjct  300  AL  301


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++ +L  L  L +  N L+G +PPE+  + +L+ ++LSNN      P   A L
Sbjct  253  LNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADL  312

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  + ++ +L  L L  N F+G IP + GR   L+ L +S N 
Sbjct  313  ENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGRSGRLQLLDLSSNK  372

Query  640  L  642
            L
Sbjct  373  L  373


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  228  SFEGGIPPEIGSLPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGR  287

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  288  LRSLKSMDLSNNALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWEN  347


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 62/120 (52%), Gaps = 6/120 (5%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +  +SPD+G+    +NLS   N+LSG +PP I   S ++ L L+ N F    P ++ +L 
Sbjct  454  AAAISPDLGE----INLS--NNRLSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQ  507

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L  +D   N  +G +  E+ +   L  + L  N  SG IPPE  R   L YL +S N L
Sbjct  508  ELSKVDFSGNRFSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQL  567


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             S  + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++A++
Sbjct  495  FSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARM  554

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G +P  +  M SL  +    N  SG +P
Sbjct  555  RILNYLNLSRNQLEGGIPPSIATMQSLTAVDFSYNKLSGHVP  596


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P +G    +  L +  NQ S  +PPEI  +  L  ++ S N F      ++++ 
Sbjct  471  LSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRC  530

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+ +M  L +L+L  N   G IPP      +L  +  S N 
Sbjct  531  KLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQLEGGIPPSIATMQSLTAVDFSYNK  590

Query  640  L  642
            L
Sbjct  591  L  591


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  277  LAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGEL  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG +P ++ +   L+ L L  N  +G +P        LE +   GN 
Sbjct  337  PALEVLQLWENNFTGGIPRQLGRSGRLQLLDLSSNKLTGTLPTGLCSENTLETVIALGNF  396

Query  640  L  642
            L
Sbjct  397  L  397


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L++  N+L G +P  I  +  L  L L  N F    P QL + 
Sbjct  301  LTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGRS  360

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP  +    +L  +   GN+  G IP   GR  +L  + +  N 
Sbjct  361  GRLQLLDLSSNKLTGTLPTGLCSENTLETVIALGNFLFGPIPETLGRCKSLSRIRMGENY  420

Query  640  L  642
            L
Sbjct  421  L  421



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score =   156 bits (395),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 114/164 (70%), Gaps = 4/164 (2%)
 Frame = +1

Query  163  ADSQSSLTSW----NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVN  330
            +D   +L SW    N STSHC+W  VTC S   VV LD+SG NLSG L  ++ +L  L+ 
Sbjct  32   SDPTGALASWGNGTNTSTSHCSWAGVTCSSRGTVVGLDVSGFNLSGALPAELSRLRGLLR  91

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L++ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  L
Sbjct  92   LAVGANAFSGPIPGSLGRLQFLTYLNLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPL  151

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            P+EV +M  LRHLHLGGN+FSG IPPEYGR+  ++YLAVSGN L
Sbjct  152  PMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNEL  195


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 65/123 (53%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  146  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGRIPPELGN  205

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N+ +G LP E+  +T L  L       SG IPPE G+  NL+ L +  
Sbjct  206  LTSLRELYIGYYNSYSGGLPPELGNLTELIRLDAANCGLSGEIPPELGKLQNLDTLFLQV  265

Query  634  NGL  642
            NGL
Sbjct  266  NGL  268


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  244  LSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  303

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  304  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  363

Query  640  L  642
            L
Sbjct  364  L  364


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N F    P ++ + 
Sbjct  461  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGKC  520

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  521  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  580

Query  640  L  642
            L
Sbjct  581  L  581


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 63/121 (52%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SGV +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ QL
Sbjct  443  VSGVAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGQL  496

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L   DL +N   G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  497  QQLSKADLSSNAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  556

Query  640  L  642
            L
Sbjct  557  L  557


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+ P++GQL  L    +++N   G VPPEI     L +L+LS N      P  ++ 
Sbjct  484  SFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  543

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  544  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  586


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  221  SGGLPPELGNLTELIRLDAANCGLSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLK  280

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +
Sbjct  281  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQL  335


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  292  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  351

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP   G   +L  + +  N 
Sbjct  352  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGECRSLSRVRLGENY  411

Query  640  L  642
            L
Sbjct  412  L  412



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 112/160 (70%), Gaps = 5/160 (3%)
 Frame = +1

Query  178  SLTSWNISTS-HCTWRRVTCd---sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA  345
            +L SW +++S HC W  VTC    S   VV LD+SGLNLSG L P + +L  L  LS+AA
Sbjct  46   ALASWGVASSDHCAWAGVTCAPRGSGGVVVGLDVSGLNLSGALPPALSRLRGLQRLSVAA  105

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLPVEV  522
            N   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP+EV
Sbjct  106  NGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSATLPLEV  165

Query  523  YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              M  LRHLHLGGN+FSG IPPEYGR+P L+YLAVSGN L
Sbjct  166  THMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNEL  205


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  254  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLKSLSSLDLSNNALTGEIPASFSEL  313

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  314  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRSLGRNGRLQLLDLSSNK  373

Query  640  L  642
            L
Sbjct  374  L  374


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG +PPEI  +  L   +LS+N F    P ++ + 
Sbjct  471  LTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEIGKC  530

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  531  RLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  590

Query  640  L  642
            L
Sbjct  591  L  591


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L    +++N+  G VPPEI     L +L++S N      P  ++ +
Sbjct  495  FSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGM  554

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  555  RILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  612


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 55/109 (50%), Gaps = 0/109 (0%)
 Frame = +1

Query  316  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNN  495
            P L  +S++ NQL+G +P  +   S ++ L L  N F    P ++ +L  L   DL +N 
Sbjct  459  PNLGEISLSNNQLTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNK  518

Query  496  LTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              G +P E+ K   L +L +  N  SG+IPP       L YL +S N L
Sbjct  519  FEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHL  567


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 61/115 (53%), Gaps = 0/115 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  231  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLK  290

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +
Sbjct  291  SLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQL  345


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  278  LTGSIPSELGYLKSLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDL  337

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  338  PSLEVLQLWENNFTGGVPRSLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNF  397

Query  640  L  642
            L
Sbjct  398  L  398


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P  L + 
Sbjct  302  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRSLGRN  361

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP E+     L+ L   GN+  G IP   G+  +L  + +  N 
Sbjct  362  GRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGAIPDSLGQCKSLSRVRLGENY  421

Query  640  L  642
            L
Sbjct  422  L  422



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score =   155 bits (393),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 113/166 (68%), Gaps = 6/166 (4%)
 Frame = +1

Query  163  ADSQSSLTSWNISTS-HCTWRRVTCd----sllhvvsldlsglNLSGVLSPDVGQLPFLV  327
            +D   +L SW+ ++S HC W  VTC         VV LD+SGLNLSG L P + +L  L 
Sbjct  34   SDPTGALASWDAASSDHCAWVGVTCAPRGSGGGVVVGLDVSGLNLSGALPPALSRLRGLQ  93

Query  328  NLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-G  504
             LS+AAN   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  
Sbjct  94   RLSVAANGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSA  153

Query  505  DLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             LP+EV  M  LRHLHLGGN+FSG IPPEYGR+P L+YLAVSGN L
Sbjct  154  TLPLEVTHMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNEL  199


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  248  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLRSLSSLDLSNNALTGEIPASFSEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  308  KNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG +PPEI  +  L   +LS+N F    P ++ + 
Sbjct  465  LTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEVGKC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  525  RLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  584

Query  640  L  642
            L
Sbjct  585  L  585


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 6/119 (5%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G  +P++G++      S++ NQL+G +P  +   S ++ L L  N F    P ++ +L  
Sbjct  449  GAAAPNLGEI------SLSNNQLTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQ  502

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L   DL +N   G +P EV K   L +L +  N  SG+IPP       L YL +S N L
Sbjct  503  LSKADLSSNKFEGGVPPEVGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHL  561


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L    +++N+  G VPPE+     L +L++S N      P  ++ +
Sbjct  489  FSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEVGKCRLLTYLDMSQNNLSGKIPPAISGM  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  549  RILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  606


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 61/115 (53%), Gaps = 0/115 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  225  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLR  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +
Sbjct  285  SLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQL  339


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  296  LTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNFTGGVPRRLGRN  355

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP E+     L+ L   GN+  G IP   G+  +L  + +  N 
Sbjct  356  GRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGAIPDSLGQCKSLSRVRLGENY  415

Query  640  L  642
            L
Sbjct  416  L  416


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  272  LTGSIPSELGYLRSLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  332  PSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNF  391

Query  640  L  642
            L
Sbjct  392  L  392



>ref|NP_001058840.2| Os07g0134200 [Oryza sativa Japonica Group]
 dbj|BAF20754.2| Os07g0134200 [Oryza sativa Japonica Group]
Length=883

 Score =   155 bits (392),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 119/177 (67%), Gaps = 5/177 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN L
Sbjct  146  VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNEL  202


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 55/119 (46%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L   
Sbjct  323  LRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAG  382

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL  + +  N
Sbjct  383  GKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ + 
Sbjct  468  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  528  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N   G VPPEI     L +L+LS N      P  ++ +
Sbjct  492  FTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N L G++P  +  M SL  +    N  SG +P   G+F      +  GN
Sbjct  552  RILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLVPAT-GQFSYFNATSFVGN  609


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPP-EISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   + +LP L  + +  N +SG  P    +    L  ++LSNN      P  +  
Sbjct  419  LNGSIPEGLFELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGS  478

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + +Q L L  N  TG++P E+ ++  L    L GN F G +PPE G+   L YL +S N
Sbjct  479  FSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRN  538

Query  637  GL  642
             L
Sbjct  539  NL  540


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRN  321

Query  637  GL  642
             L
Sbjct  322  KL  323


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  457  LANLQVLDLYNNNLTGDLPV  516
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G+L  L +L ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  275  LAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL L+ NN TG +P  + +    + L L  N  +G +PP+      LE L   GN 
Sbjct  335  PSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIALGNS  394

Query  640  L  642
            L
Sbjct  395  L  395



>ref|XP_010685023.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 121/189 (64%), Gaps = 12/189 (6%)
 Frame = +1

Query  106  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC---------dsllhvvs  258
            KPL   EQ  LLSIK++ T D Q++L+SWN +T+HCTW  VTC          +   V+S
Sbjct  21   KPLQ-DEQKVLLSIKSSITDDPQNTLSSWNTTTNHCTWPFVTCSHHHHSPTNTTTSTVIS  79

Query  259  ldlsglNLSGVLS-PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
            LD+S LNL+G+LS  ++  L  L  LS+A N  SG +PP +S +S LR+LNLS+NIF  T
Sbjct  80   LDISSLNLTGILSLSNISLLTNLQKLSVADNYFSGQIPPSLSLLSNLRYLNLSDNIFNGT  139

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  615
            FP  L+    L +LD+YNN LTG LP+ V  MT LRHL LG NYF G++P  YG+  NL+
Sbjct  140  FP-SLSSFKRLTILDVYNNYLTGSLPLSVINMTKLRHLDLGSNYFYGKLPSGYGQLKNLK  198

Query  616  YLAVSGNGL  642
               V  N L
Sbjct  199  NFYVDQNNL  207


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 54/117 (46%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L    GQL  L N  +  N L G +PPE+  +  L  L L +N F    P +L  L  
Sbjct  185  GKLPSGYGQLKNLKNFYVDQNNLVGEIPPELGKLEKLDSLFLWSNYFSGDIPSELGSLKT  244

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  +DL NN L+G++P     +  L  L+L  N   G IP   G  P L  L +  N
Sbjct  245  LISMDLSNNTLSGEIPRSFSLLKKLNFLNLFQNKLQGVIPEFIGDLPELGILQLREN  301


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 51/112 (46%), Gaps = 4/112 (4%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +   L  L ++ NQL G VP  +S    L FLNL NN+    FP  L  L
Sbjct  390  LTGTIPTSFTKCDSLKYLDLSYNQLEGVVPKSLSQCQNLSFLNLENNMLKDKFPSWLESL  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMT----SLRHLHLGGNYFSGRIPPEYGRF  603
              LQVL L  N+  G L     K+      ++   L  N F G +P  Y ++
Sbjct  450  PQLQVLSLSYNSFHGLLLTSSSKVKHPFPKIQIFDLSNNKFCGELPTSYIKY  501



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 119/177 (67%), Gaps = 5/177 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN L
Sbjct  146  VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNEL  202


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322  KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL  + +  N
Sbjct  382  GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ + 
Sbjct  468  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  528  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N   G VPPEI     L +L+LS N      P  ++ +
Sbjct  492  FTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  RILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLV-PATGQFSYFNATSFVGN  609


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPP-EISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   + +LP L  + +  N +SG  P    +    L  ++LSNN      P  +  
Sbjct  419  LNGSIPEGLFELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGS  478

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + +Q L L  N  TG++P E+ ++  L    L GN F G +PPE G+   L YL +S N
Sbjct  479  FSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRN  538

Query  637  GL  642
             L
Sbjct  539  NL  540


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRN  321

Query  637  GL  642
             L
Sbjct  322  KL  323


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  457  LANLQVLDLYNNNLTGDLPV  516
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G+L  L +L ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  275  LAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL L+ NN TG +P  + +    + L L  N  +G +PP+      LE L   GN 
Sbjct  335  PSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIALGNS  394

Query  640  L  642
            L
Sbjct  395  L  395



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 119/177 (67%), Gaps = 5/177 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN L
Sbjct  146  VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPPEYGRWGRLQYLAVSGNEL  202


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP   GR    + L +S N 
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNR  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322  KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L+ L    N+L G +P  + K TSL  + LG NY +G IP      PNL  + +  N
Sbjct  382  GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  441


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ + 
Sbjct  468  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N 
Sbjct  528  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N   G VPPEI     L +L+LS N      P  ++ +
Sbjct  492  FTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  RILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLV-PATGQFSYFNATSFVGN  609


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPP-EISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   + +LP L  + +  N +SG  P    +    L  ++LSNN      P  +  
Sbjct  419  LNGSIPEGLFELPNLTQVELQDNLISGGFPAVSGTGAPNLGQISLSNNQLTGALPAFIGS  478

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + +Q L L  N  TG++P E+ ++  L    L GN F G +PPE G+   L YL +S N
Sbjct  479  FSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRN  538

Query  637  GL  642
             L
Sbjct  539  NL  540


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP  +    NL  L +  N
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRN  321

Query  637  GL  642
             L
Sbjct  322  KL  323


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  457  LANLQVLDLYNNNLTGDLPV  516
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G+L  L +L ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  275  LAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL L+ NN TG +P  + +    + L L  N  +G +PP+      LE L   GN 
Sbjct  335  PSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIALGNS  394

Query  640  L  642
            L
Sbjct  395  L  395



>ref|XP_008440463.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Cucumis melo]
Length=973

 Score =   155 bits (392),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  LS
Sbjct  39   ESQALLSLKSSISDDPHSSLSSWNPAAVATHCSWLGVTCDSHRHVVALDLSSLDLTATLS  98

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +  L FL N+S   N+ SG +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  99   PHIASLRFLTNVSFGLNKFSGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  158

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            D+YNNNLTG+ P  V +M +LR+LHLGGN+F+GRIPPE GR   LE+LA+ GN L
Sbjct  159  DVYNNNLTGEFPRVVTEMPNLRYLHLGGNFFTGRIPPEVGRLQFLEFLAIHGNDL  213


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  ++G L  +  L I+ N L G +P   +    LR L+L +N      P  +A L
Sbjct  286  LSGPLM-ELGGLKSIEALDISCNMLVGEIPISFAVFKNLRLLHLFDNKLSGEIPGFMADL  344

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L   GN 
Sbjct  345  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEVCHGNKLEVLIAMGNS  404

Query  640  L  642
            L
Sbjct  405  L  405


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 59/120 (49%), Gaps = 7/120 (6%)
 Frame = +1

Query  304  VGQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            VG++P        L  L +  N+LSG +P  ++ +  L  L L NN F  + P  L +  
Sbjct  310  VGEIPISFAVFKNLRLLHLFDNKLSGEIPGFMADLPKLEILQLWNNNFTGSIPRNLGKNG  369

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L+ LDL  N+LTG +P EV     L  L   GN  SG IP   G   +L+ + + GN L
Sbjct  370  MLRTLDLAFNHLTGTIPPEVCHGNKLEVLIAMGNSLSGLIPESLGNCISLKRILLWGNAL  429


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 7/119 (6%)
 Frame = +1

Query  307  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  455  GELPITNSVSANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSSIGRLQQ  514

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  ++   N  +G +  E+ +   L  L L GN  SG IP        L Y+ +S N L
Sbjct  515  LSRINFSQNKFSGSIVAEISECKHLIFLDLSGNELSGEIPNHITNMKLLNYMNLSRNHL  573


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP +  + +  N LSG +P   S  + L  ++LSNN+   + P  +  L
Sbjct  429  LNGSIPKRLLGLPNITQIDLHDNFLSGELPITNSVSANLLQISLSNNMLSGSLPPTIGSL  488

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +Q L L  N  +G +P  + ++  L  ++   N FSG I  E     +L +L +SGN 
Sbjct  489  VAVQKLLLDRNKFSGQIPSSIGRLQQLSRINFSQNKFSGSIVAEISECKHLIFLDLSGNE  548

Query  640  L  642
            L
Sbjct  549  L  549


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG++   +G    L  + +  N L+G +P  +  +  +  ++L +N      P   + 
Sbjct  404  SLSGLIPESLGNCISLKRILLWGNALNGSIPKRLLGLPNITQIDLHDNFLSGELPITNSV  463

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             ANL  + L NN L+G LP  +  + +++ L L  N FSG+IP   GR   L  +  S N
Sbjct  464  SANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSSIGRLQQLSRINFSQN  523


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G + P+V     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  380  HLTGTIPPEVCHGNKLEVLIAMGNSLSGLIPESLGNCISLKRILLWGNALNGSIPKRLLG  439

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  440  LPNITQIDLHDNFLSGELPITNSVSANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  499



>ref|XP_004160944.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1-like [Cucumis sativus]
Length=984

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101  PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            D+YNNNLTGD P  V +M +LR+LHLGGN+F+GRIPPE GR   LE+LA+ GN L
Sbjct  161  DVYNNNLTGDFPRVVTEMPNLRYLHLGGNFFTGRIPPEVGRLQFLEFLAIHGNDL  215


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288  LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L    N 
Sbjct  347  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNS  406

Query  640  L  642
            L
Sbjct  407  L  407


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            LP +  + +  N LSG +P   S    L  ++LSNN+   + P  +  L  +Q L L  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              +G +P  + ++  L  ++   N FSG I PE     +L +L +SGN L
Sbjct  502  KFSGQIPSNIGRLQQLSRINFSQNKFSGSIVPEISECKHLIFLDLSGNEL  551


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 7/119 (6%)
 Frame = +1

Query  307  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  457  GELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQ  516

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  ++   N  +G +  E+ +   L  L L GN  SG IP        L Y+ +S N L
Sbjct  517  LSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIPNHITNMKLLNYMNLSRNHL  575


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 58/120 (48%), Gaps = 7/120 (6%)
 Frame = +1

Query  304  VGQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            VG++P        L  L +  N+LSG +P  ++ +  L  L L NN F  + P  L +  
Sbjct  312  VGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADLPKLEILQLWNNNFTGSIPRNLGKNG  371

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L+ LDL  N+LTG +P E+     L  L    N  SG IP   G   +L+ + + GN L
Sbjct  372  MLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNAL  431


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G + P++     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  382  HLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLG  441

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG++   +G    L  + +  N L+G +P  +  +  +  ++L +N      P   +  
Sbjct  407  LSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLGLPNITQIDLHDNFLSGELPIINSVS  466

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +  + +++ L L  N FSG+IP   GR   L  +  S N
Sbjct  467  VNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQLSRINFSQN  525



>ref|XP_004143533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48656.1| Receptor-like protein kinase 3 [Cucumis sativus]
Length=984

 Score =   154 bits (389),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 129/175 (74%), Gaps = 2/175 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101  PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            D+YNNNLTGD P  V +M +LR+LHLGGN+F+GRIPPE GR   LE+LA+ GN L
Sbjct  161  DVYNNNLTGDFPRVVTEMPNLRYLHLGGNFFTGRIPPEVGRLQFLEFLAIHGNDL  215


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 60/121 (50%), Gaps = 1/121 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288  LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPPE      LE L    N 
Sbjct  347  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNS  406

Query  640  L  642
            L
Sbjct  407  L  407


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/110 (32%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            LP +  + +  N LSG +P   S    L  ++LSNN+   + P  +  L  +Q L L  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              +G +P  + ++  L  ++   N FSG I PE     +L +L +SGN L
Sbjct  502  KFSGQIPSNIGRLQQLSRINFSQNKFSGSIVPEISECKHLIFLDLSGNEL  551


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 56/119 (47%), Gaps = 7/119 (6%)
 Frame = +1

Query  307  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  457  GELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQ  516

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  ++   N  +G +  E+ +   L  L L GN  SG IP        L Y+ +S N L
Sbjct  517  LSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIPNHITNMKLLNYMNLSRNHL  575


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 58/120 (48%), Gaps = 7/120 (6%)
 Frame = +1

Query  304  VGQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            VG++P        L  L +  N+LSG +P  ++ +  L  L L NN F  + P  L +  
Sbjct  312  VGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADLPKLEILQLWNNNFTGSIPRNLGKNG  371

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L+ LDL  N+LTG +P E+     L  L    N  SG IP   G   +L+ + + GN L
Sbjct  372  MLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNAL  431


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G + P++     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  382  HLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLG  441

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP  G    ++ L +  N
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRN  501


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG++   +G    L  + +  N L+G +P  +  +  +  ++L +N      P   +  
Sbjct  407  LSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLGLPNITQIDLHDNFLSGELPIINSVS  466

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  + L NN L+G LP  +  + +++ L L  N FSG+IP   GR   L  +  S N
Sbjct  467  VNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQLSRINFSQN  525



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 109/162 (67%), Gaps = 2/162 (1%)
 Frame = +1

Query  163  ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLS  336
            +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG +   + +L  L  L 
Sbjct  45   SDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLD  104

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            +AAN L GP+P  +S + +L  LNLSNN+   TFP  LA+L  L+VLDLYNNNLTG LP+
Sbjct  105  LAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPL  164

Query  517  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             V  +  LRHLHLGGN+FSG IPPEYGR+  L+YLAVSGN L
Sbjct  165  AVVGLPVLRHLHLGGNFFSGEIPPEYGRWRRLQYLAVSGNEL  206


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  255  LSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAAL  314

