BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF044J23

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629595.1|  PREDICTED: probable pectin methyltransferase...    119   2e-27   Nicotiana tomentosiformis
ref|XP_009760349.1|  PREDICTED: probable pectin methyltransferase...    118   7e-27   Nicotiana sylvestris
ref|XP_006367734.1|  PREDICTED: probable pectin methyltransferase...    117   1e-26   Solanum tuberosum [potatoes]
ref|XP_010320179.1|  PREDICTED: probable pectin methyltransferase...    115   5e-26   