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V  + SL  L L  N F+G IP   GR   L+ + +S N 
Sbjct  315  RNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  374

Query  640  L  642
            L
Sbjct  375  L  375


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 64/119 (54%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  279  LAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIPELVGDL  338

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L+VL L+ NN TG +P  + +   L+ + L  N  +G +PPE      LE L   GN
Sbjct  339  PSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCAGGKLETLIALGN  397


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G+   L  L +  N  +G VPPEI  +  L   +LS N      P ++ + 
Sbjct  472  LTGALPASIGKFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNTLDGGVPPEIGKC  531

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  532  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLGGEIPATIAAMQSLTAVDFSYNN  591

Query  640  L  642
            L
Sbjct  592  L  592


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N L G VPPEI     L +L+LS N      P  ++ +
Sbjct  496  FTGAVPPEIGRLQQLSKADLSGNTLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  555

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  556  RILNYLNLSRNHLGGEIPATIAAMQSLTAVDFSYNNLSGLV-PATGQFSYFNATSFVGN  613


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 60/128 (47%), Gaps = 13/128 (10%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVP-------PEISAISTLRFLNLSNNIFGSTF  438
            L+G +   + +LP L  + +  N LSG  P       P + AI+      LSNN      
Sbjct  423  LNGSIPDGLFELPNLTQVELQDNLLSGGFPAVSGTGAPNLGAIT------LSNNQLTGAL  476

Query  439  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEY  618
            P  + + + LQ L L  N  TG +P E+ ++  L    L GN   G +PPE G+   L Y
Sbjct  477  PASIGKFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNTLDGGVPPEIGKCRLLTY  536

Query  619  LAVSGNGL  642
            L +S N L
Sbjct  537  LDLSRNNL  544


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 58/110 (53%), Gaps = 0/110 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G +  LV L  A   LSG +PPE+  ++ L  L L  N      P +L +L +L 
Sbjct  235  LPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLS  294

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  621
             LDL NN LTG++P     + +L  L+L  N   G IP   G  P+LE L
Sbjct  295  SLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIPELVGDLPSLEVL  344


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P +L  
Sbjct  326  KLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCA  385

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L+ L    N L G +P  + K  +L  + LG NY +G IP      PNL  + +  N
Sbjct  386  GGKLETLIALGNFLFGSIPEPLGKCEALSRIRLGENYLNGSIPDGLFELPNLTQVELQDN  445


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 71/153 (46%), Gaps = 9/153 (6%)
 Frame = +1

Query  187  SWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA-NQLSGP  363
            S  I   +  WRR+          L +SG  LSG + P++G L  L  L I   N  S  
Sbjct  183  SGEIPPEYGRWRRLQ--------YLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSG  234

Query  364  VPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLR  543
            +PPE+  ++ L  L+ +N       P +L  LANL  L L  N L G +P E+ ++ SL 
Sbjct  235  LPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLS  294

Query  544  HLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L L  N  +G IP  +    NL  L +  N L
Sbjct  295  SLDLSNNALTGEIPASFAALRNLTLLNLFRNKL  327



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 110/163 (67%), Gaps = 8/163 (5%)
 Frame = +1

Query  178  SLTSWN-ISTSHCTWRRVTCd------sllhvvsldlsglNLSGVLSPDVGQLPFLVNLS  336
            +L SWN  S  HC W  VTC           VV LD+SGLNLSG L   + +L  L  LS
Sbjct  41   ALRSWNATSPDHCAWAGVTCAPPGGGRGGGIVVGLDVSGLNLSGALPQALSRLHGLQRLS  100

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLP  513
            +AAN L GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP
Sbjct  101  VAANALYGPIPPSLARLQQLVHLNLSNNAFNGSFPPALARLRGLRVLDLYNNNLTSATLP  160

Query  514  VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +EV +M  LRHLHLGGN+FSG IPPEYGR+P L+YLAVSGN L
Sbjct  161  LEVTQMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNEL  203


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 62/121 (51%), Gaps = 1/121 (1%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            S  L  +V Q+P L +L +  N  SG +PPE      L++L +S N      P +L  L 
Sbjct  156  SATLPLEVTQMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGRIPPELGNLT  215

Query  463  NLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             L+ L + Y N+ TG LP E+  +T L  L       SG IPPE GR  NL+ L +  NG
Sbjct  216  TLRELYIGYYNSYTGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNG  275

Query  640  L  642
            L
Sbjct  276  L  276


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  252  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  M SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNK  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 59/121 (49%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N F    P ++ + 
Sbjct  469  LTGALPASLGSFSGIQKLLLDRNSFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGKC  528

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  529  RLLTYLDMSQNNLSGKIPPAISGMWILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  588

Query  640  L  642
            L
Sbjct  589  L  589


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 62/119 (52%), Gaps = 6/119 (5%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            GV +P++G++      S++ NQL+G +P  + + S ++ L L  N F    P ++ +L  
Sbjct  453  GVAAPNLGEI------SLSNNQLTGALPASLGSFSGIQKLLLDRNSFSGAVPPEIGRLQQ  506

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L   DL +N   G +P E+ K   L +L +  N  SG+IPP       L YL +S N L
Sbjct  507  LSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGMWILNYLNLSRNHL  565


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG + P++G+L  L    +++N+  G VPPEI     L +L++S N      P  ++ 
Sbjct  492  SFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISG  551

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MWILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFTYFNATSFVGN  610


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 62/118 (53%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  229  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGHLK  288

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +  N
Sbjct  289  SLSSLDLSNNALTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWEN  346


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWENNFTGGVPRRLGRN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP E+     L+ L   GN+  G IP   G+  +L  + +  N 
Sbjct  360  GRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGAIPDSLGQCKSLSRVRLGENY  419

Query  640  L  642
            L
Sbjct  420  L  420


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  +
Sbjct  276  LTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDM  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PPE      L+ L   GN 
Sbjct  336  PSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNF  395

Query  640  L  642
            L
Sbjct  396  L  396



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 113/189 (60%), Gaps = 27/189 (14%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  255
            R SA A  G+     E  AL+ +KAA   +   SL  W+ +  HC +W  V CD+     
Sbjct  15   RPSATAATGEGT-AAEHRALVELKAAI-GNPTGSLAGWDAAADHCRSWAGVACDAAGR--  70

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
                                  +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71   ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  615
            FP  L++L NL+ LDLYNNNLT  LPV V  +  LRHLHLGGN+FSG IPPEYGR+ ++E
Sbjct  109  FPSDLSRLKNLRALDLYNNNLTDVLPVVVADLPVLRHLHLGGNFFSGAIPPEYGRWEHIE  168

Query  616  YLAVSGNGL  642
            YLA+SGN L
Sbjct  169  YLAISGNEL  177


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 64/121 (53%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P ++++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKC  500

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              +  +DL  NNL+G++PVE+ +M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  501  RLVTFIDLSRNNLSGEIPVEITEMRILNYLNLSRNHLEGEIPTSISTMQSLTAVDFSYNN  560

Query  640  L  642
            L
Sbjct  561  L  561


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+   +  L+I+ N+LSGP+PPE+  ++TLR L +   N +    P     
Sbjct  153  FSGAIPPEYGRWEHIEYLAISGNELSGPIPPELGNLTTLRELYIGYFNSYQGGLPAAFGN  212

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  LD  N  L+G++P E+  + +L  L L  N  SG I PE G+   L+ + +S N
Sbjct  213  LTSLVRLDAANCGLSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWGLKSMDLSNN  272

Query  637  GL  642
             L
Sbjct  273  AL  274


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG + PE+  +  L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADL  285

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V  +  L  L L  N F+G IP   G    L+ L +S N 
Sbjct  286  KNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNK  345

Query  640  L  642
            L
Sbjct  346  L  346


 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 64/121 (53%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  310  PELEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPDLCSGDKLETLIALGNF  369

Query  640  L  642
            L
Sbjct  370  L  370


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ S P+PPEIS    + F++LS N      P ++ ++
Sbjct  465  FSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKCRLVTFIDLSRNNLSGEIPVEITEM  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  525  RILNYLNLSRNHLEGEIPTSISTMQSLTAVDFSYNNLSGLVP  566


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F    P +L   
Sbjct  274  LTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFTGEIPRRLGTN  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP ++     L  L   GN+  G IP   GR  +L  + +  N 
Sbjct  334  GRLQLLDLSSNKLTGSLPPDLCSGDKLETLIALGNFLFGSIPESLGRCKSLTRIRLGENY  393

Query  640  L  642
            L
Sbjct  394  L  394


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 55/117 (47%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L    G L  LV L  A   LSG +PPE+  +  L  L L  N        +L +L  
Sbjct  204  GGLPAAFGNLTSLVRLDAANCGLSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWG  263

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ +DL NN LTG++P     + +L  L+L  N   G IP   G  P LE L +  N
Sbjct  264  LKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWEN  320


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 58/121 (48%), Gaps = 1/121 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  L  L  + +  N L+G  P + S+  TL  ++LSNN      P  +   
Sbjct  394  LTGSIPSGLFSLRKLAQVELQDNLLNGSFPAKASS-PTLGQISLSNNRLSGALPSSIGNF  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ L L  N  +G +P E+ ++  L  +   GN FS  IPPE  +   + ++ +S N 
Sbjct  453  PGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKCRLVTFIDLSRNN  512

Query  640  L  642
            L
Sbjct  513  L  513



>emb|CDY02112.1| BnaA03g40550D [Brassica napus]
Length=969

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 101/158 (64%), Gaps = 24/158 (15%)
 Frame = +1

Query  172  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  351
             S L SW++STS C W  VTCD                         L  +++L ++   
Sbjct  45   HSPLASWDLSTSFCLWTGVTCD-----------------------ASLRHVISLDLSGLN  81

Query  352  LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVYK  528
            LSG +P  ++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV +  
Sbjct  82   LSGTLPSSMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSITN  141

Query  529  MTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +T LRHLHLGGNYF+GRIPP YG +P LEYLAVSGN L
Sbjct  142  LTELRHLHLGGNYFAGRIPPAYGSWPTLEYLAVSGNEL  179


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P    QL
Sbjct  228  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQL  287

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  288  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGENGRLVILDLSSNK  347

Query  640  L  642
            L
Sbjct  348  L  348


 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 67/120 (56%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  155  FAGRIPPAYGSWPTLEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGGLPPEIGN  214

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L  LD  N  L G++P E+ ++  L  L L  N FSG +PPE G   +L+ + +S N
Sbjct  215  LSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNN  274


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G L P++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  204  FDGGLPPEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  263

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  264  SSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWEN  322


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +S ++GQ+      S++ NQLSGP+PP I + S ++ L L  N F    P ++ +L
Sbjct  428  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRL  481

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LD  +N  +G +P E+ +   L ++ L  N  SG IP E      L YL VS N 
Sbjct  482  QQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGDIPNEITSMRILNYLNVSRNH  541

Query  640  L  642
            L
Sbjct  542  L  542


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +P EI  +  L  L+ S+N+F    P ++++ 
Sbjct  446  LSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRC  505

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+GD+P E+  M  L +L++  N+  G IP       +L  +  S N 
Sbjct  506  KLLTYVDLSRNELSGDIPNEITSMRILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYNN  565

Query  640  L  642
            L
Sbjct  566  L  566


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G + P++G L  L  L I   N   G +PPEI  +S L  L+ +N       P ++ +
Sbjct  179  LAGKIPPEIGNLTTLRELYIGYFNAFDGGLPPEIGNLSELLRLDAANCGLRGEIPPEIGR  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  L L  N  +G LP E+  ++SL+ + L  N F+G IPP + +  NL  L +  N
Sbjct  239  LRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRN  298

Query  637  GL  642
             L
Sbjct  299  KL  300


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 61/120 (51%), Gaps = 2/120 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  L  + N  SG +PPEIS    L +++LS N      P+++  
Sbjct  469  KFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGDIPNEITS  528

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP--EYGRFPNLEYLAVS  630
            +  L  L++  N+L G +PV +  M SL  +    N  SG +P   ++G F +  +L  S
Sbjct  529  MRILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYNNLSGLVPSTGQFGYFNHTSFLGNS  588


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 55/112 (49%), Gaps = 2/112 (2%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  486
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  407  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  466

Query  487  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             N  +G +P E+ ++  L  L    N FSG IPPE  R   L Y+ +S N L
Sbjct  467  GNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNEL  518


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (48%), Gaps = 2/122 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     LV L    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  347  KLTGTLPPNMCFGNRLVTLITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNVLFG  406

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  630
            L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  407  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGSFSGVQKLLLD  466

Query  631  GN  636
            GN
Sbjct  467  GN  468



>emb|CDY23037.1| BnaC07g31500D [Brassica napus]
Length=967

 Score =   150 bits (378),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 100/160 (63%), Gaps = 24/160 (15%)
 Frame = +1

Query  166  DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA  345
            D  S L SWN+STS C W  VTCD                         L  + +L ++ 
Sbjct  42   DQHSPLASWNLSTSFCLWTGVTCD-----------------------ASLRHVTSLYLSG  78

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEV  522
              LSG +   ++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV +
Sbjct  79   LNLSGTLSSSMASLSELRLLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSL  138

Query  523  YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              +T LRHLHLGGNYF+GRIPP YG +P LEYLAVSGN L
Sbjct  139  TNLTELRHLHLGGNYFAGRIPPAYGSWPALEYLAVSGNEL  178


 Score = 79.7 bits (195),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 67/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P    QL
Sbjct  227  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQL  286

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP + G    L  L +S N 
Sbjct  287  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGGNGRLVILDLSSNK  346

Query  640  L  642
            L
Sbjct  347  L  347


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 67/120 (56%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P L  L+++ N+L+G +PPEI  ++ LR L +   N F    P ++  
Sbjct  154  FAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTALRELYIGYFNAFDGGLPPEIGN  213

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L++L  LD  N  L G++P E+ ++  L  L L  N FSG +PPE G   +L+ + +S N
Sbjct  214  LSDLLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNN  273


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G L P++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  203  FDGGLPPEIGNLSDLLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  262

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP   G  P LE L +  N
Sbjct  263  SSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWEN  321


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SGP+P EI  +  L  L+ S+N+F      ++++ 
Sbjct  445  LSGPLPPAIGNFSGVQKLLLDGNKFSGPIPSEIGRLQQLSKLDFSHNLFSGGIAPEISRC  504

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L++  N+  G IP       +L  +  S N 
Sbjct  505  KLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNHLVGSIPATISSMQSLTSVDFSYNN  564

Query  640  L  642
            L
Sbjct  565  L  565


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G + P++G L  L  L I   N   G +PPEI  +S L  L+ +N       P ++ +
Sbjct  178  LAGKIPPEIGNLTALRELYIGYFNAFDGGLPPEIGNLSDLLRLDAANCGLRGEIPPEIGR  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  L L  N  +G LP E+  ++SL+ + L  N F+G IPP + +  NL  L +  N
Sbjct  238  LRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRN  297

Query  637  GL  642
             L
Sbjct  298  KL  299


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 63/121 (52%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +S ++GQ+      S++ NQLSGP+PP I   S ++ L L  N F    P ++ +L
Sbjct  427  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGNFSGVQKLLLDGNKFSGPIPSEIGRL  480

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LD  +N  +G +  E+ +   L ++ L  N  SG IP E      L YL VS N 
Sbjct  481  QQLSKLDFSHNLFSGGIAPEISRCKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNH  540

Query  640  L  642
            L
Sbjct  541  L  541


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/122 (30%), Positives = 58/122 (48%), Gaps = 2/122 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     LV +    N L G +P  +    +L  + +  N    + P+ L  
Sbjct  346  KLTGTLPPNMCFGNRLVTVITLGNFLFGSIPDSLGKCESLTRIRMGQNFLNGSIPNGLFG  405

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  630
            L  L  ++L +N LTG+LP+ +    S  L  + L  N  SG +PP  G F  ++ L + 
Sbjct  406  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLD  465

Query  631  GN  636
            GN
Sbjct  466  GN  467


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 54/112 (48%), Gaps = 2/112 (2%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRF--LNLSNNIFGSTFPHQLAQLANLQVLDLY  486
            LP L  + +  N L+G +P  IS   ++    ++LSNN      P  +   + +Q L L 
Sbjct  406  LPELSQVELQDNYLTGELPLPISGGVSVNLGQISLSNNQLSGPLPPAIGNFSGVQKLLLD  465

Query  487  NNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             N  +G +P E+ ++  L  L    N FSG I PE  R   L Y+ +S N L
Sbjct  466  GNKFSGPIPSEIGRLQQLSKLDFSHNLFSGGIAPEISRCKLLTYVDLSRNEL  517


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+++  L +LN+S N    + P  ++ +
Sbjct  493  FSGGIAPEISRCKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNHLVGSIPATISSM  552

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  553  QSLTSVDFSYNNLSGLVP  570



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score =   150 bits (379),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 108/157 (69%), Gaps = 2/157 (1%)
 Frame = +1

Query  178  SLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  351
            +L SW  N + S C W  VTC++   V+ +DLSG NLSG +   + +LP L  L +AAN 
Sbjct  48   ALASWTANATASPCAWSGVTCNARGAVIGVDLSGRNLSGPVPAALSRLPHLARLDLAANA  107

Query  352  LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  531
             SGP+P  ++ +  L  LNLSNN+   TFP  LA+L  L+V+DLYNNNLTG LP+ V  +
Sbjct  108  FSGPIPTPLARLRYLTHLNLSNNVLNGTFPPPLARLRALRVVDLYNNNLTGPLPLGVAAL  167

Query  532  TSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             +LRHLHLGGN+FSG IPPEYG +  L+YLAVSGN L
Sbjct  168  PALRHLHLGGNFFSGEIPPEYGTWGRLQYLAVSGNEL  204


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  253  LSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAAL  312

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V  + SL  L L  N F+G IP   GR   L+ + +S N 
Sbjct  313  KNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  372

Query  640  L  642
            L
Sbjct  373  L  373


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    L  L +  N  +G VPPEI  +  L   +LS N      P ++ + 
Sbjct  470  LTGALPASIGNFSGLQKLLLDQNAFNGAVPPEIGRLQQLSKADLSGNSLDGGVPPEIGKC  529

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  530  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYNN  589

Query  640  L  642
            L
Sbjct  590  L  590


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N L G VPPEI     L +L+LS N      P  ++ +
Sbjct  494  FNGAVPPEIGRLQQLSKADLSGNSLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  553

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  554  RILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYNNLSGLV-PATGQFSYFNATSFVGN  611


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  277  LAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAALKNLTLLNLFRNKLRGSIPELVGDL  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL L+ NN TG +P  + +   L+ + L  N  +G +PP+      LE L   GN 
Sbjct  337  PSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPDLCAGGKLETLIALGNF  396

Query  640  L  642
            L
Sbjct  397  L  397


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   + +LP LV + +  N LSG  P    +A S L  + LSNN      P  +  
Sbjct  421  LNGSIPEGLFELPNLVQVELQDNLLSGGFPAVAGAAASNLGSITLSNNQLTGALPASIGN  480

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + LQ L L  N   G +P E+ ++  L    L GN   G +PPE G+   L YL +S N
Sbjct  481  FSGLQKLLLDQNAFNGAVPPEIGRLQQLSKADLSGNSLDGGVPPEIGKCRLLTYLDLSRN  540

Query  637  GL  642
             L
Sbjct  541  NL  542


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG + P++G +  LV L  A   LSG +PPE+  ++ L  L L  N      P +L +L 
Sbjct  230  SGGIPPELGNMTELVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGRLR  289

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  621
            +L  LDL NN LTG++P     + +L  L+L  N   G IP   G  P+LE L
Sbjct  290  SLSSLDLSNNALTGEIPATFAALKNLTLLNLFRNKLRGSIPELVGDLPSLEVL  342


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  517  SLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAA  576

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  577  MQSLTAVDFSYNNLSGLVP  595


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 54/120 (45%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P  L  
Sbjct  324  KLRGSIPELVGDLPSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPDLCA  383

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L+ L    N L G +P  + K  +L  + LG NY +G IP      PNL  + +  N
Sbjct  384  GGKLETLIALGNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGLFELPNLVQVELQDN  443


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 80/179 (45%), Gaps = 15/179 (8%)
 Frame = +1

Query  109  PLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSG  288
            PLGV    AL  +          +  S  I   + TW R+          L +SG  LSG
Sbjct  161  PLGVAALPALRHLHLG------GNFFSGEIPPEYGTWGRLQ--------YLAVSGNELSG  206

Query  289  VLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
             + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  LAN
Sbjct  207  RIPPELGNLTSLRELYIGYYNSYSGGIPPELGNMTELVRLDAANCGLSGEIPPELGNLAN  266

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  L L  N L G +P E+ ++ SL  L L  N  +G IP  +    NL  L +  N L
Sbjct  267  LDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAALKNLTLLNLFRNKL  325



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 110/163 (67%), Gaps = 3/163 (2%)
 Frame = +1

Query  163  ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSG-VLSPDVGQLPFLVNL  333
            +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG V +  + +L  L  L
Sbjct  42   SDPAGALASWTNATSTGPCAWSGVTCNARGAVIGLDLSGRNLSGAVPAAALSRLAHLARL  101

Query  334  SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLP  513
             +AAN LSGP+P  +S + +L  LNLSNN+   TFP   A+L  L+VLDLYNNNLTG LP
Sbjct  102  DLAANALSGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPFARLRALRVLDLYNNNLTGPLP  161

Query  514  VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            + V  +  LRHLHLGGN+FSG IPPEYG++  L+YLAVSGN L
Sbjct  162  LVVVALPMLRHLHLGGNFFSGEIPPEYGQWRRLQYLAVSGNEL  204


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 70/122 (57%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ GQ   L  L+++ N+LSG +PPE+  +++LR L +   N + S  P +   
Sbjct  180  FSGEIPPEYGQWRRLQYLAVSGNELSGKIPPELGGLTSLRELYIGYYNSYSSGIPPEFGN  239

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            + +L  LD  N  L+G++P E+  + +L  L L  N  +G IPPE GR  +L  L +S N
Sbjct  240  MTDLVRLDAANCGLSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLSSLDLSNN  299

Query  637  GL  642
            GL
Sbjct  300  GL  301


 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  253  LSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLSSLDLSNNGLTGEIPASFAAL  312

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP   GR   L+ + +S N 
Sbjct  313  KNLTLLNLFRNKLRGSIPELVGDLPNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNR  372

Query  640  L  642
            L
Sbjct  373  L  373


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  277  LTGAIPPELGRLRSLSSLDLSNNGLTGEIPASFAALKNLTLLNLFRNKLRGSIPELVGDL  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL+VL L+ NN TG +P  + +   L+ + L  N  +G +PPE      LE L   GN 
Sbjct  337  PNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCAGGKLETLIALGNF  396

Query  640  L  642
            L
Sbjct  397  L  397


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    L  L +  N  +G VPPEI  +  L   +LS N      P ++ + 
Sbjct  470  LTGALPASIGNFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNALDGGMPPEIGKC  529

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP       +L  +  S N 
Sbjct  530  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYNN  589

Query  640  L  642
            L
Sbjct  590  L  590


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 58/119 (49%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N L G +PPEI     L +L+LS N      P  ++ +
Sbjct  494  FTGAVPPEIGRLQQLSKADLSGNALDGGMPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  553

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  554  RILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYNNLSGLV-PATGQFSYFNATSFVGN  611


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 57/122 (47%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   + +LP L  + +  N LSG  P    +    L  + LSNN      P  +  
Sbjct  421  LNGSIPEGLFELPNLTQVELQDNLLSGGFPAVAGTGAPNLGAITLSNNQLTGALPASIGN  480

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + LQ L L  N  TG +P E+ ++  L    L GN   G +PPE G+   L YL +S N
Sbjct  481  FSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNALDGGMPPEIGKCRLLTYLDLSRN  540

Query  637  GL  642
             L
Sbjct  541  NL  542


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            + P+ G +  LV L  A   LSG +PPE+  +  L  L L  N      P +L +L +L 
Sbjct  233  IPPEFGNMTDLVRLDAANCGLSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLS  292

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
             LDL NN LTG++P     + +L  L+L  N   G IP   G  PNLE L +
Sbjct  293  SLDLSNNGLTGEIPASFAALKNLTLLNLFRNKLRGSIPELVGDLPNLEVLQL  344


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 55/120 (46%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   VG LP L  L +  N  +G +P  +     L+ ++LS+N    T P +L  
Sbjct  324  KLRGSIPELVGDLPNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPPELCA  383

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L+ L    N L G +P  + K  +L  + LG NY +G IP      PNL  + +  N
Sbjct  384  GGKLETLIALGNFLFGSIPESLGKCEALSRIRLGENYLNGSIPEGLFELPNLTQVELQDN  443



>emb|CDY45620.1| BnaCnng13280D [Brassica napus]
Length=973

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 115/177 (65%), Gaps = 25/177 (14%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC                    
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTC--------------------  62

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
              DV +   + +L +++  LSG +  +IS +S LR LNLSNN+F  +FP +++  LANL+
Sbjct  63   --DVSRR-HVTSLDLSSLNLSGTLSRDISNLSGLRHLNLSNNVFNGSFPDEISSGLANLR  119

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP YG +P +EYLAVSGN L
Sbjct  120  VLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPPSYGTWPEIEYLAVSGNEL  176


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  225  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPSSFSDL  284

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  + +S N 
Sbjct  285  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNK  344

Query  640  L  642
            L
Sbjct  345  L  345


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/115 (36%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  205  LPPEIGNLSELVRFDAANCGLNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  264

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +DL NN  TG++P     + +L  L+L  N   G IP   G  P+LE L +  N
Sbjct  265  SMDLSNNMFTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWEN  319


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  152  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  211

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ L   D  N  L G++P E+ ++  L  L L  N FSG +  E G+  +L+ + +S N
Sbjct  212  LSELVRFDAANCGLNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNN  271


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  441  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  500

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP       +L  L  S N 
Sbjct  501  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNN  560

Query  640  L  642
            L
Sbjct  561  L  561


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  249  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP       LE L   GN 
Sbjct  309  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNF  368

Query  640  L  642
            L
Sbjct  369  L  369


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 56/120 (47%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
               G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P ++  
Sbjct  464  KFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPKEITG  523

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G +P  +  M SL  L    N  SG +P   G+F    Y +  GN
Sbjct  524  MRILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNNLSGLVPGT-GQFSYFNYTSFLGN  582


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  
Sbjct  344  KLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFG  403

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  ++L +N LTG+LPV      +L  L L  N  SG++PP  G F  ++ L + GN
Sbjct  404  LPKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGN  463


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 61/121 (50%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  423  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  476

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP E      L YL +S N 
Sbjct  477  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNH  536

Query  640  L  642
            L
Sbjct  537  L  537


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N      P   +  
Sbjct  369  LFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGELPVTGSVS  428

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             NL  L L NN L+G LP  +   T ++ L L GN F G IP E G+   L  +  S N
Sbjct  429  VNLGQLSLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHN  487


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 55/121 (45%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +      L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  273  FTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGEN  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L ++DL +N LTG LP  +     L  L   GN+  G IP   G+  +L  + +  N 
Sbjct  333  GRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENF  392

Query  640  L  642
            L
Sbjct  393  L  393



>ref|XP_001754727.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ80697.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=1017

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 116/175 (66%), Gaps = 3/175 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E+ AL+++KA    D +S L  W +  ++S C W  V C++   VV L LSG+NLSG +S
Sbjct  34   ERLALIALKATID-DPESHLADWEVNGTSSPCLWTGVDCNNSSSVVGLYLSGMNLSGTIS  92

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             ++G L  LVNLS+  N  +  +P +I  ++ L++LN+S N FG   P   +QL  LQVL
Sbjct  93   SELGNLKNLVNLSLDRNNFTEDLPADIVTLTQLKYLNVSTNSFGGALPSNFSQLQLLQVL  152

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            D +NN  +G LP +++K+++L H+ LGGNYF G IPPEYG+FPNL+Y  ++GN L
Sbjct  153  DCFNNFFSGPLPPDLWKISTLEHVSLGGNYFEGSIPPEYGKFPNLKYFGLNGNSL  207


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 67/122 (55%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLS  +   +G LP +++  I+ N  +GP+PP+I  +  L  L++S N    + P +++ 
Sbjct  471  NLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGNNLSGSIPAEMSN  530

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L +LD+ +N+LTG +PV++  +  L +L+L  N  SG IP +    P L     S N
Sbjct  531  CKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNELSGAIPSKLADLPTLSIFDFSYN  590

Query  637  GL  642
             L
Sbjct  591  NL  592


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 53/104 (51%), Gaps = 0/104 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            + I  NQ++GP+P EI     L +L+ S N   S+ P  +  L ++    + +N+ TG +
Sbjct  441  VEIQDNQVNGPIPSEIINAPLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPI  500

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            P ++  M +L  L + GN  SG IP E      L  L VS N L
Sbjct  501  PPQICDMPNLNKLDMSGNNLSGSIPAEMSNCKKLGLLDVSHNSL  544


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 60/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +  ++   P L  L  + N LS  +P  I  + ++    +S+N F    P Q+  +
Sbjct  448  VNGPIPSEIINAPLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDM  507

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL  LD+  NNL+G +P E+     L  L +  N  +G IP +    P+L YL +S N 
Sbjct  508  PNLNKLDMSGNNLSGSIPAEMSNCKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNE  567

Query  640  L  642
            L
Sbjct  568  L  568


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G L  L +L ++ N+L+G +P  +  +  L  ++L NN    T P  LA L
Sbjct  280  LEGPIPASLGNLVNLRSLDLSYNRLTGILPNTLIYLQKLELMSLMNNHLEGTVPDFLADL  339

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL+VL L+ N LTG +P  + +  +L  L L  N+ +G IPP+      L+++ +  N 
Sbjct  340  PNLEVLYLWKNQLTGPIPENLGQNMNLTLLDLSSNHLNGSIPPDLCAGQKLQWVILLENQ  399

Query  640  L  642
            L
Sbjct  400  L  400


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 55/122 (45%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N S  +    G L  LV L +A+  L G +P E+  +  L  L L  N      P  L  
Sbjct  231  NFSSSIPATFGNLTNLVRLDMASCGLVGAIPHELGNLGQLDTLFLMLNSLEGPIPASLGN  290

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL+ LDL  N LTG LP  +  +  L  + L  N+  G +P      PNLE L +  N
Sbjct  291  LVNLRSLDLSYNRLTGILPNTLIYLQKLELMSLMNNHLEGTVPDFLADLPNLEVLYLWKN  350

Query  637  GL  642
             L
Sbjct  351  QL  352


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +G    L  L +  N L+G +P  +  +  L  + + +N      P ++   
Sbjct  400  LTGSIPESLGHCQSLTKLRLGINSLNGSIPQGLLGLPLLAMVEIQDNQVNGPIPSEIINA  459

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LD   NNL+  +P  +  + S+    +  N+F+G IPP+    PNL  L +SGN 
Sbjct  460  PLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGNN  519

Query  640  L  642
            L
Sbjct  520  L  520


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L G +   +  LP L  L +  NQL+GP+P  +     L  L+LS+N    + P  L  
Sbjct  327  HLEGTVPDFLADLPNLEVLYLWKNQLTGPIPENLGQNMNLTLLDLSSNHLNGSIPPDLCA  386

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
               LQ + L  N LTG +P  +    SL  L LG N  +G I
Sbjct  387  GQKLQWVILLENQLTGSIPESLGHCQSLTKLRLGINSLNGSI  428


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +  ++     L  L ++ N L+G +P ++  I  L +LNLS+N      P +LA 
Sbjct  519  NLSGSIPAEMSNCKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNELSGAIPSKLAD  578

Query  457  LANLQVLDLYNNNLTGDLPV-EVYKMTSLR  543
            L  L + D   NNL+G +P+ + Y  T+  
Sbjct  579  LPTLSIFDFSYNNLSGPIPLFDSYNATAFE  608



>ref|XP_006853709.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
 gb|ERN15176.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
Length=918

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 123/179 (69%), Gaps = 3/179 (2%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLS  285
            + V     L ++K A   D +SSL +W+   S+++C+W  + CD   +V  LD+S + LS
Sbjct  19   ISVDNSGPLWAVKFAIN-DPESSLETWSKGNSSNYCSWIGIQCDDSGYVSVLDISDMGLS  77

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +SP++G L  L  LS+A N+ SG +P EI+ IS L  LNLSNN+F  TFP  L+ L N
Sbjct  78   GQISPEIGNLQRLTTLSLAVNEFSGQIPAEIARISGLNLLNLSNNLFNGTFPVSLSGLKN  137

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L+VLDLYNNNLTG LP  V +++ ++HLHLGGNYF+G IPPEYG+   +EYLA+SGN L
Sbjct  138  LEVLDLYNNNLTGPLPKGVAEISGIKHLHLGGNYFNGEIPPEYGKLKEIEYLALSGNEL  196


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 71/121 (59%), Gaps = 2/121 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N+L+G +PPE+  +  L+ L+LSNN      P   A+L
Sbjct  245  LSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNLRVLKSLDLSNNKLSGEIPANFAEL  304

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL++L+L+ N+L G +P  V ++  L  L L  N FSG +  ++GR  NL+ L +S N 
Sbjct  305  KNLKLLNLFINSLKGTIPPFVAELPELEVLQLWDNEFSGELDGKFGR--NLKLLDLSSNK  362

Query  640  L  642
            L
Sbjct  363  L  363


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L+ LS++ NQL+G +P  I    +L+ L L+ N F    P ++  L +L VLDL  NN +
Sbjct  450  LLELSLSNNQLNGEIPAIIGDFGSLQKLFLAGNQFSGEIPPKICSLNDLSVLDLSRNNFS  509

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEY  594
            G++P ++  M SL +L+L  N+  G+IP  +
Sbjct  510  GEIPAKIAGMRSLTYLNLSKNHLVGQIPAAF  540


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P+ G+L  +  L+++ N+LSG +P E+  ++ L  L L   N F    P +   
Sbjct  172  FNGEIPPEYGKLKEIEYLALSGNELSGNIPKELGNLTKLEQLYLGYFNWFSGGIPPEFGN  231

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  LD+ +  L+G++P E+  +T L  L L  N  +G+IPPE G    L+ L +S N
Sbjct  232  LRRLFRLDMASCGLSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNLRVLKSLDLSNN  291

Query  637  GL  642
             L
Sbjct  292  KL  293


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 64/144 (44%), Gaps = 25/144 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++     L  L +  N  SG VP  ++   +L+ + L +N+   + P+ L  L
Sbjct  363  LAGKIPPEICSGGLLQTLILLNNSFSGQVPGSLTTCQSLKRVRLGDNLLNGSLPYGLLSL  422

Query  460  ANLQVLDLYNNNLT-------------------------GDLPVEVYKMTSLRHLHLGGN  564
             NL  L+L NN LT                         G++P  +    SL+ L L GN
Sbjct  423  QNLTQLELKNNKLTGKFFSGNLSVSETLLELSLSNNQLNGEIPAIIGDFGSLQKLFLAGN  482

Query  565  YFSGRIPPEYGRFPNLEYLAVSGN  636
             FSG IPP+     +L  L +S N
Sbjct  483  QFSGEIPPKICSLNDLSVLDLSRN  506


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P+ G L  L  L +A+  LSG +P EI  ++ L  L L  N      P ++  L
Sbjct  221  FSGGIPPEFGNLRRLFRLDMASCGLSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNL  280

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L+ LDL NN L+G++P    ++ +L+ L+L  N   G IPP     P LE L +  N
Sbjct  281  RVLKSLDLSNNKLSGEIPANFAELKNLKLLNLFINSLKGTIPPFVAELPELEVLQLWDN  339



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score =   145 bits (366),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 106/176 (60%), Gaps = 3/176 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +   LLS+K AF     S LTSWN+S   S CTW  + CD+    +        N+SG L
Sbjct  37   QATILLSLKQAFEPPEDSCLTSWNVSNYNSLCTWTGIKCDAKNTSILSLDISNYNISGYL  96

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
             P +  +  LVNLS++ N LSG  P +I  +  L+FLN+SNN F  +   Q ++L  L V
Sbjct  97   LPAISDIHTLVNLSVSGNSLSGTFPVDIHKLVRLQFLNISNNQFNGSLNWQFSKLKKLVV  156

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LD YNN  +G LP+ V  ++ L+HL  GGNYFSG+IPP YG   NL+YL+++GN L
Sbjct  157  LDAYNNEFSGSLPLGVTDLSKLKHLDFGGNYFSGKIPPVYGSLENLDYLSLAGNNL  212


 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  ++G L  LV L +++  L GP+PPE+  ++ L  L L  N    + P +LA L
Sbjct  237  FDGGIPAELGNLVNLVRLDLSSCGLKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANL  296

Query  460  ANLQVLDLYNNNLTGDLPVEVYK-MTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L+  DL NN LTG++PVE++  +  L  L+L  N F G IP      PNLE L +  N
Sbjct  297  TTLKSFDLSNNVLTGEIPVELFSGLKELTLLNLFLNKFHGEIPRVLAELPNLEVLKLWQN  356


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 72/122 (59%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQ  456
            L G + P++G L  L  L +  NQLSG +PPE++ ++TL+  +LSNN+     P +L + 
Sbjct  261  LKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANLTTLKSFDLSNNVLTGEIPVELFSG  320

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L +L+L+ N   G++P  + ++ +L  L L  N F+G IP   G+  NL+ + +S N
Sbjct  321  LKELTLLNLFLNKFHGEIPRVLAELPNLEVLKLWQNNFTGSIPSMLGQNGNLKEIDLSTN  380

Query  637  GL  642
             L
Sbjct  381  KL  382


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G L     +LP  L  L++A N+LSG +P  I   S+L  L L+ N F    P  + +
Sbjct  454  LTGQLEQQRSKLPMKLGQLNLANNRLSGSLPASIGNFSSLNILLLNGNRFIGDIPSDIGR  513

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+  LD+  NN +G +P E+     L +L L  N  SG IP +  +   L YL +S N
Sbjct  514  LKNIFKLDMSRNNFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHILNYLNISWN  573

Query  637  GL  642
             L
Sbjct  574  HL  575


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 1/117 (1%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  D+G+L  +  L ++ N  SG +P EIS    L +L+LS N      P Q+AQ+  
Sbjct  505  GDIPSDIGRLKNIFKLDMSRNNFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHI  564

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L++  N+L   LP E+  M SL       N FSG I PE G++      +  GN
Sbjct  565  LNYLNISWNHLNQSLPKEIGLMKSLTSADFSHNNFSGPI-PETGQYSVFNSTSFIGN  620


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 60/122 (49%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P  G L  L  LS+A N L G +P ++  ++ L  L+L   N+F    P +L  
Sbjct  188  FSGKIPPVYGSLENLDYLSLAGNNLVGYIPKQLGNLTNLNQLHLGYYNLFDGGIPAELGN  247

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  LDL +  L G +P E+  +  L  L L  N  SG IPPE      L+   +S N
Sbjct  248  LVNLVRLDLSSCGLKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANLTTLKSFDLSNN  307

Query  637  GL  642
             L
Sbjct  308  VL  309


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG +  ++     L  L ++ NQLSGP+P +I+ I  L +LN+S N    + P ++  
Sbjct  526  NFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHILNYLNISWNHLNQSLPKEIGL  585

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +NN +G +P
Sbjct  586  MKSLTSADFSHNNFSGPIP  604



>ref|XP_002985227.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
 gb|EFJ13721.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
Length=1023

 Score =   145 bits (366),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 110/178 (62%), Gaps = 3/178 (2%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            G  +++ALL++KAA   DS  SL  W     + C W  +TCD  L  V        NLSG
Sbjct  22   GFQDKSALLALKAAMI-DSSGSLDDWTETDDTPCLWTGITCDDRLSRVVALDLSNKNLSG  80

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            + S  +G+L  L+NL++  N  +G +P E++ +  L FLN+S+N F   FP + + L  L
Sbjct  81   IFSSSIGRLTELINLTLDVNNFTGNLPSELATLHDLHFLNVSHNTFTGDFPGRFSNLQLL  140

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +VLD YNNN +G LP+E+ ++ +LRHLHLGG+YF G IPP YG   +L YLA+ GN L
Sbjct  141  EVLDAYNNNFSGPLPIELSRLPNLRHLHLGGSYFEGEIPPSYGNMTSLSYLALCGNCL  198


 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 71/121 (59%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L GV+  ++G L  L +L +  N LSGP+PP++  +  L+ L+LSNN      P +L +L
Sbjct  247  LEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL++L L+ N L+G++P  V  + +L+ L L  N F+G +P   G   NL  L VS N 
Sbjct  307  QNLELLSLFLNGLSGEIPAFVADLPNLQALLLWTNNFTGELPQRLGENMNLTELDVSSNP  366

Query  640  L  642
            L
Sbjct  367  L  367


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 64/115 (56%), Gaps = 0/115 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G + P++G+L  L  L IA+  L G +P E+  +S L  L L  N      P QL  
Sbjct  222  HFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGD  281

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  621
            L NL+ LDL NNNLTG +P+E+ K+ +L  L L  N  SG IP      PNL+ L
Sbjct  282  LVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVADLPNLQAL  336


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 65/122 (53%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG + P +G L  L +L ++ N L+G +P E+  +  L  L+L  N      P  +A 
Sbjct  270  HLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVAD  329

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NLQ L L+ NN TG+LP  + +  +L  L +  N  +G +PP   +   LE L +  N
Sbjct  330  LPNLQALLLWTNNFTGELPQRLGENMNLTELDVSSNPLTGPLPPNLCKGGQLEVLVLIEN  389

Query  637  GL  642
            G+
Sbjct  390  GI  391


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 25/147 (17%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-----------  423
            N SG L  ++ +LP L +L +  +   G +PP    +++L +L L  N            
Sbjct  149  NFSGPLPIELSRLPNLRHLHLGGSYFEGEIPPSYGNMTSLSYLALCGNCLVGPIPPELGY  208

Query  424  --------------FGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                          F    P +L +L NLQ LD+ +  L G +P E+  +++L  L L  
Sbjct  209  LVGLEELYLGYFNHFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGNLSNLDSLFLQI  268

Query  562  NYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            N+ SG IPP+ G   NL+ L +S N L
Sbjct  269  NHLSGPIPPQLGDLVNLKSLDLSNNNL  295


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   V +LP L  L + +NQ  G +P E+  +S L  L+L +N      P +LAQ 
Sbjct  462  LQGSIPAGVARLPSLQKLFLHSNQFVGGIPVELGQLSHLLHLDLHSNRLSGAIPAELAQC  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE  591
            + L  LD+ +N LTG +P E+  M  L  L++  N  SG IPP+
Sbjct  522  SKLNYLDVSDNRLTGPIPAELGSMEVLELLNVSRNRLSGGIPPQ  565


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++ +L  L  LS+  N LSG +P  ++ +  L+ L L  N F    P +L +
Sbjct  294  NLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVADLPNLQALLLWTNNFTGELPQRLGE  353

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              NL  LD+ +N LTG LP  + K   L  L L  N  +G IPP  G   +L  + ++GN
Sbjct  354  NMNLTELDVSSNPLTGPLPPNLCKGGQLEVLVLIENGITGTIPPALGHCKSLIKVRLAGN  413

Query  637  GL  642
             L
Sbjct  414  HL  415


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 70/121 (58%), Gaps = 1/121 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G++ P +   P L  L ++ N+L G +P  ++ + +L+ L L +N F    P +L QL
Sbjct  439  LTGMI-PAIVDAPLLDFLDLSQNELQGSIPAGVARLPSLQKLFLHSNQFVGGIPVELGQL  497

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            ++L  LDL++N L+G +P E+ + + L +L +  N  +G IP E G    LE L VS N 
Sbjct  498  SHLLHLDLHSNRLSGAIPAELAQCSKLNYLDVSDNRLTGPIPAELGSMEVLELLNVSRNR  557

Query  640  L  642
            L
Sbjct  558  L  558


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 66/117 (56%), Gaps = 1/117 (1%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  ++GQL  L++L + +N+LSG +P E++  S L +L++S+N      P +L  +  
Sbjct  488  GGIPVELGQLSHLLHLDLHSNRLSGAIPAELAQCSKLNYLDVSDNRLTGPIPAELGSMEV  547

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L++L++  N L+G +P ++    SL       N FSG +P + G F +L   +  GN
Sbjct  548  LELLNVSRNRLSGGIPPQILGQESLTSADFSYNDFSGTVPSD-GHFGSLNMSSFVGN  603



>dbj|BAJ89729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1030

 Score =   145 bits (365),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 105/163 (64%), Gaps = 8/163 (5%)
 Frame = +1

Query  178  SLTSWNISTS--------HCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNL  333
            +L SW +  +        HC W  V+C +   V  L L GLNLSG L P + +L  L+ L
Sbjct  40   ALASWEVPAAASNGTGYAHCAWAGVSCGARGAVAGLALGGLNLSGALPPALSRLRGLLRL  99

Query  334  SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLP  513
             + AN LSGPVP  +  +  L  LNLSNN F  + P  LA+L  L+VLDLYNNNLT  LP
Sbjct  100  DVGANALSGPVPAALGHLRFLTHLNLSNNAFNGSLPPALARLRGLRVLDLYNNNLTSPLP  159

Query  514  VEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +EV +M  LRHLHLGGN+FSG IPPEYGR+  L+YLA+SGN L
Sbjct  160  IEVAQMPMLRHLHLGGNFFSGEIPPEYGRWTRLQYLALSGNEL  202


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE    + L++L LS N      P +L  
Sbjct  153  NLTSPLPIEVAQMPMLRHLHLGGNFFSGEIPPEYGRWTRLQYLALSGNELSGKIPPELGN  212

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N  +G +P E+  +T L  L       SG+IPPE GR   L+ L +  
Sbjct  213  LTSLRELYIGYYNAYSGGVPPELGNLTDLVRLDAANCGLSGKIPPELGRLQKLDTLFLQV  272

Query  634  NGL  642
            NGL
Sbjct  273  NGL  275


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P ++ ++ +L  L+LSNN      P   +QL
Sbjct  251  LSGKIPPELGRLQKLDTLFLQVNGLTGAIPSDLGSLKSLSSLDLSNNALAGEIPPSFSQL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +L+L+ N L GD+P  V  + SL  L L  N F+G +P   G    L+ + +S N 
Sbjct  311  KNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGSVPRRLGGNNRLQLVDLSSNR  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+GVL   +G    +  L +  N  SG +P E+  +  L   +LS N      P ++ + 
Sbjct  468  LTGVLPASIGNFSGVQKLLLDRNSFSGALPAEVGRLQQLSKADLSGNAIEGGVPPEVGKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NNL+G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  528  RLLTYLDLSRNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSISTMQSLTAVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 60/119 (50%), Gaps = 6/119 (5%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G  +P++G+    +NLS   NQL+G +P  I   S ++ L L  N F    P ++ +L  
Sbjct  452  GAAAPNLGE----INLS--NNQLTGVLPASIGNFSGVQKLLLDRNSFSGALPAEVGRLQQ  505

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L   DL  N + G +P EV K   L +L L  N  SG+IPP       L YL +S N L
Sbjct  506  LSKADLSGNAIEGGVPPEVGKCRLLTYLDLSRNNLSGKIPPAISGMRILNYLNLSRNHL  564


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 58/120 (48%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG L  +VG+L  L    ++ N + G VPPE+     L +L+LS N      P  ++ 
Sbjct  491  SFSGALPAEVGRLQQLSKADLSGNAIEGGVPPEVGKCRLLTYLDLSRNNLSGKIPPAISG  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  551  MRILNYLNLSRNHLDGEIPPSISTMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  609


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 47/99 (47%), Gaps = 0/99 (0%)
 Frame = +1

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  525
            N L+G +PP  S +  +  LNL  N      P  +  L +L+VL L+ NN TG +P  + 
Sbjct  297  NALAGEIPPSFSQLKNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGSVPRRLG  356

Query  526  KMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
                L+ + L  N  +G +PP+      L  L   GN L
Sbjct  357  GNNRLQLVDLSSNRLTGTLPPDLCAGGKLHTLIALGNSL  395


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 62/122 (51%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG + P++G L  L  L I   N  SG VPPE+  ++ L  L+ +N       P +L +
Sbjct  202  LSGKIPPELGNLTSLRELYIGYYNAYSGGVPPELGNLTDLVRLDAANCGLSGKIPPELGR  261

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  L L  N LTG +P ++  + SL  L L  N  +G IPP + +  N+  L +  N
Sbjct  262  LQKLDTLFLQVNGLTGAIPSDLGSLKSLSSLDLSNNALAGEIPPSFSQLKNMTLLNLFRN  321

Query  637  GL  642
             L
Sbjct  322  KL  323


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 62/149 (42%), Gaps = 31/149 (21%)
 Frame = +1

Query  280  LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
            L+G L PD+   G+L  L+ L    N L G +P  +    +L  + L  N    + P  L
Sbjct  371  LTGTLPPDLCAGGKLHTLIAL---GNSLFGAIPDSLGQCKSLSRIRLGENYLNGSIPEGL  427

Query  451  AQLANLQVLDLYNNNLTGD-------------------------LPVEVYKMTSLRHLHL  555
             +L  L  ++L +N LTGD                         LP  +   + ++ L L
Sbjct  428  FELQKLTQVELQDNLLTGDFPAVVGAAAPNLGEINLSNNQLTGVLPASIGNFSGVQKLLL  487

Query  556  GGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              N FSG +P E GR   L    +SGN +
Sbjct  488  DRNSFSGALPAEVGRLQQLSKADLSGNAI  516



>ref|XP_011045060.1| PREDICTED: receptor protein kinase CLAVATA1-like [Populus euphratica]
Length=972

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 117/181 (65%), Gaps = 5/181 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  282
            G ++   LL +K +    + + L  W  S    T+HC +  V CD    VVSL+LS  +L
Sbjct  20   GYSDLEVLLKLKTSMCGHNGTGLQDWVASPASPTAHCYFSGVMCDEDSRVVSLNLSFRHL  79

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G++ P++G L  LVNL+++ N L+G  P EI+ +++LR LN+SNN+    FP ++   +
Sbjct  80   PGLIPPEIGLLNKLVNLTLSGNNLTGGFPVEIAMLTSLRILNISNNVIAGNFPGKITLGM  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            A L+VLD+YNNN TG LP E+ K+ +L+H+HLGGN+FSG IP EY    +LEYL ++GN 
Sbjct  140  AQLEVLDVYNNNFTGALPTEIVKLKNLKHVHLGGNFFSGTIPEEYSEILSLEYLGLNGNA  199

Query  640  L  642
            L
Sbjct  200  L  200


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++  + FL  + I  N + G +P  I   ++L  ++ S N      P  +A+L
Sbjct  488  LSGEIPEEICGMKFLTKIDIRGNNIRGEIPASIFQCTSLTSVDFSQNSLSGGVPKTIAKL  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  LDL  N LTG LPVE+  M SL  L+L  N   GRIP
Sbjct  548  KDLSFLDLSRNQLTGQLPVEIGYMRSLTSLNLSYNNLFGRIP  589


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 65/122 (53%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +GQL  L +L +  N L+G +PPE+S + +L+ L+LS N      P   + 
Sbjct  248  NLDGEIPSTLGQLTHLHSLFLQVNNLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSD  307

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L ++++++L+ N L G +P       +L  L + GN F+  +P   GR   L  L VS N
Sbjct  308  LKDIELVNLFQNKLHGPIPEFFGDFPNLEVLQVWGNNFTFELPQNLGRNGKLMILDVSIN  367

Query  637  GL  642
             L
Sbjct  368  HL  369


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 61/117 (52%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G L  L  L +A+  L G +P  +  ++ L  L L  N      P +L+ L +
Sbjct  227  GSIPPEFGLLSNLELLDMASCNLDGEIPSTLGQLTHLHSLFLQVNNLTGHIPPELSGLIS  286

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ LDL  NNLTG++P     +  +  ++L  N   G IP  +G FPNLE L V GN
Sbjct  287  LKSLDLSINNLTGEIPESFSDLKDIELVNLFQNKLHGPIPEFFGDFPNLEVLQVWGN  343


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/121 (29%), Positives = 63/121 (52%), Gaps = 1/121 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L P++     L  LS++ N+++G +PP I  +  L+ L+L  N      P ++  +
Sbjct  441  FSGELPPEISG-DALGLLSVSNNRITGKIPPAIGNLKNLQTLSLDTNRLSGEIPEEICGM  499

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  +D+  NN+ G++P  +++ TSL  +    N  SG +P    +  +L +L +S N 
Sbjct  500  KFLTKIDIRGNNIRGEIPASIFQCTSLTSVDFSQNSLSGGVPKTIAKLKDLSFLDLSRNQ  559

Query  640  L  642
            L
Sbjct  560  L  560


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 69/147 (47%), Gaps = 25/147 (17%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G L  ++ +L  L ++ +  N  SG +P E S I +L +L L+ N      P  L++
Sbjct  151  NFTGALPTEIVKLKNLKHVHLGGNFFSGTIPEEYSEILSLEYLGLNGNALSGKVPSSLSR  210

Query  457  L-------------------------ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L                         +NL++LD+ + NL G++P  + ++T L  L L  
Sbjct  211  LKNLKSLCVGYFNRYEGSIPPEFGLLSNLELLDMASCNLDGEIPSTLGQLTHLHSLFLQV  270

Query  562  NYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            N  +G IPPE     +L+ L +S N L
Sbjct  271  NNLTGHIPPELSGLISLKSLDLSINNL  297


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 55/105 (52%), Gaps = 0/105 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L+ L ++ N L+G VP ++     L  L L NN F  + P ++ Q
Sbjct  344  NFTFELPQNLGRNGKLMILDVSINHLTGLVPRDLCKGGKLTTLILMNNFFLGSLPDEIGQ  403

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE  591
              +L  + + NN  +G +P  ++ +     + L  N+FSG +PPE
Sbjct  404  CKSLIKIRIMNNMFSGTIPAGMFNLPMATLVELSNNFFSGELPPE  448


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++  L  L +L ++ N L+G +P   S +  +  +NL  N      P     
Sbjct  272  NLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSDLKDIELVNLFQNKLHGPIPEFFGD  331

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              NL+VL ++ NN T +LP  + +   L  L +  N+ +G +P +  +   L  L +  N
Sbjct  332  FPNLEVLQVWGNNFTFELPQNLGRNGKLMILDVSINHLTGLVPRDLCKGGKLTTLILMNN  391


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +      L  +  +++  N+L GP+P        L  L +  N F    P  L +
Sbjct  296  NLTGEIPESFSDLKDIELVNLFQNKLHGPIPEFFGDFPNLEVLQVWGNNFTFELPQNLGR  355

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L +LD+  N+LTG +P ++ K   L  L L  N+F G +P E G+  +L  + +  N
Sbjct  356  NGKLMILDVSINHLTGLVPRDLCKGGKLTTLILMNNFFLGSLPDEIGQCKSLIKIRIMNN  415



>ref|XP_003558681.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1027

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = +1

Query  178  SLTSW-----NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  342
            +L SW     N S +HC W  VTC     VV LD+ GLNLSG L P + +L  L+ L + 
Sbjct  43   ALASWAAPKKNESAAHCAWAGVTCGPRGTVVGLDVGGLNLSGALPPALSRLRGLLRLDVG  102

Query  343  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  522
            AN   GPVP  +  +  L  LNLSNN F  + P  LA L  L+VLDLYNNNLT  LP+EV
Sbjct  103  ANAFFGPVPAALGHLQFLTHLNLSNNAFNGSLPPALACLRALRVLDLYNNNLTSPLPLEV  162

Query  523  YKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             +M  LRHLHLGGN+FSG+IPPEYGR+  L+YLAVSGN L
Sbjct  163  AQMPLLRHLHLGGNFFSGQIPPEYGRWARLQYLAVSGNEL  202


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE    + L++L +S N    T P +L  
Sbjct  153  NLTSPLPLEVAQMPLLRHLHLGGNFFSGQIPPEYGRWARLQYLAVSGNELSGTIPPELGN  212

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L L Y N+ +G LP E+  +T L  L       SG IPPE G+   L+ L +  
Sbjct  213  LTSLRELYLGYYNSYSGGLPAELGNLTELVRLDAANCGLSGEIPPELGKLQKLDTLFLQV  272

Query  634  NGL  642
            NGL
Sbjct  273  NGL  275


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG +P E+  + +L  L+LSNN+     P   ++L
Sbjct  251  LSGEIPPELGKLQKLDTLFLQVNGLSGSIPTELGYLKSLSSLDLSNNVLTGVIPASFSEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             N+ +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ + +S N 
Sbjct  311  KNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLVDLSSNK  370

Query  640  L  642
            L
Sbjct  371  L  371


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG +P EI  +  L   +LS+N      P ++ + 
Sbjct  468  LTGTLPASIGNFSGVQKLLLDRNSFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NNL+GD+P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  528  RLLTYLDLSRNNLSGDIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  587

Query  640  L  642
            L
Sbjct  588  L  588


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 60/120 (50%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+  ++G+L  L    +++N + G VPPEI     L +L+LS N      P  ++ 
Sbjct  491  SFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGKCRLLTYLDLSRNNLSGDIPPAISG  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P   G+F      +  GN
Sbjct  551  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVPVT-GQFSYFNATSFVGN  609


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 59/122 (48%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEIS-AISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   + +L  L  + +  N L+G  P  +  A   L  +NLSNN    T P  +  
Sbjct  419  LNGSIPKGLFELQKLTQVELQDNLLTGNFPAVVGVAAPNLGEINLSNNQLTGTLPASIGN  478

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             + +Q L L  N+ +G +P E+ ++  L    L  N   G +PPE G+   L YL +S N
Sbjct  479  FSGVQKLLLDRNSFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGKCRLLTYLDLSRN  538

Query  637  GL  642
             L
Sbjct  539  NL  540



>ref|XP_010266811.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
 ref|XP_010266812.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
Length=979

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 115/178 (65%), Gaps = 4/178 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+  ALL +K A      S L  WN+S+S   HC +  V+CD    VV+L++S + L G 
Sbjct  25   TDLDALLKLKTAMIGRRGSGLDDWNVSSSRNSHCLFSGVSCDENSRVVALNVSYVPLFGT  84

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  468
            +SP++G L  LVNL+++ N L+G +P EI+ +++L+ LN+SNN F    P  +A  L  +
Sbjct  85   VSPEIGLLNKLVNLTLSCNNLTGKLPEEIANLTSLKLLNISNNAFVGGVPEGIAGGLLEV  144

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            ++ D+YNNN TG LP  + K+  L+HLHLGGN+FSG IP  Y    +LEYL ++GNGL
Sbjct  145  EIFDIYNNNFTGRLPTGLVKLKRLKHLHLGGNFFSGEIPSVYSEIQSLEYLGLNGNGL  202


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 62/121 (51%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G + P +  L  L  LS+  N  SG +PPEI  +  L  +N+S+N      P  L   
Sbjct  466  ITGKIPPAIANLTNLRTLSLDVNLFSGEIPPEIFGLKMLSKINISSNNITGEIPIALGHC  525

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L  +D   NNL G +P E+ K+  L  L+L  N+ +G+IP E     +L  L +S N 
Sbjct  526  KSLSSVDFSRNNLFGRIPREIAKLEILSTLNLSRNHLTGQIPNEIRSMASLTILDLSYNK  585

Query  640  L  642
            L
Sbjct  586  L  586


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 68/122 (56%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +   +G+L  L  L +  N+LSG +P E+S + +L+ L+LSNN      P   ++
Sbjct  250  NLTGEIPASLGRLKLLHTLFLQLNKLSGLIPAELSGLVSLKSLDLSNNDLTGEIPESFSE  309

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L +++L+ N+L G +P  V ++  L  L + GN F+  +P   G    L+ + VS N
Sbjct  310  LKQLTLINLFRNHLRGRIPPFVAELPYLEVLQVWGNNFTFELPQNLGSNGMLKKIDVSIN  369

Query  637  GL  642
             L
Sbjct  370  HL  371


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 61/117 (52%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  + G L  L+ L + +  L+G +P  +  +  L  L L  N      P +L+ L +
Sbjct  229  GGIPTEFGSLSSLLILDMGSCNLTGEIPASLGRLKLLHTLFLQLNKLSGLIPAELSGLVS  288

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ LDL NN+LTG++P    ++  L  ++L  N+  GRIPP     P LE L V GN
Sbjct  289  LKSLDLSNNDLTGEIPESFSELKQLTLINLFRNHLRGRIPPFVAELPYLEVLQVWGN  345


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 59/104 (57%), Gaps = 0/104 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L+++ N+++G +PP I+ ++ LR L+L  N+F    P ++  L  L  +++ +NN+TG++
Sbjct  459  LTLSNNRITGKIPPAIANLTNLRTLSLDVNLFSGEIPPEIFGLKMLSKINISSNNITGEI  518

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            P+ +    SL  +    N   GRIP E  +   L  L +S N L
Sbjct  519  PIALGHCKSLSSVDFSRNNLFGRIPREIAKLEILSTLNLSRNHL  562


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G    L  + ++ N L+GP+PP + A   L  L L NN F    P +L  
Sbjct  346  NFTFELPQNLGSNGMLKKIDVSINHLTGPIPPRLCAGQRLETLILMNNYFLGPIPEELGD  405

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + L  N L G +P  ++ +  +  L L  N+F+G +P
Sbjct  406  CKSLTRVRLMKNFLNGTIPSGLFNLPLVDMLELNDNFFTGELP  448


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 66/147 (45%), Gaps = 25/147 (17%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G L   + +L  L +L +  N  SG +P   S I +L +L L+ N      P  L++
Sbjct  153  NFTGRLPTGLVKLKRLKHLHLGGNFFSGEIPSVYSEIQSLEYLGLNGNGLSGKIPATLSR  212

Query  457  LANLQ-------------------------VLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L+NL+                         +LD+ + NLTG++P  + ++  L  L L  
Sbjct  213  LSNLRELYIGYYSTYEGGIPTEFGSLSSLLILDMGSCNLTGEIPASLGRLKLLHTLFLQL  272

Query  562  NYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            N  SG IP E     +L+ L +S N L
Sbjct  273  NKLSGLIPAELSGLVSLKSLDLSNNDL  299



>gb|ABF99108.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=792

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 100/139 (72%), Gaps = 0/139 (0%)
 Frame = +1

Query  226  VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  405
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  406  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  586  PEYGRFPNLEYLAVSGNGL  642
            PEYGR+  ++YLAVSGN L
Sbjct  185  PEYGRWGRMQYLAVSGNEL  203


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  154  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGKIPPELGN  213

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N+ +G LP E+  +T L  L       SG IPPE G+  NL+ L +  
Sbjct  214  LTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQV  273

Query  634  NGL  642
            N L
Sbjct  274  NSL  276


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  564

Query  640  L  642
            L
Sbjct  565  L  565


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  594


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  469  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  528

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  529  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  588

Query  640  L  642
            L
Sbjct  589  L  589


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQL  343


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (48%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP   G   +L  + +  N
Sbjct  360  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGECKSLSRVRLGEN  418



>gb|AAP68887.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 gb|ABF99107.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 100/139 (72%), Gaps = 0/139 (0%)
 Frame = +1

Query  226  VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  405
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  406  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  586  PEYGRFPNLEYLAVSGNGL  642
            PEYGR+  ++YLAVSGN L
Sbjct  185  PEYGRWGRMQYLAVSGNEL  203


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  154  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGKIPPELGN  213

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N+ +G LP E+  +T L  L       SG IPPE G+  NL+ L +  
Sbjct  214  LTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQV  273

Query  634  NGL  642
            N L
Sbjct  274  NSL  276


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  564

Query  640  L  642
            L
Sbjct  565  L  565


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  469  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  528

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  529  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  588

Query  640  L  642
            L
Sbjct  589  L  589


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  610


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQL  343


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP   G   +L  + +  N 
Sbjct  360  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGECKSLSRVRLGENY  419

Query  640  L  642
            L
Sbjct  420  L  420



>gb|EAY92008.1| hypothetical protein OsI_13698 [Oryza sativa Indica Group]
Length=1029

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 100/139 (72%), Gaps = 0/139 (0%)
 Frame = +1

Query  226  VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  405
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  406  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  586  PEYGRFPNLEYLAVSGNGL  642
            PEYGR+  ++YLAVSGN L
Sbjct  185  PEYGRWGRMQYLAVSGNEL  203


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P   GR   L+ L +S N 
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNR  371

Query  640  L  642
            L
Sbjct  372  L  372


 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  154  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGKIPPELGN  213

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N+ +G LP E+  +T L  L       SG IPPE G+  NL+ L +  
Sbjct  214  LTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQV  273

Query  634  NGL  642
            N L
Sbjct  274  NSL  276


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  564

Query  640  L  642
            L
Sbjct  565  L  565


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  469  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  528

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  529  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  588

Query  640  L  642
            L
Sbjct  589  L  589


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  610


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQL  343


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP   G   +L  + +  N 
Sbjct  360  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIPDSLGECKSLSRVRLGENY  419

Query  640  L  642
            L
Sbjct  420  L  420



>ref|XP_002307734.1| receptor protein kinase [Populus trichocarpa]
 gb|EEE94730.1| receptor protein kinase [Populus trichocarpa]
Length=973

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 117/181 (65%), Gaps = 5/181 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  282
            G ++   LL +K +    + + L  W  S    T+HC +  VTCD    VVSL++S  +L
Sbjct  20   GYSDLEVLLKLKTSMYGHNGTGLQDWVASPASPTAHCYFSGVTCDEDSRVVSLNVSFRHL  79

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G + P++G L  LVNL+++ N L+G  P EI+ +++LR LN+SNN+    FP ++   +
Sbjct  80   PGSIPPEIGLLNKLVNLTLSGNNLTGGFPVEIAMLTSLRILNISNNVIAGNFPGKITLGM  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            A L+VLD+YNNN TG LP E+ K+ +L+H+HLGGN+FSG IP EY    +LEYL ++GN 
Sbjct  140  ALLEVLDVYNNNFTGALPTEIVKLKNLKHVHLGGNFFSGTIPEEYSEILSLEYLGLNGNA  199

Query  640  L  642
            L
Sbjct  200  L  200


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 63/117 (54%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G L  L  L +A+  L G +P  +S ++ L  L L  N      P +L+ L +
Sbjct  227  GSIPPEFGSLSNLELLDMASCNLDGEIPSALSQLTHLHSLFLQVNNLTGHIPPELSGLIS  286

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ LDL  NNLTG++P     + ++  ++L  N   G IP  +G FPNLE L V GN
Sbjct  287  LKSLDLSINNLTGEIPESFSDLKNIELINLFQNKLHGPIPEFFGDFPNLEVLQVWGN  343


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++  L  L  ++I AN + G +P  IS  ++L  ++ S N      P ++A+L
Sbjct  488  LSGEIPEEIWGLKSLTKINIRANNIRGEIPASISHCTSLTSVDFSQNSLSGEIPKKIAKL  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  LDL  N LTG LP E+  M SL  L+L  N   GRIP
Sbjct  548  NDLSFLDLSRNQLTGQLPGEIGYMRSLTSLNLSYNNLFGRIP  589


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 59/121 (49%), Gaps = 1/121 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +   +  LP    + ++ N  SG +PPEIS    L  L++SNN      P  +  L
Sbjct  417  FSGTIPAGIFNLPLATLVELSNNLFSGELPPEISG-DALGLLSVSNNRITGKIPPAIGNL  475

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NLQ L L  N L+G++P E++ + SL  +++  N   G IP       +L  +  S N 
Sbjct  476  KNLQTLSLDTNRLSGEIPEEIWGLKSLTKINIRANNIRGEIPASISHCTSLTSVDFSQNS  535

Query  640  L  642
            L
Sbjct  536  L  536


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 63/121 (52%), Gaps = 1/121 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L P++     L  LS++ N+++G +PP I  +  L+ L+L  N      P ++  L
Sbjct  441  FSGELPPEISG-DALGLLSVSNNRITGKIPPAIGNLKNLQTLSLDTNRLSGEIPEEIWGL  499

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L  +++  NN+ G++P  +   TSL  +    N  SG IP +  +  +L +L +S N 
Sbjct  500  KSLTKINIRANNIRGEIPASISHCTSLTSVDFSQNSLSGEIPKKIAKLNDLSFLDLSRNQ  559

Query  640  L  642
            L
Sbjct  560  L  560


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 65/122 (53%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +  +  ++  L  L +  N LSG VP  +S +  L+ L +   N +  + P +   
Sbjct  176  FSGTIPEEYSEILSLEYLGLNGNALSGKVPSSLSRLKNLKSLCVGYFNRYEGSIPPEFGS  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+NL++LD+ + NL G++P  + ++T L  L L  N  +G IPPE     +L+ L +S N
Sbjct  236  LSNLELLDMASCNLDGEIPSALSQLTHLHSLFLQVNNLTGHIPPELSGLISLKSLDLSIN  295

Query  637  GL  642
             L
Sbjct  296  NL  297


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 58/120 (48%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++  L  L +L ++ N L+G +P   S +  +  +NL  N      P     
Sbjct  272  NLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSDLKNIELINLFQNKLHGPIPEFFGD  331

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              NL+VL ++ NN T +LP  + +   L  L +  N+ +G +P +  +   L  L +  N
Sbjct  332  FPNLEVLQVWGNNFTFELPQNLGRNGKLMMLDVSINHLTGLVPRDLCKGGKLTTLILMNN  391


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L+ L ++ N L+G VP ++     L  L L NN F  + P ++ Q
Sbjct  344  NFTFELPQNLGRNGKLMMLDVSINHLTGLVPRDLCKGGKLTTLILMNNFFLGSLPDEIGQ  403

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE  591
              +L  + + NN  +G +P  ++ +     + L  N FSG +PPE
Sbjct  404  CKSLLKIRIMNNMFSGTIPAGIFNLPLATLVELSNNLFSGELPPE  448


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 57/120 (48%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +      L  +  +++  N+L GP+P        L  L +  N F    P  L +
Sbjct  296  NLTGEIPESFSDLKNIELINLFQNKLHGPIPEFFGDFPNLEVLQVWGNNFTFELPQNLGR  355

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L +LD+  N+LTG +P ++ K   L  L L  N+F G +P E G+  +L  + +  N
Sbjct  356  NGKLMMLDVSINHLTGLVPRDLCKGGKLTTLILMNNFFLGSLPDEIGQCKSLLKIRIMNN  415



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 115/176 (65%), Gaps = 4/176 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            + +  LS+K AF   + + L +WN S   S C+W  + CD +   VVSLD+S  N+SGV+
Sbjct  53   QASIFLSLKQAFYVPT-TCLDTWNESNFMSLCSWTGIQCDDMGSSVVSLDISNFNISGVI  111

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G+L  L+NLSIA N  SG  PPE+  +++LRFLN+SNN F  +     + L  L+V
Sbjct  112  SPAIGELQSLLNLSIAGNSFSGLFPPELHKLTSLRFLNISNNQFNGSLSWNFSSLRELEV  171

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LD+YNNN  G LP+ V ++  L+HL LGGNY SG+IPP YG    L YL+++GN L
Sbjct  172  LDVYNNNFFGSLPLGVTELPKLKHLDLGGNYISGKIPPSYGAMEELNYLSLAGNDL  227


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 62/123 (50%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N  G L   V +LP L +L +  N +SG +PP   A+  L +L+L+ N  G   P +L  
Sbjct  178  NFFGSLPLGVTELPKLKHLDLGGNYISGKIPPSYGAMEELNYLSLAGNDLGGLIPGELGN  237

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L NL+ L L Y N   G +P E  K+ +L HL L      G IPPE G    L+ L +  
Sbjct  238  LTNLKQLYLGYFNEFDGGIPPEFGKLVNLVHLDLSSCGLEGPIPPELGNLNKLDTLFLQT  297

Query  634  NGL  642
            N L
Sbjct  298  NQL  300


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 66/119 (55%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV+L +++  L GP+PPE+  ++ L  L L  N    + PHQ   L
Sbjct  252  FDGGIPPEFGKLVNLVHLDLSSCGLEGPIPPELGNLNKLDTLFLQTNQLSGSIPHQFGNL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            ++L+ LDL NN LTG++PVE  ++  L  LHL  N   G IP      P LE L +  N
Sbjct  312  SSLKSLDLSNNGLTGEIPVEFSELRELSLLHLFINKLHGEIPRFIAELPKLEVLKLWQN  370


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G  + D  ++P  L  L+++ N+LSG +P  I   S+L+ L L  N F    P +L +
Sbjct  468  LTGWFAEDPNKVPSKLGQLNLSNNRLSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGR  527

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  LD+  NNLTG +P ++     L +L L  N  SG IP +  +   L YL +S N
Sbjct  528  LKNLLKLDMSRNNLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWN  587

Query  637  GL  642
             L
Sbjct  588  HL  589


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  ++G+L  L+ L ++ N L+G +PP+I     L +L+LS N      P Q++Q+
Sbjct  517  FTGEIPSELGRLKNLLKLDMSRNNLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQI  576

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L++  N+L   LP E+  + SL       N FSGRI PE G+F      +  GN
Sbjct  577  HILNYLNISWNHLNQSLPKEIGAIKSLTSADFSHNDFSGRI-PESGQFAYFNSTSFVGN  634


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + PD+G    L  L ++ NQLSGP+P +IS I  L +LN+S N    + P ++  
Sbjct  540  NLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLPKEIGA  599

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +N+ +G +P
Sbjct  600  IKSLTSADFSHNDFSGRIP  618


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 57/121 (47%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   + +LP L  L +  N  +G +PP++     L  L+LS N      P  L   
Sbjct  348  LHGEIPRFIAELPKLEVLKLWQNNFTGTIPPKLGQNGKLTELDLSTNKLTGLVPRSLCLG  407

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L++L L NN L G LP ++    +L  + LG NY SG IP  +   P L  + +  N 
Sbjct  408  RKLRILILLNNFLFGPLPDDLGDCVTLLRVRLGQNYLSGSIPYGFLYLPELSLMELQNNY  467

Query  640  L  642
            L
Sbjct  468  L  468


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 70/171 (41%), Gaps = 49/171 (29%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNN-IFG--------  429
            N +G + P +GQ   L  L ++ N+L+G VP  +     LR L L NN +FG        
Sbjct  371  NFTGTIPPKLGQNGKLTELDLSTNKLTGLVPRSLCLGRKLRILILLNNFLFGPLPDDLGD  430

Query  430  ---------------STFPHQLAQLANLQVLDLYNNNLT---------------------  501
                            + P+    L  L +++L NN LT                     
Sbjct  431  CVTLLRVRLGQNYLSGSIPYGFLYLPELSLMELQNNYLTGWFAEDPNKVPSKLGQLNLSN  490

Query  502  ----GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
                G +P  +   +SL+ L LGGN F+G IP E GR  NL  L +S N L
Sbjct  491  NRLSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGRLKNLLKLDMSRNNL  541


 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G    L  L +  NQ +G +P E+  +  L  L++S N      P  +   
Sbjct  493  LSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGRLKNLLKLDMSRNNLTGRIPPDIGNC  552

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNL  612
              L  LDL  N L+G +PV++ ++  L +L++  N+ +  +P E G   +L
Sbjct  553  LLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLPKEIGAIKSL  603


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 51/106 (48%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  +  +L  L  L +  N+L G +P  I+ +  L  L L  N F  T P +L Q 
Sbjct  324  LTGEIPVEFSELRELSLLHLFINKLHGEIPRFIAELPKLEVLKLWQNNFTGTIPPKLGQN  383

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYG  597
              L  LDL  N LTG +P  +     LR L L  N+  G +P + G
Sbjct  384  GKLTELDLSTNKLTGLVPRSLCLGRKLRILILLNNFLFGPLPDDLG  429



>ref|XP_001752668.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ82539.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=992

 Score =   142 bits (357),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 118/175 (67%), Gaps = 3/175 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALL++K++F AD Q+ L +W +  + + C W  +TC +   VV L+LS +NL+G L 
Sbjct  12   EGLALLAMKSSF-ADPQNHLENWKLNGTATPCLWTGITCSNASSVVGLNLSNMNLTGTLP  70

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             D+G+L  LVN+S+  N  +G +P EI  +  L+++N+SNN F   FP  +++L +L+VL
Sbjct  71   ADLGRLKNLVNISLDLNNFTGVLPAEIVTLLMLQYVNISNNRFNGAFPANVSRLQSLKVL  130

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            D +NN+ +G LP +++ + +L HL LGGNYF G IP +YG FP L+YL ++GN L
Sbjct  131  DCFNNDFSGSLPDDLWIIATLEHLSLGGNYFEGSIPSQYGSFPALKYLGLNGNSL  185


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 61/122 (50%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLS  L   +G LP L +  IA N  SGP+PP+I  + +L  L+LS N      P +++ 
Sbjct  449  NLSSKLPESIGNLPTLQSFLIANNHFSGPIPPQICDMQSLNKLDLSGNELTGLIPQEMSN  508

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L  LD   N LTG++P ++  +  L  L+L  N  SG IPP+      L     S N
Sbjct  509  CKKLGSLDFSRNGLTGEIPPQIEYIPDLYLLNLSHNQLSGHIPPQLQMLQTLNVFDFSYN  568

Query  637  GL  642
             L
Sbjct  569  NL  570


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 55/110 (50%), Gaps = 0/110 (0%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            LP +  + I  NQ+ GP+P EI     L +L+ SNN   S  P  +  L  LQ   + NN
Sbjct  413  LPNITMVEIQMNQIMGPIPSEIIDSPKLSYLDFSNNNLSSKLPESIGNLPTLQSFLIANN  472

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            + +G +P ++  M SL  L L GN  +G IP E      L  L  S NGL
Sbjct  473  HFSGPIPPQICDMQSLNKLDLSGNELTGLIPQEMSNCKKLGSLDFSRNGL  522


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/121 (34%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L GV+   +G L  LV+L ++ N LSG +PP +  +  L  L+L +N F    P  +  +
Sbjct  258  LVGVIPVQIGNLVNLVSLDLSYNNLSGIIPPALIYLQKLELLSLMSNNFEGEIPDFIGDM  317

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NLQVL L+ N LTG +P  + +  +L  L L  N+ +G IP +      L+++ +  N 
Sbjct  318  PNLQVLYLWANKLTGPIPEALGQNMNLTLLDLSSNFLNGTIPSDLCAGQKLQWVILKDNQ  377

Query  640  L  642
            L
Sbjct  378  L  378


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 57/122 (47%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N S  +    G L  LV L +    L+G +PPE+  +  L  + L  N      P Q+  
Sbjct  209  NYSSGIPATFGNLTSLVRLDMGRCGLTGTIPPELGNLGNLDSMFLQLNELVGVIPVQIGN  268

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  LDL  NNL+G +P  +  +  L  L L  N F G IP   G  PNL+ L +  N
Sbjct  269  LVNLVSLDLSYNNLSGIIPPALIYLQKLELLSLMSNNFEGEIPDFIGDMPNLQVLYLWAN  328

Query  637  GL  642
             L
Sbjct  329  KL  330


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 56/120 (47%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N  G +   +G +P L  L + AN+L+GP+P  +     L  L+LS+N    T P  L  
Sbjct  305  NFEGEIPDFIGDMPNLQVLYLWANKLTGPIPEALGQNMNLTLLDLSSNFLNGTIPSDLCA  364

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               LQ + L +N LTG +P       SL  + L  N  +G IP      PN+  + +  N
Sbjct  365  GQKLQWVILKDNQLTGPIPENFGNCLSLEKIRLSNNLLNGSIPLGLLGLPNITMVEIQMN  424


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = +1

Query  316  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNN  495
            P L  L  + N LS  +P  I  + TL+   ++NN F    P Q+  + +L  LDL  N 
Sbjct  438  PKLSYLDFSNNNLSSKLPESIGNLPTLQSFLIANNHFSGPIPPQICDMQSLNKLDLSGNE  497

Query  496  LTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LTG +P E+     L  L    N  +G IPP+    P+L  L +S N L
Sbjct  498  LTGLIPQEMSNCKKLGSLDFSRNGLTGEIPPQIEYIPDLYLLNLSHNQL  546


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            +  NQL+GP+P       +L  + LSNN+   + P  L  L N+ ++++  N + G +P 
Sbjct  373  LKDNQLTGPIPENFGNCLSLEKIRLSNNLLNGSIPLGLLGLPNITMVEIQMNQIMGPIPS  432

Query  517  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            E+     L +L    N  S ++P   G  P L+   ++ N
Sbjct  433  EIIDSPKLSYLDFSNNNLSSKLPESIGNLPTLQSFLIANN  472


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 57/122 (47%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
              G +    G  P L  L +  N L+GP+PPE+  +  L+ L +   N + S  P     
Sbjct  161  FEGSIPSQYGSFPALKYLGLNGNSLTGPIPPELGKLQALQELYMGYFNNYSSGIPATFGN  220

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L  LD+    LTG +P E+  + +L  + L  N   G IP + G   NL  L +S N
Sbjct  221  LTSLVRLDMGRCGLTGTIPPELGNLGNLDSMFLQLNELVGVIPVQIGNLVNLVSLDLSYN  280

Query  637  GL  642
             L
Sbjct  281  NL  282


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G++  ++     L +L  + N L+G +PP+I  I  L  LNLS+N      P QL  L
Sbjct  498  LTGLIPQEMSNCKKLGSLDFSRNGLTGEIPPQIEYIPDLYLLNLSHNQLSGHIPPQLQML  557

Query  460  ANLQVLDLYNNNLTGDLP  513
              L V D   NNL+G +P
Sbjct  558  QTLNVFDFSYNNLSGPIP  575



>gb|EEE60014.1| hypothetical protein OsJ_12761 [Oryza sativa Japonica Group]
Length=979

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+
Sbjct  56   NLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYLNLSNNAFNGSFPAALAR  115

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IPPEYGR+  ++YLAVSGN
Sbjct  116  LRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGN  175

Query  637  GL  642
             L
Sbjct  176  EL  177


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 64/123 (52%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  128  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGKIPPELGN  187

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L +L+ L + Y N+ +G LP E+  +T L  L       SG IPPE G+  NL+ L +  
Sbjct  188  LTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQV  247

Query  634  NGL  642
            N L
Sbjct  248  NSL  250


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 66/121 (55%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  226  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  285

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL +L+L+ N L GD+P  V  + SL  L L  N  +G +PPE      +  L   GN 
Sbjct  286  KNLTLLNLFRNKLRGDIPDFVGDLPSLELLDLSSNRLTGTLPPELCAGGKMHTLIALGNF  345

Query  640  L  642
            L
Sbjct  346  L  346


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 63/121 (52%), Gaps = 6/121 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  401  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP       L YL +S N 
Sbjct  455  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNH  514

Query  640  L  642
            L
Sbjct  515  L  515


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  419  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP      +L  +  S N 
Sbjct  479  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNN  538

Query  640  L  642
            L
Sbjct  539  L  539


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  203  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  262

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP   G  P+LE L +S N L
Sbjct  263  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLELLDLSSNRL  322


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 61/120 (51%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  442  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  501

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +  L  L+L  N+L G++P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  502  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLV-PGTGQFSYFNATSFVGN  560



>gb|AAF73373.1|AF193835_1 LRK1 protein [Oryza sativa]
Length=970

 Score =   139 bits (351),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            VLDLYNNNLTG LP+EV  +  LRHLHLGGN FSG IPPEYG   + +YLA+
Sbjct  146  VLDLYNNNLTGALPLEVVSLRKLRHLHLGGNIFSGGIPPEYGHGGSFKYLAL  197


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 60/123 (49%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP     
Sbjct  397  SLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDNLISGGFPAVSGT  456

Query  457  LA-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
             A NL  + L NN LTG LP  +   + ++ L L  N F+G IPPE GR   L    +SG
Sbjct  457  GAPNLGQISLSNNQLTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSG  516

Query  634  NGL  642
            N L
Sbjct  517  NSL  519


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = +1

Query  304  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  483
            VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L     L+ L  
Sbjct  334  VGDLPSLEVLQLWENNFTGGMPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIA  393

Query  484  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              N+L G +P  + K TSL  + LG NY +G IP      PNL  + +  N
Sbjct  394  LGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIPEGLFELPNLTQVELQDN  444


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A + 
Sbjct  521  TGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQ  580

Query  463  NLQVLDLYNNNLTGDLPV  516
            +L  +D   NNL+G +P 
Sbjct  581  SLTAVDFSYNNLSGLVPA  598


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (47%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST-FPHQLAQ  456
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N   +   P ++ +
Sbjct  471  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSLPTGGVPPEIGK  530

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
               L  LDL  NNL+G++P  +  M  L +L+L  N   G IP       +L  +  S N
Sbjct  531  CRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYN  590

Query  637  GL  642
             L
Sbjct  591  NL  592


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/148 (28%), Positives = 63/148 (43%), Gaps = 27/148 (18%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  399
            LSG + P++G L  L  L +  N L+G +P E+  +++L+                    
Sbjct  251  LSGEIPPELGNLANLDTLFLRVNGLAGGIPRELGKLASLQPKVDLSKKGLAGEDPAKVRR  310

Query  400  ------FLNLSNNIFGSTFPHQ-LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG  558
                   LNL  N      P   +  L +L+VL L+ NN TG +P  + +    + L L 
Sbjct  311  LQRTFTLLNLFRNKLQGDIPEAFVGDLPSLEVLQLWENNFTGGMPRRLGRNGRFQLLDLS  370

Query  559  GNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             N  +G +PP+      LE L   GN L
Sbjct  371  SNRLTGTLPPDLCAGGKLETLIALGNSL  398



>ref|XP_008357152.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=837

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 111/170 (65%), Gaps = 1/170 (1%)
 Frame = +1

Query  136  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  315
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  316  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQVLDLYNN  492
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            N TG LPVE+  + +L+HL LGGN+ +G IP  Y    +LEYL V+GN L
Sbjct  153  NFTGTLPVELVSLKNLKHLQLGGNFITGEIPENYSEIQSLEYLGVNGNML  202


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+ +++LY NNL G +P  +     L  L +  N F+  +P   GR   L+ L V+G 
Sbjct  310  LKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGX  369

Query  637  GL  642
             L
Sbjct  370  HL  371


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 64/111 (58%), Gaps = 2/111 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            LSG + P++  L  L++L ++ N+LSG +P   S +  +  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPELSALNRLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGP-IPKFIGD  333

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPN  609
              +L+VL ++ NN T +LP  + +   L+ L + G + +G IP ++ + P+
Sbjct  334  FPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGXHLTGLIPRDFRKIPD  384


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 61/118 (52%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG + P++G L  L  L + +  L GP+P  +S +  L  L L  N    + P +L+ L 
Sbjct  228  SGGIPPELGSLSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALN  287

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             L  LDL  N L+G++P    ++ ++  ++L  N   G IP   G FP+LE L +  N
Sbjct  288  RLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWEN  345


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 61/127 (48%), Gaps = 8/127 (6%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSG-------PVPPEISAISTLRFLNLSNNIFGST  435
            N +  L  ++G+   L  L +    L+G        +P  IS  S+L   +LS N     
Sbjct  346  NFTFELPENLGRNGRLKELDVTGXHLTGLIPRDFRKIPDSISRCSSLTSADLSQNNLVGE  405

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  615
             P  +A+L  L +L+   N LTG++P E+  MTSL  L L  N F GRIP   G+F    
Sbjct  406  IPKGIAKLKVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSDNNFVGRIPTG-GQFLVFN  464

Query  616  YLAVSGN  636
              + SGN
Sbjct  465  DTSFSGN  471


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
            ++G +  +  ++  L  L +  N LSG VP  +S +  LR L +   N +    P +L  
Sbjct  178  ITGEIPENYSEIQSLEYLGVNGNMLSGRVPASLSRLKNLRELYVGYYNSYSGGIPPELGS  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L++LQ+LD+ + NL G +P  +  +  L  L L  N  SG IPPE      L  L +S N
Sbjct  238  LSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSIN  297

Query  637  GL  642
             L
Sbjct  298  EL  299



>ref|XP_009418700.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Musa acuminata subsp. malaccensis]
Length=993

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNLSGV  291
            G  +  AL+ +KAA  A   S+L +W+  S  +C++  V CD    VV+L+ +G+ L+G 
Sbjct  24   GDADLEALIKLKAALVAPGSSALGNWDPASADYCSFTGVACDENSRVVALNFTGVQLNGT  83

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH-QLAQLANL  468
            L P++G L  LVNL+++ + + GP+P E++A+ +LR LN+SNN F   FPH        L
Sbjct  84   LPPEIGILSGLVNLTVSCSGVVGPLPMELAALPSLRLLNVSNNNFSGAFPHVGPGGFPTL  143

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            +V+D YNNN +G LP+ +    SLR+LHLGGNYF+G IP EY    NLEYL ++GN L
Sbjct  144  EVIDAYNNNFSGRLPLGLAAAPSLRYLHLGGNYFNGTIPKEYSDIKNLEYLGLNGNAL  201


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 70/121 (58%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G + P +G LP L NL++ +NQ+SG +PPEI  +  L  LNLS N      P  L + 
Sbjct  465  ITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDIPVDLTRC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            ++L ++DL  NNLTG +PV +  +  L  L+L  N  SG IPPE  R  +L    +S N 
Sbjct  525  SSLVMIDLSRNNLTGAIPVRIPALQILNTLNLSRNQISGVIPPEMQRMRSLTIFDLSYNR  584

Query  640  L  642
            L
Sbjct  585  L  585


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 62/108 (57%), Gaps = 1/108 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG + P++GQL  L  L+++ N LSG +P +++  S+L  ++LS N      P ++  L
Sbjct  489  ISGAIPPEIGQLKQLSKLNLSGNSLSGDIPVDLTRCSSLVMIDLSRNNLTGAIPVRIPAL  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRF  603
              L  L+L  N ++G +P E+ +M SL    L  N  +G IP + G+F
Sbjct  549  QILNTLNLSRNQISGVIPPEMQRMRSLTIFDLSYNRLAGVIPAQ-GQF  595


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 62/117 (53%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV L +A   LSGP+P  + ++  L  L L  N    + P +L  L+ 
Sbjct  228  GGIPPELGMLSSLVRLDMAGCGLSGPIPASLGSLKHLDTLFLQINRLSGSIPPELGGLSM  287

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ LDL  N LTG++P    ++  L+ L L  N+  G IPP     PNLE L +  N
Sbjct  288  LESLDLSINELTGEVPESFAELKELKLLSLFRNHIRGAIPPFVAELPNLEVLELWEN  344


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L +L ++ N+L+G VP   + +  L+ L+L  N      P  +A+L
Sbjct  274  LSGSIPPELGGLSMLESLDLSINELTGEVPESFAELKELKLLSLFRNHIRGAIPPFVAEL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NL+VL+L+ NN T  LP  + +   L  L +  N  +G IPP+      LE L +  NG
Sbjct  334  PNLEVLELWENNFTMQLPESLGRNGRLLKLDVASNRITGTIPPDLCASGRLETLVLMENG  393

Query  640  L  642
             
Sbjct  394  F  394


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 56/97 (58%), Gaps = 3/97 (3%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L+++ N ++G +PP I ++  L+ L L +N      P ++ QL  L  L+L  N+L+GD+
Sbjct  458  LALSNNLITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDI  517

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYL  621
            PV++ + +SL  + L  N  +G IP    R P L+ L
Sbjct  518  PVDLTRCSSLVMIDLSRNNLTGAIPV---RIPALQIL  551


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 57/119 (48%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G + PD+     L  L +  N   GP+P ++    +L  + L+ N    + P  L  L
Sbjct  370  ITGTIPPDLCASGRLETLVLMENGFFGPIPEKLGECKSLTRVRLAKNFLNGSIPAGLFDL  429

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +  +L+L  N L+GDLP  V     L  L L  N  +G IPP  G  P L+ LA+  N
Sbjct  430  PSNDMLELSENFLSGDLP-PVIAGNKLGMLALSNNLITGSIPPAIGSLPALQNLALDSN  487


 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/119 (33%), Positives = 60/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +   +G+   L  + +A N L+G +P  +  + +   L LS N      P  +A    
Sbjct  396  GPIPEKLGECKSLTRVRLAKNFLNGSIPAGLFDLPSNDMLELSENFLSGDLPPVIAG-NK  454

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L +L L NN +TG +P  +  + +L++L L  N  SG IPPE G+   L  L +SGN L
Sbjct  455  LGMLALSNNLITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSL  513



>ref|XP_008364929.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=973

 Score =   139 bits (350),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 111/170 (65%), Gaps = 1/170 (1%)
 Frame = +1

Query  136  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  315
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  316  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQVLDLYNN  492
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            N TG LPVE+  + +L+HL LGGN+ +G IP  Y    +LEYL V+GN L
Sbjct  153  NFTGTLPVELVSLKNLKHLQLGGNFITGEIPENYSEIQSLEYLGVNGNML  202


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 65/122 (53%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+ +++LY NNL G +P  +     L  L +  N F+  +P   GR   L+ L V+GN
Sbjct  310  LKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGN  369

Query  637  GL  642
             L
Sbjct  370  HL  371


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++  L  L  ++I+AN     +P  IS  S+L   +LS N      P  +A+L
Sbjct  490  FSGEIPSEIFDLKLLSRINISANNJGRKIPDSISRCSSLTSADLSQNNLVGEIPKGIAKL  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L +L+   N LTG++P E+  MTSL  L L  N F GRIP   G+F      + SGN
Sbjct  550  KVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSDNNFVGRIPTG-GQFLVFNDTSFSGN  607


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG + P  G L  L  L +  N  SG +P EI  +  L  +N+S N  G   P  +++
Sbjct  465  HLSGKIPPAXGNLKSLQTLXLEMNGFSGEIPSEIFDLKLLSRINISANNJGRKIPDSISR  524

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             ++L   DL  NNL G++P  + K+  L  L+   N  +G IP E     +L  L +S N
Sbjct  525  CSSLTSADLSQNNLVGEIPKGIAKLKVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSDN  584


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 64/113 (57%), Gaps = 2/113 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            LSG + P++  L  L++L ++ N+LSG +P   S +  +  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPELSALNRLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGP-IPKFIGD  333

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  615
              +L+VL ++ NN T +LP  + +   L+ L + GN+ +G IP +     NL+
Sbjct  334  FPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGNHLTGLIPRDLCTGGNLK  386


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 0/115 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG + P++G L  L  L + +  L GP+P  +S +  L  L L  N    + P +L+ L 
Sbjct  228  SGGIPPELGSLSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALN  287

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
             L  LDL  N L+G++P    ++ ++  ++L  N   G IP   G FP+LE L +
Sbjct  288  RLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGPIPKFIGDFPHLEVLQI  342


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+     L    +  N   GP+P E+   ++L  + +  N    T P  +  
Sbjct  370  HLTGLIPRDLCTGGNLKTAILMENHFFGPIPEELGRCNSLTKIRMMKNSLSGTIPAGIFS  429

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +++L +N L+G+LP E     ++  L L GN+ SG+IPP  G   +L+ L +  N
Sbjct  430  LPNLIMIELNDNFLSGELP-EQMSGGNIGILTLSGNHLSGKIPPAXGNLKSLQTLXLEMN  488

Query  637  GL  642
            G 
Sbjct  489  GF  490


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
            ++G +  +  ++  L  L +  N LSG VP  +S +  LR L +   N +    P +L  
Sbjct  178  ITGEIPENYSEIQSLEYLGVNGNMLSGRVPASLSRLKNLRELYVGYYNSYSGGIPPELGS  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L++LQ+LD+ + NL G +P  +  +  L  L L  N  SG IPPE      L  L +S N
Sbjct  238  LSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSIN  297

Query  637  GL  642
             L
Sbjct  298  EL  299



>ref|XP_007017845.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY15070.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 115/180 (64%), Gaps = 4/180 (2%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  285
            G ++   LL +K++      S L  W  S+S   HC +  V CD   HVVSL+ S   LS
Sbjct  25   GYSDLEVLLKLKSSMIGPKGSGLEDWEFSSSPSAHCHFSGVQCDEEFHVVSLNASFAPLS  84

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLA  462
            G + P++G L  LVNL+IAA  L+G +P E+  +++L+  N+SNN+F  +FP + L  + 
Sbjct  85   GTIPPEIGLLNKLVNLTIAAANLTGKIPVEMGNLTSLKLFNISNNVFKGSFPGEILTGMT  144

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L++LD YNNN TG LP+EV  +T+++HL LGGN+F+G IP +Y    +LEYL ++G GL
Sbjct  145  ELEILDAYNNNFTGLLPIEVANLTNIKHLCLGGNFFTGEIPEKYSDIQSLEYLGLNGIGL  204


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 63/120 (53%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++  +  L  ++I+ N ++G +PP IS  ++L  ++ S N      P  + +
Sbjct  491  KFSGEIPEEIFNIKLLSKINISDNSITGEIPPSISRCTSLTSIDFSQNSLTGEIPKGIEK  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L +L +L+   N LTG++P E+  M SL  L L  N F GRI P  G+F      + +GN
Sbjct  551  LKDLSILNFSRNQLTGEIPGEIRYMISLTTLDLSYNNFVGRI-PSGGQFSVFNDTSFTGN  609


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 61/117 (52%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G L  L  L +A+  L+G +P  +S +  L  L L  N      P +L+ L +
Sbjct  231  GEIPPEFGTLSQLQVLDMASCNLTGEIPVSLSNLKHLHTLFLQLNRLTGRIPSELSGLIS  290

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L+ LDL  N LTG++P     + ++  +HL  N   G IP   G FP+LE L V GN
Sbjct  291  LKSLDLSINELTGEIPESFSALQNITLIHLFKNNLYGPIPSFVGDFPHLEVLQVWGN  347


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 63/121 (52%), Gaps = 1/121 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N  SG +P ++S  ++L  L +SNN      P  ++ L
Sbjct  421  LNGTIPAGIFNLPLLSIVELNDNFFSGELPTQMSG-ASLGQLKVSNNWITGKIPPAISNL  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             NLQVL L  N  +G++P E++ +  L  +++  N  +G IPP   R  +L  +  S N 
Sbjct  480  RNLQVLSLEMNKFSGEIPEEIFNIKLLSKINISDNSITGEIPPSISRCTSLTSIDFSQNS  539

Query  640  L  642
            L
Sbjct  540  L  540


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G + P +  L  L  LS+  N+ SG +P EI  I  L  +N+S+N      P  +++ 
Sbjct  468  ITGKIPPAISNLRNLQVLSLEMNKFSGEIPEEIFNIKLLSKINISDNSITGEIPPSISRC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  +D   N+LTG++P  + K+  L  L+   N  +G IP E     +L  L +S N
Sbjct  528  TSLTSIDFSQNSLTGEIPKGIEKLKDLSILNFSRNQLTGEIPGEIRYMISLTTLDLSYN  586


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 67/147 (46%), Gaps = 25/147 (17%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-------------  417
            N +G+L  +V  L  + +L +  N  +G +P + S I +L +L L+              
Sbjct  155  NFTGLLPIEVANLTNIKHLCLGGNFFTGEIPEKYSDIQSLEYLGLNGIGLTGKSPAFLAR  214

Query  418  ------------NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                        N +    P +   L+ LQVLD+ + NLTG++PV +  +  L  L L  
Sbjct  215  LKNLKEMYIGYFNAYVGEIPPEFGTLSQLQVLDMASCNLTGEIPVSLSNLKHLHTLFLQL  274

Query  562  NYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            N  +GRIP E     +L+ L +S N L
Sbjct  275  NRLTGRIPSELSGLISLKSLDLSINEL  301


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 56/107 (52%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  L ++ N ++G +PP IS +  L+ L+L  N F    P ++  +  L  +++ +N++T
Sbjct  458  LGQLKVSNNWITGKIPPAISNLRNLQVLSLEMNKFSGEIPEEIFNIKLLSKINISDNSIT  517

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G++P  + + TSL  +    N  +G IP    +  +L  L  S N L
Sbjct  518  GEIPPSISRCTSLTSIDFSQNSLTGEIPKGIEKLKDLSILNFSRNQL  564


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/120 (27%), Positives = 62/120 (52%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++   + +   L  L +  N   GP+P E+   ++L  + +  N+   T P  +  
Sbjct  372  HLTGLIPRHLCEGGRLETLILMDNFFFGPLPRELGNCTSLTKIRIMKNLLNGTIPAGIFN  431

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L +++L +N  +G+LP ++    SL  L +  N+ +G+IPP      NL+ L++  N
Sbjct  432  LPLLSIVELNDNFFSGELPTQM-SGASLGQLKVSNNWITGKIPPAISNLRNLQVLSLEMN  490


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 62/120 (52%), Gaps = 2/120 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            L+G +  ++  L  L +L ++ N+L+G +P   SA+  +  ++L  NN++G   P  +  
Sbjct  277  LTGRIPSELSGLISLKSLDLSINELTGEIPESFSALQNITLIHLFKNNLYGP-IPSFVGD  335

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              +L+VL ++ NN T +LP  + +   L  L +  N+ +G IP        LE L +  N
Sbjct  336  FPHLEVLQVWGNNFTRELPENLGRNGKLFKLDVTSNHLTGLIPRHLCEGGRLETLILMDN  395



>ref|XP_009399076.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1021

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 103/173 (60%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  303
            E  ALLS+K+  + +  ++L +W  +T HC+W  VTC S   VV+LDLSG NLSG L P 
Sbjct  28   EHRALLSLKSELS-NPGAALAAWEAATDHCSWPGVTCGSSGAVVALDLSGRNLSGPLPPA  86

Query  304  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  483
            VG+L  L+ LS+AAN LSGP+PPE++ +  LR LNLSNN+   +FP  LA+LA+L++LDL
Sbjct  87   VGRLRSLLRLSVAANFLSGPIPPELALLPDLRHLNLSNNLLNGSFPVALARLADLRLLDL  146

Query  484  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            YNNNLTG LP EV  MT LRHLHLGGN+FSG IPPEYG +  LEYLA+SGN L
Sbjct  147  YNNNLTGPLPQEVAAMTLLRHLHLGGNFFSGSIPPEYGHWQFLEYLAISGNEL  199


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 64/121 (53%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L ++ ++ N L+G +PP  S +S L  LNL  N    T P  +  L
Sbjct  272  LSGEIPPELGRLRSLKSMDLSNNALTGQIPPSFSGLSNLTLLNLFRNKLFGTIPEFVGDL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L+VL ++ NN TG +P  +     L+ L L  N  +G +PP+      LE L   GN 
Sbjct  332  PELEVLQMWENNFTGSIPRRLGTNGQLQLLDLSSNKLTGSLPPDLCYGNKLETLIALGNF  391

Query  640  L  642
            L
Sbjct  392  L  392


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   + L
Sbjct  248  LSGGIPSEMGNLRNLDTLFLQVNGLSGEIPPELGRLRSLKSMDLSNNALTGQIPPSFSGL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
            +NL +L+L+ N L G +P  V  +  L  L +  N F+G IP   G    L+ L +S N 
Sbjct  308  SNLTLLNLFRNKLFGTIPEFVGDLPELEVLQMWENNFTGSIPRRLGTNGQLQLLDLSSNK  367

Query  640  L  642
            L
Sbjct  368  L  368


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 59/120 (49%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG + P+V +L  L  L  + N+ SGP+ PEIS    L F++LS N      P  +A 
Sbjct  489  SFSGSIPPEVRRLQQLSKLDFSGNRFSGPITPEISKCKLLTFVDLSRNEISGNVPSDIAA  548

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L  L+L  N+L G +P  +  M SL  +    N  SG + P  G+F      +  GN
Sbjct  549  LRILNYLNLSRNHLEGQIPSAISTMQSLTAVDFSYNNLSGLV-PSTGQFSYFNATSFVGN  607


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 58/114 (51%), Gaps = 0/114 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  L+ L  A   LSG +P E+  +  L  L L  N      P +L +L +
Sbjct  226  GGVPPEIGNLSALLRLDAANCGLSGGIPSEMGNLRNLDTLFLQVNGLSGEIPPELGRLRS  285

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L+ +DL NN LTG +P     +++L  L+L  N   G IP   G  P LE L +
Sbjct  286  LKSMDLSNNALTGQIPPSFSGLSNLTLLNLFRNKLFGTIPEFVGDLPELEVLQM  339


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 57/118 (48%), Gaps = 3/118 (3%)
 Frame = +1

Query  298  PDVGQL---PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            PD G     P L  + ++ N+L GP+PP I   S L+ L LS N F  + P ++ +L  L
Sbjct  445  PDTGDSSISPSLGQICLSNNRLVGPLPPSIGNFSGLQKLLLSQNSFSGSIPPEVRRLQQL  504

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
              LD   N  +G +  E+ K   L  + L  N  SG +P +      L YL +S N L
Sbjct  505  SKLDFSGNRFSGPITPEISKCKLLTFVDLSRNEISGNVPSDIAALRILNYLNLSRNHL  562


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 57/146 (39%), Gaps = 26/146 (18%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L G +P  +    +L  + + +N    + PH L  
Sbjct  367  KLTGSLPPDLCYGNKLETLIALGNFLFGSIPESLGRCESLSRIRMGDNYLNGSIPHGLFS  426

Query  457  LANLQVLD--------------------------LYNNNLTGDLPVEVYKMTSLRHLHLG  558
            L NL  ++                          L NN L G LP  +   + L+ L L 
Sbjct  427  LPNLSQVEFQDNLLTGGFPDTGDSSISPSLGQICLSNNRLVGPLPPSIGNFSGLQKLLLS  486

Query  559  GNYFSGRIPPEYGRFPNLEYLAVSGN  636
             N FSG IPPE  R   L  L  SGN
Sbjct  487  QNSFSGSIPPEVRRLQQLSKLDFSGN  512



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 107/176 (61%), Gaps = 5/176 (3%)
 Frame = +1

Query  127  QAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            QA++L S+K  F A S  SL+SWN+S     C+W  + CD+L   V        NLSG L
Sbjct  29   QASILASVKQGFEA-SDPSLSSWNVSNYKFLCSWAGIMCDNLSRSVISLDVSNYNLSGSL  87

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+ +L  LVNLS++ N  SG  P  I  +  L++LN+SNN FG +   + AQL  L +
Sbjct  88   SPDITELRTLVNLSVSGNDFSGSFPAGIHKLPRLQYLNISNNGFGGSMDWEFAQLKELIL  147

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LD YNN+  G LP+ V ++  L+ L  GGNYFSG IPP YG    L YL+V+GN L
Sbjct  148  LDAYNNDFNGSLPLGVTQLPKLKRLDFGGNYFSGSIPPSYGNMSQLNYLSVAGNDL  203


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 61/123 (50%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G L   V QLP L  L    N  SG +PP    +S L +L+++ N      P +L  
Sbjct  154  DFNGSLPLGVTQLPKLKRLDFGGNYFSGSIPPSYGNMSQLNYLSVAGNDLSGFIPSELGN  213

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L NL  L L Y N+  G +P E+ K+T+L HL L      G IPPE G    L+ L +  
Sbjct  214  LTNLTQLFLGYYNDFDGGIPPEIGKLTNLFHLDLANCGLEGSIPPELGNLKKLDTLFLQT  273

Query  634  NGL  642
            N L
Sbjct  274  NQL  276


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G+L  L +L +A   L G +PPE+  +  L  L L  N    + P QL  
Sbjct  227  DFDGGIPPEIGKLTNLFHLDLANCGLEGSIPPELGNLKKLDTLFLQTNQLSGSIPAQLGN  286

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L++L+ LDL NN LTGD+PVE   +  L  L+L  N F G IP E    PNLE L +  N
Sbjct  287  LSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIAELPNLEVLKLWQN  346


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 58/107 (54%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  L++++N+LSG  P  I   S+L+ L LS N F    P  + +L N+  LD+  NN +
Sbjct  460  LSQLNLSSNRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMSRNNFS  519

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +P E+   T L +L L  N  SG IPP+  +   L Y  VS N L
Sbjct  520  GSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSWNHL  566


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH++A+L
Sbjct  276  LSGSIPAQLGNLSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIAEL  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE--YGR  600
             NL+VL L+ NN TG +P ++ +   L  L L  N  +G +P    +GR
Sbjct  336  PNLEVLKLWQNNFTGAIPSKLGQNGKLVELDLSTNKLTGEVPKSLCFGR  384


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 70/147 (48%), Gaps = 26/147 (18%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVP------PEISAI------------------  387
            L G L  D+G+   LV + +  N LSG +P      PE++ +                  
Sbjct  396  LFGPLPDDLGECDTLVRVRLGQNYLSGSIPRGFLYLPELTLMELQNNYLTGQLDMQEKSQ  455

Query  388  --STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
              S L  LNLS+N    + P  +   ++LQ+L L  N  TG++P ++ ++ ++  L +  
Sbjct  456  VPSKLSQLNLSSNRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMSR  515

Query  562  NYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            N FSG IPPE G    L YL +S N L
Sbjct  516  NNFSGSIPPEIGNCTLLTYLDLSQNQL  542


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G    L  L ++ NQLSGP+PP++  I  L + N+S N    + P +L  
Sbjct  517  NFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSWNHLNQSLPKELGS  576

Query  457  LANLQVLDLYNNNLTGDLP  513
            L +L   D  +N+ +G +P
Sbjct  577  LKSLTSADFSHNSFSGSVP  595


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  D+G+L  ++ L ++ N  SG +PPEI   + L +L+LS N      P Q+ Q+
Sbjct  494  FTGEIPSDIGRLRNVLKLDMSRNNFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQI  553

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L   ++  N+L   LP E+  + SL       N FSG + P+ G++    + +  GN
Sbjct  554  HILNYFNVSWNHLNQSLPKELGSLKSLTSADFSHNSFSGSV-PQTGQYLFFNHTSFIGN  611


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 62/146 (42%), Gaps = 26/146 (18%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G +   +GQ   LV L ++ N+L+G VP  +     L+ L L NN      P  L +
Sbjct  347  NFTGAIPSKLGQNGKLVELDLSTNKLTGEVPKSLCFGRKLKILILLNNFLFGPLPDDLGE  406

Query  457  ------------------------LANLQVLDLYNNNLTGDLPVEVYKM--TSLRHLHLG  558
                                    L  L +++L NN LTG L ++      + L  L+L 
Sbjct  407  CDTLVRVRLGQNYLSGSIPRGFLYLPELTLMELQNNYLTGQLDMQEKSQVPSKLSQLNLS  466

Query  559  GNYFSGRIPPEYGRFPNLEYLAVSGN  636
             N  SG  P   G F +L+ L +SGN
Sbjct  467  SNRLSGSPPASIGNFSSLQILLLSGN  492



>ref|XP_008808401.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Phoenix dactylifera]
Length=989

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 111/171 (65%), Gaps = 1/171 (1%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNIST-SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  309
            AL+ +K      + + L  W+ S  +HC++  VTCD+   VV+L++S +     L P++ 
Sbjct  31   ALMKLKEGLLGSAGNDLHDWDPSAPTHCSFSGVTCDADARVVALNVSHIRFHRPLPPEIS  90

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
            +L  LVNL++A + L+G +PPEI+A+  LRFLN+SNN F   FP        L+VLD YN
Sbjct  91   RLDRLVNLTVACDSLAGRLPPEIAALPALRFLNISNNNFTGHFPDVDGGFLALEVLDAYN  150

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            NN +G LP+ + K+  LR++HLGGN+FSG IP  YG   +LEYL ++GNGL
Sbjct  151  NNFSGPLPLGLAKLPHLRYIHLGGNFFSGEIPESYGGIGSLEYLGLNGNGL  201


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 68/122 (56%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG + P +G    L  LS+ +N++SG +PP+I  +  L  LNLS N      P  LA+ 
Sbjct  465  ISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEIPSDLARC  524

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            A  L+ +DL  N LTG++P  + K+ +L  L+L  N  SG IP +  R  +L  L +S N
Sbjct  525  AGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIPADIQRMLSLTTLDLSYN  584

Query  637  GL  642
             L
Sbjct  585  NL  586


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 56/105 (53%), Gaps = 1/105 (1%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L +A N++SGP+PP I     L+ L+L +N      P Q+  L  L  L+L  NNLTG++
Sbjct  458  LLLANNRISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEI  517

Query  511  PVEVYKMT-SLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            P ++ +   +L  + L  N  +G IP    +  NL  L +S N L
Sbjct  518  PSDLARCAGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQL  562


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 60/118 (51%), Gaps = 0/118 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
             G + P+ G L  LV L +A   L+G +P  +  +  L  L L  N    + P +L  L 
Sbjct  227  EGGIPPEFGMLTSLVRLDMANCNLTGRIPASLGQLKLLDSLFLQWNHLAGSIPPELGGLD  286

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             L+ LDL  N LTG+LP    ++  L+ L+L  N+F G IPP     PNLE L V  N
Sbjct  287  LLESLDLSINELTGELPESFAELKQLKLLNLFRNHFRGHIPPFIADLPNLEVLQVWEN  344


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 61/122 (50%), Gaps = 7/122 (6%)
 Frame = +1

Query  280  LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
            L+G +  D+   G+L  LV   +  N   GP+P ++    +L  + L+ N    T P  L
Sbjct  370  LTGTIPSDLCASGRLELLV---LMENAFFGPIPEKLGDCKSLLHVRLAKNFLDGTIPAGL  426

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  630
              L ++ +L+L +N L+G+LP  +     L  L L  N  SG IPP  G F  L+ L++ 
Sbjct  427  FDLPSVDMLELSDNYLSGELPARIAG-DKLGMLLLANNRISGPIPPAIGNFRGLQTLSLQ  485

Query  631  GN  636
             N
Sbjct  486  SN  487


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G + P++G L  L +L ++ N+L+G +P   + +  L+ LNL  N F    P  +A 
Sbjct  273  HLAGSIPPELGGLDLLESLDLSINELTGELPESFAELKQLKLLNLFRNHFRGHIPPFIAD  332

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL+VL ++ NN T +LP  + +   L  L +  N  +G IP +      LE L +  N
Sbjct  333  LPNLEVLQVWENNFTFELPEGLGRNGRLIKLDVATNRLTGTIPSDLCASGRLELLVLMEN  392

Query  637  GL  642
              
Sbjct  393  AF  394


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 64/122 (52%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +   +GQL  L +L +  N L+G +PPE+  +  L  L+LS N      P   A+
Sbjct  249  NLTGRIPASLGQLKLLDSLFLQWNHLAGSIPPELGGLDLLESLDLSINELTGELPESFAE  308

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  L++L+L+ N+  G +P  +  + +L  L +  N F+  +P   GR   L  L V+ N
Sbjct  309  LKQLKLLNLFRNHFRGHIPPFIADLPNLEVLQVWENNFTFELPEGLGRNGRLIKLDVATN  368

Query  637  GL  642
             L
Sbjct  369  RL  370


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 59/119 (50%), Gaps = 1/119 (1%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +   +G    L+++ +A N L G +P  +  + ++  L LS+N      P ++A    
Sbjct  396  GPIPEKLGDCKSLLHVRLAKNFLDGTIPAGLFDLPSVDMLELSDNYLSGELPARIAG-DK  454

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L +L L NN ++G +P  +     L+ L L  N  SG IPP+ G    L  L +SGN L
Sbjct  455  LGMLLLANNRISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNL  513


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 39/132 (30%), Positives = 57/132 (43%), Gaps = 25/132 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG L   + +LP L  + +  N  SG +P     I +L +L L+ N      P  L++
Sbjct  152  NFSGPLPLGLAKLPHLRYIHLGGNFFSGEIPESYGGIGSLEYLGLNGNGLSGRVPVSLSR  211

Query  457  LANLQV-------------------------LDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L NL+                          LD+ N NLTG +P  + ++  L  L L  
Sbjct  212  LTNLREMYIGYYSMYEGGIPPEFGMLTSLVRLDMANCNLTGRIPASLGQLKLLDSLFLQW  271

Query  562  NYFSGRIPPEYG  597
            N+ +G IPPE G
Sbjct  272  NHLAGSIPPELG  283


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            NL+G +  D+ +    L  + ++ N+L+G +P  I+ +  L  LNLS N      P  + 
Sbjct  512  NLTGEIPSDLARCAGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIPADIQ  571

Query  454  QLANLQVLDLYNNNLTGDLPVE  519
            ++ +L  LDL  NNL+G++PVE
Sbjct  572  RMLSLTTLDLSYNNLSGEIPVE  593



>ref|XP_009405747.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=984

 Score =   137 bits (344),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 109/177 (62%), Gaps = 6/177 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH---CTWRRVTCdsllhvvsldlsg-lNLSGV  291
            + + LLSIK +F   SQS L SWN S++H   C W  V CD   H+V        N SG 
Sbjct  35   QASILLSIKRSFH-HSQSLLPSWN-SSAHAALCAWDGVRCDDSNHLVLALDVANSNFSGS  92

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LSP + +L  L +LS+A N LSGP P  IS +  LR+LN+SNN F  T     +  A L+
Sbjct  93   LSPAIAELKGLASLSVAGNSLSGPFPHAISELPRLRYLNISNNQFNGTLNWSFSDTAELE  152

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            VLD Y+N+ +G LPV + ++T LRHL LGGNYFSG IP  YG F  + YL+++GN L
Sbjct  153  VLDAYDNDFSGPLPVGLPRLTKLRHLDLGGNYFSGAIPFAYGGFSAITYLSLAGNDL  209


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G L  L  L +  NQL+G +P ++  +S+LR+L++SNN      P + ++L
Sbjct  258  LEGEIPPELGNLKNLDTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIPKEFSKL  317

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L +L ++ N L  ++P  V ++ SL  L L  N F+G IP   GR   L  L +S N 
Sbjct  318  HQLTLLHVFMNRLHSEIPGFVAELPSLEVLKLWQNNFTGSIPAALGRNGRLRELDLSTNK  377

Query  640  L  642
            L
Sbjct  378  L  378


 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  ++G L  L++L +++  L G +PPE+  +  L  L L  N      P QL  L
Sbjct  234  FDGGVPAEIGNLIGLLHLDLSSCGLEGEIPPELGNLKNLDTLFLQTNQLTGAIPFQLGNL  293

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            ++L+ LD+ NN LTG++P E  K+  L  LH+  N     IP      P+LE L +  N
Sbjct  294  SSLRYLDISNNALTGEIPKEFSKLHQLTLLHVFMNRLHSEIPGFVAELPSLEVLKLWQN  352


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            +L G + P++G +  L  L +   N+  G VP EI  +  L  L+LS+       P +L 
Sbjct  208  DLGGFIPPELGNVTTLKQLYLGYYNEFDGGVPAEIGNLIGLLHLDLSSCGLEGEIPPELG  267

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
             L NL  L L  N LTG +P ++  ++SLR+L +  N  +G IP E+ +   L  L V  
Sbjct  268  NLKNLDTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIPKEFSKLHQLTLLHVFM  327

Query  634  NGL  642
            N L
Sbjct  328  NRL  330


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 61/111 (55%), Gaps = 1/111 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +G L  ++ + ++ N  SG +PPEI   S+L +L+LS+N      P +++Q+
Sbjct  499  FAGEIPSQLGLLKQVLKVDMSRNNFSGRIPPEIGDCSSLTYLDLSHNQLAGPIPARISQV  558

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNL  612
              L  L+L  N L+  +P E+  M SL       N FSG+I PE G+F  L
Sbjct  559  RILSYLNLSWNRLSQRIPQEMASMKSLTSADFSHNDFSGKI-PETGQFAYL  608


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 64/146 (44%), Gaps = 25/146 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G    L  + +  N L+G +P     +  L  L L NN        + AQ 
Sbjct  402  LFGPLPDDLGDCMTLSRVRMGQNYLTGSIPRGFLYLPELSLLELQNNYLTGVVAEEPAQK  461

Query  460  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYF----------------------  570
             A L +L+L NN LTG LP  +   +SL+ L LGGN F                      
Sbjct  462  PAKLGLLNLSNNRLTGPLPSSIGNFSSLQILLLGGNEFAGEIPSQLGLLKQVLKVDMSRN  521

Query  571  --SGRIPPEYGRFPNLEYLAVSGNGL  642
              SGRIPPE G   +L YL +S N L
Sbjct  522  NFSGRIPPEIGDCSSLTYLDLSHNQL  547


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G    L  L ++ NQL+GP+P  IS +  L +LNLS N      P ++A 
Sbjct  522  NFSGRIPPEIGDCSSLTYLDLSHNQLAGPIPARISQVRILSYLNLSWNRLSQRIPQEMAS  581

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +N+ +G +P
Sbjct  582  MKSLTSADFSHNDFSGKIP  600


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    L  L +  N+ +G +P ++  +  +  +++S N F    P ++   
Sbjct  475  LTGPLPSSIGNFSSLQILLLGGNEFAGEIPSQLGLLKQVLKVDMSRNNFSGRIPPEIGDC  534

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNL  612
            ++L  LDL +N L G +P  + ++  L +L+L  N  S RIP E     +L
Sbjct  535  SSLTYLDLSHNQLAGPIPARISQVRILSYLNLSWNRLSQRIPQEMASMKSL  585



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 109/181 (60%), Gaps = 5/181 (3%)
 Frame = +1

Query  112  LGVTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lN  279
            L +  QA++L S+K +F A S  SL SWN+S     C+W  + CD++   V        N
Sbjct  29   LSLRRQASILVSVKQSFEA-SNPSLNSWNVSNYMFICSWAGIHCDNMNISVVSLDISNYN  87

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LSP + +L  LVNLS++ N  SG  PPEI  ++ L++LN+SNN F      + AQL
Sbjct  88   LSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKLARLQYLNISNNGFSGNLSWEFAQL  147

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L +LD YNN+  G LP+ V ++  L+ L  GGNYFSG IPP YG    L YL+V+GN 
Sbjct  148  KELILLDAYNNDFNGSLPLGVTQIPKLKRLDFGGNYFSGNIPPSYGNMVQLNYLSVAGND  207

Query  640  L  642
            L
Sbjct  208  L  208


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G L  +  ++P  L  L++++N+LSGP+P  I   S+L+ L LS N F    P  + +
Sbjct  449  LTGQLLEEASKVPSKLSQLNLSSNRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGR  508

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+  LD   NN +G +P+EV    SL +L L  N  +G IP +  +   L Y  VS N
Sbjct  509  LVNVLKLDFSRNNFSGRIPLEVGNCLSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWN  568

Query  637  GL  642
             L
Sbjct  569  HL  570


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 62/116 (53%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P++G+L  L +L +A   L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  233  FEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNL  292

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            ++L+ LDL NN LTGD+P E   +  L  L+L  N F G IP      P LE L +
Sbjct  293  SSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAELPKLEVLKL  348


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 59/123 (48%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G L   V Q+P L  L    N  SG +PP    +  L +L+++ N      P +L  
Sbjct  159  DFNGSLPLGVTQIPKLKRLDFGGNYFSGNIPPSYGNMVQLNYLSVAGNDLSGFIPSELGN  218

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            L NL+ L L Y N   G +P E+ K+ +L HL L      G IPPE G    L+ L +  
Sbjct  219  LTNLKQLFLGYYNEFEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQT  278

Query  634  NGL  642
            N L
Sbjct  279  NQL  281


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 2/109 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH +A+L
Sbjct  281  LSGSIPAQLGNLSSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAEL  340

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE--YGR  600
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P    +GR
Sbjct  341  PKLEVLKLWHNNFTGAIPSKLGQNGKLIDLDLSSNKLTGVVPKSLCFGR  389


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 58/111 (52%), Gaps = 0/111 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    L NL ++ NQ +G +P +I  +  +  L+ S N F    P ++   
Sbjct  474  LSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGRLVNVLKLDFSRNNFSGRIPLEVGNC  533

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNL  612
             +L  LDL  N LTG +PV++ ++  L + ++  N+ +  +P E G   +L
Sbjct  534  LSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWNHLNQSLPKELGSMKSL  584


 Score = 55.8 bits (133),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 66/145 (46%), Gaps = 25/145 (17%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G +   +GQ   L++L +++N+L+G VP  +     L+ L L NN      P  L +
Sbjct  352  NFTGAIPSKLGQNGKLIDLDLSSNKLTGVVPKSLCFGRRLKILILLNNFLFGALPDDLGK  411

Query  457  ------------------------LANLQVLDLYNNNLTGDLPVEVYKMTS-LRHLHLGG  561
                                    L  L +++L NN LTG L  E  K+ S L  L+L  
Sbjct  412  CDTLVRVRMGQNYLTGSIPQGFLYLPELSLVELQNNYLTGQLLEEASKVPSKLSQLNLSS  471

Query  562  NYFSGRIPPEYGRFPNLEYLAVSGN  636
            N  SG +P   G F +L+ L +SGN
Sbjct  472  NRLSGPLPTSIGNFSSLQNLLLSGN  496


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG +  +VG    L  L ++ NQL+GP+P +I  I  L + N+S N    + P +L  
Sbjct  521  NFSGRIPLEVGNCLSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWNHLNQSLPKELGS  580

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +N+ +G +P
Sbjct  581  MKSLTSADFSHNSFSGSIP  599



>ref|XP_002510557.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF52744.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=985

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 117/181 (65%), Gaps = 5/181 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglN-L  282
            G ++   LL +K++  A + S L  W  S S   HC++  VTCD    VVSL+L+  +  
Sbjct  25   GYSDAELLLKLKSSMIARNGSGLQDWEPSPSPSAHCSFSGVTCDKDSRVVSLNLTSRHGF  84

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G + P++G L  LVNLSIA+  L+G +P E++ +++LR  N+SNN F   FP ++   +
Sbjct  85   FGFIPPEIGLLNKLVNLSIASLNLTGRLPLELAQLTSLRIFNISNNAFIGNFPGEITLVM  144

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+LD+YNNN +G LP+E+ K+ +L+HLHLGGNYFSG IP  Y    +LEYL ++GN 
Sbjct  145  TQLQILDIYNNNFSGLLPLELIKLKNLKHLHLGGNYFSGTIPESYSAIESLEYLGLNGNS  204

Query  640  L  642
            L
Sbjct  205  L  205


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 70/122 (57%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P +GQL  L +L +  N+LSG +PPE+S + +L+ L+LS N      P   ++
Sbjct  253  NLSGEIPPSLGQLKNLNSLFLQMNRLSGHIPPELSDLISLQSLDLSINSLKGEIPASFSK  312

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+ ++ L+ NNL G++P  +    +L  LH+  N F+  +P   G    L+ L VS N
Sbjct  313  LKNITLIHLFQNNLGGEIPEFIGDFPNLEVLHVWENNFTLELPKNLGSSGKLKMLDVSYN  372

Query  637  GL  642
             L
Sbjct  373  HL  374


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 60/114 (53%), Gaps = 0/114 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G L  L  L +A + LSG +PP +  +  L  L L  N      P +L+ L +
Sbjct  232  GGIPPEFGSLSSLEILDMAQSNLSGEIPPSLGQLKNLNSLFLQMNRLSGHIPPELSDLIS  291

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            LQ LDL  N+L G++P    K+ ++  +HL  N   G IP   G FPNLE L V
Sbjct  292  LQSLDLSINSLKGEIPASFSKLKNITLIHLFQNNLGGEIPEFIGDFPNLEVLHV  345


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++  L +L  ++ +AN LSG +PP IS  ++L  ++ S N      P ++A L
Sbjct  493  LSGEIPNEIFNLKYLTAINFSANNLSGDIPPSISHCTSLTSVDFSRNNLHGQIPVEIANL  552

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L +L++  N+LTG +P ++  MTSL  L L  N   GR+P
Sbjct  553  KDLSILNVSQNHLTGQIPGDIRIMTSLTTLDLSYNNLLGRVP  594


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 70/147 (48%), Gaps = 25/147 (17%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG+L  ++ +L  L +L +  N  SG +P   SAI +L +L L+ N      P  LA+
Sbjct  156  NFSGLLPLELIKLKNLKHLHLGGNYFSGTIPESYSAIESLEYLGLNGNSLSGKVPASLAK  215

Query  457  LANL-------------------------QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L NL                         ++LD+  +NL+G++P  + ++ +L  L L  
Sbjct  216  LKNLRKLYLGYFNSWEGGIPPEFGSLSSLEILDMAQSNLSGEIPPSLGQLKNLNSLFLQM  275

Query  562  NYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            N  SG IPPE     +L+ L +S N L
Sbjct  276  NRLSGHIPPELSDLISLQSLDLSINSL  302


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 65/145 (45%), Gaps = 25/145 (17%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +  LP +  L +  N  SG +P E+S I+ L  L +SNN+   + P  L  L
Sbjct  422  LSGTIPSGIFNLPSMAILELNDNYFSGELPSEMSGIA-LGLLKISNNLISGSIPETLGNL  480

Query  460  ANLQVLDL-------------YN-----------NNLTGDLPVEVYKMTSLRHLHLGGNY  567
             NLQ++ L             +N           NNL+GD+P  +   TSL  +    N 
Sbjct  481  RNLQIIKLEINRLSGEIPNEIFNLKYLTAINFSANNLSGDIPPSISHCTSLTSVDFSRNN  540

Query  568  FSGRIPPEYGRFPNLEYLAVSGNGL  642
              G+IP E     +L  L VS N L
Sbjct  541  LHGQIPVEIANLKDLSILNVSQNHL  565


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +   +G L  L  + +  N+LSG +P EI  +  L  +N S N      P  ++  
Sbjct  469  ISGSIPETLGNLRNLQIIKLEINRLSGEIPNEIFNLKYLTAINFSANNLSGDIPPSISHC  528

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
             +L  +D   NNL G +PVE+  +  L  L++  N+ +G+IP +     +L  L +S N 
Sbjct  529  TSLTSVDFSRNNLHGQIPVEIANLKDLSILNVSQNHLTGQIPGDIRIMTSLTTLDLSYNN  588

Query  640  L  642
            L
Sbjct  589  L  589


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G    L  L ++ N L+G +P ++     L+ L L  N F    P +L Q
Sbjct  349  NFTLELPKNLGSSGKLKMLDVSYNHLTGLIPKDLCKGGRLKELVLMKNFFLGPLPDELGQ  408

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE  591
              +L  + + NN L+G +P  ++ + S+  L L  NYFSG +P E
Sbjct  409  CKSLYKIRVANNMLSGTIPSGIFNLPSMAILELNDNYFSGELPSE  453



>ref|XP_009108464.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=995

 Score =   136 bits (343),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 109/179 (61%), Gaps = 5/179 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            V +   L SIK +F +    SL SW +    S C+W  V+CD+L   ++      LN+SG
Sbjct  36   VRQAKVLFSIKQSFDS-YDPSLDSWTVPNFNSLCSWTGVSCDNLNQSITRLDISNLNISG  94

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIF-GSTFPHQLAQLAN  465
             LSP+V +LP LV LS+A+N  SG +P EI  +S L  LN+S N F G   P +  ++  
Sbjct  95   TLSPEVSRLPSLVFLSVASNSFSGKIPKEIHKLSNLEVLNISTNAFEGELAPLEFGEMTQ  154

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  LD YNNN TG LP+ + K+T L +L LGGNYF+G IP  YG F  L+YL++SGN L
Sbjct  155  LTTLDAYNNNFTGSLPLSLTKLTQLEYLDLGGNYFNGEIPVSYGGFLRLKYLSLSGNDL  213


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 61/107 (57%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  ++++ N+L+GP+P  I  + +L+ L L +N F    P ++  L +L  +D+  NNL+
Sbjct  471  LTQINLSNNRLTGPIPSSIRNLRSLQILLLGSNRFTGQIPGEIGSLKSLLTIDMSRNNLS  530

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G LP E  +  SL +L L  N  SG+IP +  R   L YL VS N L
Sbjct  531  GKLPPEFGECQSLTYLDLSHNEISGQIPVQISRIRILNYLNVSWNSL  577


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 68/121 (56%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +  ++G L  L  L +  N+L+G VP E+  +++L+ L+LSNN      P +L+ L
Sbjct  262  LKGSIPAELGFLKNLEILFLQTNELTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGL  321

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+ +L+ N L G++P  V  +  L+ L L  N F+G+IP + G    L  + +S N 
Sbjct  322  QELQLFNLFFNRLHGEIPEFVAHLPVLQILKLWHNNFTGKIPAKLGLNGKLVEIDLSSNK  381

Query  640  L  642
            L
Sbjct  382  L  382


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G +  D+G+L  LV+L +A   L G +P E+  +  L  L L  N    + P +L  
Sbjct  237  DFHGGIPADLGRLINLVHLDLANCSLKGSIPAELGFLKNLEILFLQTNELTGSVPRELGN  296

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            + +L+ LDL NN L G++P+E+  +  L+  +L  N   G IP      P L+ L +  N
Sbjct  297  MTSLKTLDLSNNFLEGEIPLELSGLQELQLFNLFFNRLHGEIPEFVAHLPVLQILKLWHN  356


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 3/122 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI---SAISTLRFLNLSNNIFGSTFPHQL  450
            L+G L   +  LP +  L +  N L+G +  E    + +S+L  +NLSNN      P  +
Sbjct  430  LTGTLPKGLIYLPNVSLLELQNNFLTGEIAEEEAGNTGLSSLTQINLSNNRLTGPIPSSI  489

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVS  630
              L +LQ+L L +N  TG +P E+  + SL  + +  N  SG++PPE+G   +L YL +S
Sbjct  490  RNLRSLQILLLGSNRFTGQIPGEIGSLKSLLTIDMSRNNLSGKLPPEFGECQSLTYLDLS  549

Query  631  GN  636
             N
Sbjct  550  HN  551


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 63/117 (54%), Gaps = 2/117 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  ++G L  L+ + ++ N LSG +PPE     +L +L+LS+N      P Q++++
Sbjct  505  FTGQIPGEIGSLKSLLTIDMSRNNLSGKLPPEFGECQSLTYLDLSHNEISGQIPVQISRI  564

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP--EYGRFPNLEYLA  624
              L  L++  N+L   LPVE+  M SL  +    N FSG +P   ++  F N  +L 
Sbjct  565  RILNYLNVSWNSLNQSLPVELGSMKSLTSVDFSHNNFSGSVPTLGQFVYFNNTSFLG  621


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 61/123 (50%), Gaps = 1/123 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            +L G +  ++G +  L  L +   N   G +P ++  +  L  L+L+N     + P +L 
Sbjct  212  DLIGRIPNELGNITTLEKLYLGYYNDFHGGIPADLGRLINLVHLDLANCSLKGSIPAELG  271

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
             L NL++L L  N LTG +P E+  MTSL+ L L  N+  G IP E      L+   +  
Sbjct  272  FLKNLEILFLQTNELTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGLQELQLFNLFF  331

Query  634  NGL  642
            N L
Sbjct  332  NRL  334


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 2/109 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G +  L  L ++ N L G +P E+S +  L+  NL  N      P  +A L
Sbjct  286  LTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGLQELQLFNLFFNRLHGEIPEFVAHL  345

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE--YGR  600
              LQ+L L++NN TG +P ++     L  + L  N  +G IP    +GR
Sbjct  346  PVLQILKLWHNNFTGKIPAKLGLNGKLVEIDLSSNKLTGLIPETLCFGR  394


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 63/119 (53%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  L  L  L + +N+ +G +P EI ++ +L  +++S N      P +  + 
Sbjct  481  LTGPIPSSIRNLRSLQILLLGSNRFTGQIPGEIGSLKSLLTIDMSRNNLSGKLPPEFGEC  540

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             +L  LDL +N ++G +PV++ ++  L +L++  N  +  +P E G   +L  +  S N
Sbjct  541  QSLTYLDLSHNEISGQIPVQISRIRILNYLNVSWNSLNQSLPVELGSMKSLTSVDFSHN  599


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 56/121 (46%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   V  LP L  L +  N  +G +P ++     L  ++LS+N      P  L   
Sbjct  334  LHGEIPEFVAHLPVLQILKLWHNNFTGKIPAKLGLNGKLVEIDLSSNKLTGLIPETLCFG  393

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              LQ+L L+NN L G LP ++ +   L    LG N+ +G +P      PN+  L +  N 
Sbjct  394  RRLQILILFNNFLFGPLPEDLGQCEPLWRFRLGQNFLTGTLPKGLIYLPNVSLLELQNNF  453

Query  640  L  642
            L
Sbjct  454  L  454



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score =   136 bits (342),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 103/176 (59%), Gaps = 4/176 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+SG L
Sbjct  36   QASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LD+YNNNL G LP+ V ++  L++L  GGNYF G IPP YG    L YL++ GN L
Sbjct  155  LDVYNNNLNGTLPLGVTQLGKLKYLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDL  210


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP    +   L YL +S N
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWN  570

Query  637  GL  642
             L
Sbjct  571  HL  572


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNK  378

Query  640  L  642
            L
Sbjct  379  L  379


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 63/119 (53%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +++  LDL NN LTGD+P+E   +  L  L+L  N   G IP      P LE L +  N
Sbjct  295  SSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHN  353


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +GQL  +  L ++ N LSG +PPEI    TL +L+LS N      P  + Q+
Sbjct  500  FTGEIPSQIGQLKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQI  559

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L++  N+L   LP E+  M SL       N FSG I PE+G++      + SGN
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKSLTSADFSHNNFSGSI-PEFGQYSFFNSTSFSGN  617


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P
Sbjct  343  PELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNKLTGLVP  384


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
              G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  +DL N +L+G +P E+  +  L  L L  N  +G IPPE G   ++  L +S N
Sbjct  246  LINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNN  305

Query  637  GL  642
             L
Sbjct  306  AL  307


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 0/110 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G +   +G+   L  L +++N+L+G VP  +     L+ L L  N      P  L  
Sbjct  354  NFTGAIPAKLGENGRLTELDLSSNKLTGLVPKSLCLGRKLQILILRINFLFGPLPDDLGH  413

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFP  606
               L  + L  N LTG +P     +  L  + L  NY SG++P +  + P
Sbjct  414  CDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTP  463



>gb|KEH33614.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score =   136 bits (342),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 111/183 (61%), Gaps = 6/183 (3%)
 Frame = +1

Query  112  LGVTEQAALL-SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl---sg  273
            L +  QA++L S+K  F   S +SL+SWN+S   S CTW  + CD  +  +S+     S 
Sbjct  25   LSLKNQASILVSMKQDFEPSSNTSLSSWNMSNYMSLCTWYGIQCDHTITNMSIVSLDISN  84

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            LN+SG  SP + +L  LVN+SI  N   G  P EI  +  L+ LN+SNN+F      +  
Sbjct  85   LNISGSFSPQITKLYNLVNVSIQGNSFYGEFPTEIHKLQRLKCLNISNNMFSGNLSWEFN  144

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSG  633
            +L  L+VLD+YNN   G LP  V +++SL+HL+ GGNYFSG+IP  YG    L +L+++G
Sbjct  145  KLKELEVLDIYNNGFNGSLPRGVTQVSSLKHLNFGGNYFSGKIPTSYGEMKQLNFLSLAG  204

Query  634  NGL  642
            N L
Sbjct  205  NDL  207


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 60/111 (54%), Gaps = 0/111 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G  P L  L ++ N+ SG +P +I  +  +  L++S+N F  T P ++ + 
Sbjct  474  LSGSLPTSIGNFPNLQTLQLSGNRFSGQIPSDIGKLKKILKLDISSNNFSGTIPSEIGKC  533

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNL  612
              L  LDL  N  +G +P+++ ++  L HL++  N+ +  IP E G    L
Sbjct  534  TLLTYLDLSQNQFSGPIPIQLAQIHILNHLNVSWNHLNQSIPKELGALKGL  584


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 0/107 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L   +++ N+LSG +P  I     L+ L LS N F    P  + +L  +  LD+ +NN +
Sbjct  464  LEQCNLSNNRLSGSLPTSIGNFPNLQTLQLSGNRFSGQIPSDIGKLKKILKLDISSNNFS  523

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            G +P E+ K T L +L L  N FSG IP +  +   L +L VS N L
Sbjct  524  GTIPSEIGKCTLLTYLDLSQNQFSGPIPIQLAQIHILNHLNVSWNHL  570


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (52%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G++  L  LS+A N LSG +P E+  +++L  L L   N F    P +  +
Sbjct  183  FSGKIPTSYGEMKQLNFLSLAGNDLSGFLPSELGNLTSLENLYLGYFNQFDGGVPKEFGK  242

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  LDL +  L G +P+E+ ++  L  L L  N  +G IPPE G    L  L +S N
Sbjct  243  LINLVHLDLASCFLKGSIPLELGQLNKLDTLFLQKNQLTGFIPPELGNLSRLNALDLSLN  302

Query  637  GL  642
             L
Sbjct  303  NL  304


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L  L ++ N L+G +P E S +  L  LNL  N F S  P  +++L
Sbjct  280  LTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNLRELSLLNLFINKFHSEIPDFISEL  339

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L+ NN TG +P ++ +   L  + L  N  +G +P
Sbjct  340  PKLEVLKLWRNNFTGVIPSKLGQNGRLTEVDLSTNKLTGILP  381


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 65/121 (54%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +  ++GQL  L  L +  NQL+G +PPE+  +S L  L+LS N      P++ + L
Sbjct  256  LKGSIPLELGQLNKLDTLFLQKNQLTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNL  315

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L +L+L+ N    ++P  + ++  L  L L  N F+G IP + G+   L  + +S N 
Sbjct  316  RELSLLNLFINKFHSEIPDFISELPKLEVLKLWRNNFTGVIPSKLGQNGRLTEVDLSTNK  375

Query  640  L  642
            L
Sbjct  376  L  376


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 56/116 (48%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  + G+L  LV+L +A+  L G +P E+  ++ L  L L  N      P +L  L
Sbjct  232  FDGGVPKEFGKLINLVHLDLASCFLKGSIPLELGQLNKLDTLFLQKNQLTGFIPPELGNL  291

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            + L  LDL  NNLTG +P E   +  L  L+L  N F   IP      P LE L +
Sbjct  292  SRLNALDLSLNNLTGGIPNEFSNLRELSLLNLFINKFHSEIPDFISELPKLEVLKL  347


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 63/146 (43%), Gaps = 26/146 (18%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +GV+   +GQ   L  + ++ N+L+G +P  +     L+ L L NN    + P+ L Q
Sbjct  351  NFTGVIPSKLGQNGRLTEVDLSTNKLTGILPKSLCFGKRLKILILLNNFLFGSLPNDLGQ  410

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPE---------------  591
               LQ + +  N  TG +P     + +L  L L  NY SG IP +               
Sbjct  411  CYTLQRVRIGQNYFTGSIPHGFLYLPNLSLLELQNNYLSGVIPQQTHKNKTSKLEQCNLS  470

Query  592  -----------YGRFPNLEYLAVSGN  636
                        G FPNL+ L +SGN
Sbjct  471  NNRLSGSLPTSIGNFPNLQTLQLSGN  496



>ref|XP_009334873.1| PREDICTED: receptor protein kinase CLAVATA1 [Pyrus x bretschneideri]
Length=973

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 110/175 (63%), Gaps = 1/175 (1%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            G  +  ALL +KAA      S L  WN S+SHC +  V CD    VVSL++S + L G +
Sbjct  26   GHRDLDALLKLKAAMVGPKGSGLEDWNSSSSHCFFSGVLCDRDSRVVSLNVSNIPLFGTI  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQ  471
               +G L  LVNL I  + L+G +P E++ ++ L+ LN+SNN F  +FP ++   + +L+
Sbjct  86   PAAIGLLDKLVNLKITDDNLTGRLPAEMANLTALKHLNISNNAFSGSFPGEIMLGMTDLE  145

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            VLD YNNN  G LPVE+  + +++HLHLGGNY +G IP +Y    +LEYL ++GN
Sbjct  146  VLDAYNNNFNGTLPVELASLKNIKHLHLGGNYITGEIPEDYSEIQSLEYLGLNGN  200


 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 67/122 (55%), Gaps = 0/122 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +  L  L +L +  N+LSG +PP++SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLYSLFLQVNRLSGSIPPQLSALNRLMSLDLSINELTGEIPESFSE  309

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +++LY NNL G +P  V  +  L  L +  N F+  +P   GR   L+ L V+GN
Sbjct  310  LKNLTLVNLYKNNLYGQIPKFVGDLPYLEVLQIWENNFTFELPENLGRNGRLKDLDVTGN  369

Query  637  GL  642
             L
Sbjct  370  HL  371


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 61/128 (48%), Gaps = 26/128 (20%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS--------------  414
            ++SG + P +G L  L  LS+  N+ SG +P EI  +  L  +N+S              
Sbjct  465  HISGKIPPAIGNLKSLQTLSLEMNRFSGEIPTEIFYLKLLSKINISANNLSSDISDSISR  524

Query  415  -----------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                       NN+ G   P  +A+L  L +L+   N LTG++P E+  MTSL  L L  
Sbjct  525  CSSLTSVDLSRNNLVGE-IPRGIAKLKVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSN  583

Query  562  NYFSGRIP  585
            N F GR+P
Sbjct  584  NNFVGRLP  591


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            LSG + P +  L  L++L ++ N+L+G +P   S +  L  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPQLSALNRLMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGQ-IPKFVGD  333

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L+VL ++ NN T +LP  + +   L+ L + GN+ +G IP
Sbjct  334  LPYLEVLQIWENNFTFELPENLGRNGRLKDLDVTGNHLTGLIP  376


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 0/117 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  L  L +++  L GP+P  +S +  L  L L  N    + P QL+ L  
Sbjct  229  GGIPPELGSLSSLQVLDMSSCNLVGPIPTTLSLLKHLYSLFLQVNRLSGSIPPQLSALNR  288

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L  LDL  N LTG++P    ++ +L  ++L  N   G+IP   G  P LE L +  N
Sbjct  289  LMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGQIPKFVGDLPYLEVLQIWEN  345


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L    +  N   GP+P E+   ++L  + +  N    T P  +  
Sbjct  370  HLTGLIPRDLCKGGHLKTAILMDNHFFGPIPEELGLCNSLVKIRMMKNTLTGTIPAGIFS  429

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +++L +N L+G+LP ++    ++  L L GN+ SG+IPP  G   +L+ L++  N
Sbjct  430  LPNLIMIELNDNFLSGELPEQI-SGGNIGILTLSGNHISGKIPPAIGNLKSLQTLSLEMN  488


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 64/147 (44%), Gaps = 25/147 (17%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G L  ++  L  + +L +  N ++G +P + S I +L +L L+ N+     P  L++
Sbjct  153  NFNGTLPVELASLKNIKHLHLGGNYITGEIPEDYSEIQSLEYLGLNGNLLTGKLPASLSR  212

Query  457  LAN-------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L N                         LQVLD+ + NL G +P  +  +  L  L L  
Sbjct  213  LKNLREMYVGYYNSYDGGIPPELGSLSSLQVLDMSSCNLVGPIPTTLSLLKHLYSLFLQV  272

Query  562  NYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            N  SG IPP+      L  L +S N L
Sbjct  273  NRLSGSIPPQLSALNRLMSLDLSINEL  299



>ref|XP_004960969.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Setaria italica]
Length=1031

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 116/180 (64%), Gaps = 6/180 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNI--STSHCT-WRRVTCds--llhvvsldlsglNLS  285
            ++ A LLSIKAAF      +L +W +  + S C+ W  V C       VVSLD+SG NLS
Sbjct  42   SQAATLLSIKAAFAPPLPPTLRAWTLANTASLCSSWPGVACGGPGGRTVVSLDVSGFNLS  101

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIF-GSTFPHQLAQLA  462
            G LSP VG L  L  LS AAN LSG +PP ++++  LR LNLSNN F G+      + + 
Sbjct  102  GALSPAVGGLAGLRFLSAAANSLSGALPPAVASLRGLRHLNLSNNQFNGTLVGIDFSAMR  161

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             L+V +LY+N+L G LP  +  + SLRHL LGGN+FSG IPP +GRFP +E+L+++GN L
Sbjct  162  GLEVFNLYDNDLAGPLPAGLSALPSLRHLDLGGNFFSGTIPPAFGRFPAIEFLSLAGNSL  221


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 66/122 (54%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P  G+ P +  LS+A N L+G +PP++  ++T+R L L   N F    P +L  
Sbjct  197  FSGTIPPAFGRFPAIEFLSLAGNSLTGAIPPDLGNLTTIRHLYLGYFNRFDGGIPPELGS  256

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            LA+L  LDL +  L G +P  +  +T L  L+L  N  +G +PP  G    L +L VS N
Sbjct  257  LASLVHLDLASCGLQGPIPASLGGLTRLDTLYLQTNQLNGTLPPSLGNLTGLRFLDVSNN  316

Query  637  GL  642
             L
Sbjct  317  AL  318


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L P +G L  L  L ++ N L+G +PPE++A+  LR LN+  N F    P  LA 
Sbjct  293  QLNGTLPPSLGNLTGLRFLDVSNNALTGEIPPELAALRGLRLLNMFINRFRGGVPEFLAG  352

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+VL L+ NN TG +P  + +   LR + L  N  +G +P
Sbjct  353  LESLEVLKLWQNNFTGAIPAALGRAAPLREVDLSTNRLTGEVP  395


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 61/116 (53%), Gaps = 0/116 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P++G L  LV+L +A+  L GP+P  +  ++ L  L L  N    T P  L  L
Sbjct  246  FDGGIPPELGSLASLVHLDLASCGLQGPIPASLGGLTRLDTLYLQTNQLNGTLPPSLGNL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
              L+ LD+ NN LTG++P E+  +  LR L++  N F G +P       +LE L +
Sbjct  306  TGLRFLDVSNNALTGEIPPELAALRGLRLLNMFINRFRGGVPEFLAGLESLEVLKL  361


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 59/114 (52%), Gaps = 0/114 (0%)
 Frame = +1

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
            D G    L  L+++ N+L+G +P  I   S L+ L L  N      P Q+ +L  L  LD
Sbjct  471  DAGVPARLSLLNLSGNRLNGSLPASIGNFSALQTLLLGGNQLRGEIPRQVGRLRRLLKLD  530

Query  481  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            L  NNLTG++P EV    SL +L L GN  SG IP    R   L YL VS N L
Sbjct  531  LSGNNLTGEVPGEVGDCASLTYLDLSGNRLSGAIPGRLARIRILNYLNVSWNAL  584


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  +VG    L  L ++ N+LSG +P  ++ I  L +LN+S N      P +L  
Sbjct  535  NLTGEVPGEVGDCASLTYLDLSGNRLSGAIPGRLARIRILNYLNVSWNALSGGIPRELGA  594

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +N+L+G +P
Sbjct  595  MKSLTAADFSHNDLSGRVP  613



>ref|XP_011004295.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Populus euphratica]
Length=893

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 103/176 (59%), Gaps = 4/176 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+SG L
Sbjct  36   QASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
            LD+YNNNL G LP+ V ++  L++L  GGNYF G IPP YG    L YL++ GN L
Sbjct  155  LDVYNNNLNGTLPLGVTQLGKLKYLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDL  210


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP    +   L YL +S N
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWN  570

Query  637  GL  642
             L
Sbjct  571  HL  572


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 69/121 (57%), Gaps = 0/121 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNG  639
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP + G    L  L +S N 
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNK  378

Query  640  L  642
            L
Sbjct  379  L  379


 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/119 (37%), Positives = 63/119 (53%), Gaps = 0/119 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            +++  LDL NN LTGD+P+E   +  L  L+L  N   G IP      P LE L +  N
Sbjct  295  SSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHN  353


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 61/119 (51%), Gaps = 1/119 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +GQL  +  L ++ N LSG +PPEI    TL +L+LS N      P  + Q+
Sbjct  500  FTGEIPSQIGQLKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQI  559

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
              L  L++  N+L   LP E+  M SL       N FSG I PE+G++      + SGN
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKSLTSADFSHNNFSGSI-PEFGQYSFFNSTSFSGN  617


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P
Sbjct  343  PELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNKLTGLVP  384


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 61/122 (50%), Gaps = 1/122 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
              G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL  +DL N +L+G +P E+  +  L  L L  N  +G IPPE G   ++  L +S N
Sbjct  246  LINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNN  305

Query  637  GL  642
             L
Sbjct  306  AL  307



>ref|XP_008387933.1| PREDICTED: receptor protein kinase CLAVATA1 [Malus domestica]
Length=973

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 109/169 (64%), Gaps = 1/169 (1%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  312
            ALL +KAA      S L  WN S+SHC +  V CD    VV+L++S + L G +   +G 
Sbjct  32   ALLKLKAAMVGPKGSGLEDWNSSSSHCFFSGVLCDRDSRVVALNVSNIPLFGTIPAAIGL  91

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQVLDLYN  489
            L  LVNL I  + L+G +P E++ +++L+ LN+SNN F  +FP ++   + +L+VLD YN
Sbjct  92   LDKLVNLEITDDNLTGRLPAEMANLTSLKHLNISNNAFSGSFPGEIVLGMTDLEVLDAYN  151

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            NN  G LP+++  + +++HLHLGGNY +G IP +Y    +LEYL ++GN
Sbjct  152  NNFNGTLPIQLVSLKNIKHLHLGGNYITGEIPEDYSEIQSLEYLGLNGN  200


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 63/120 (53%), Gaps = 0/120 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            ++SG + P +G L  L  LS+  N+ SG +P EI  +  L  +N+S N   S     +++
Sbjct  465  HISGKIPPAIGNLKSLQTLSLEMNRFSGEIPTEIFYLKLLSKINISANNLSSDISESISR  524

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
             ++L  +DL  NNL G++P  + K+  L  L+   N  +G IP E     +L  L +S N
Sbjct  525  CSSLTSVDLSGNNLVGEIPRGIAKLKVLSILNFSRNQLTGEIPAEMRSMTSLTTLDLSNN  584


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            +  N+LSG +PP++SA++ L  L+LS N      P   ++L NL +++LY NNL G +P 
Sbjct  270  LQVNRLSGSIPPQLSALNMLMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGPIPK  329

Query  517  EVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
             V     L  L +  N F+  +P   GR   L+ L V+GN L
Sbjct  330  FVGDFPHLEVLQIWENNFTFELPENLGRNGRLKDLDVTGNHL  371


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++  L  L  ++I+AN LS  +   IS  S+L  ++LS N      P  +A+L
Sbjct  490  FSGEIPTEIFYLKLLSKINISANNLSSDISESISRCSSLTSVDLSGNNLVGEIPRGIAKL  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+   N LTG++P E+  MTSL  L L  N F GR+P
Sbjct  550  KVLSILNFSRNQLTGEIPAEMRSMTSLTTLDLSNNNFVGRLP  591


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 64/113 (57%), Gaps = 2/113 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            LSG + P +  L  L++L ++ N+L+G +P   S +  L  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPQLSALNMLMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGP-IPKFVGD  333

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLE  615
              +L+VL ++ NN T +LP  + +   L+ L + GN+ +G IP +  +  NL+
Sbjct  334  FPHLEVLQIWENNFTFELPENLGRNGRLKDLDVTGNHLTGLIPRDLCKGGNLK  386


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 65/120 (54%), Gaps = 1/120 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L    +  N   GP+P E+   ++L  + +  N    T P  +  
Sbjct  370  HLTGLIPRDLCKGGNLKTAILMENHFFGPIPEELGLCNSLVKIRMMKNTLTGTIPAGIFS  429

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGN  636
            L NL +++L +N L+G+LP ++    ++  L L GN+ SG+IPP  G   +L+ L++  N
Sbjct  430  LPNLIMIELNDNFLSGELPQQISG-GNIGILTLSGNHISGKIPPAIGNLKSLQTLSLEMN  488


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 53/104 (51%), Gaps = 0/104 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L+++ N +SG +PP I  + +L+ L+L  N F    P ++  L  L  +++  NNL+ D+
Sbjct  459  LTLSGNHISGKIPPAIGNLKSLQTLSLEMNRFSGEIPTEIFYLKLLSKINISANNLSSDI  518

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAVSGNGL  642
               + + +SL  + L GN   G IP    +   L  L  S N L
Sbjct  519  SESISRCSSLTSVDLSGNNLVGEIPRGIAKLKVLSILNFSRNQL  562


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 60/114 (53%), Gaps = 0/114 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G +  L  L +++  L GP+P  +S +  L  L L  N    + P QL+ L  
Sbjct  229  GGIPPELGSVSSLQVLDMSSCNLVGPIPTTLSLLKHLHSLFLQVNRLSGSIPPQLSALNM  288

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYGRFPNLEYLAV  627
            L  LDL  N LTG++P    ++ +L  ++L  N   G IP   G FP+LE L +
Sbjct  289  LMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGPIPKFVGDFPHLEVLQI  342


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 0/106 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  +++  N L GP+P  +     L  L +  N F    P  L + 
Sbjct  299  LTGEIPESFSELKNLTLVNLYKNNLYGPIPKFVGDFPHLEVLQIWENNFTFELPENLGRN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPPEYG  597
              L+ LD+  N+LTG +P ++ K  +L+   L  N+F G IP E G
Sbjct  359  GRLKDLDVTGNHLTGLIPRDLCKGGNLKTAILMENHFFGPIPEELG  404


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 40/79 (51%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLS  +S  + +   L ++ ++ N L G +P  I+ +  L  LN S N      P ++  
Sbjct  513  NLSSDISESISRCSSLTSVDLSGNNLVGEIPRGIAKLKVLSILNFSRNQLTGEIPAEMRS  572

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  LDL NNN  G LP
Sbjct  573  MTSLTTLDLSNNNFVGRLP  591



>ref|XP_009415746.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=978

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 109/176 (62%), Gaps = 4/176 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+SIK +F + S+S L SWN S   S C W  V CD+ +HVV       LN+SG L
Sbjct  30   QASVLISIKRSFHS-SESFLPSWNPSNHASLCAW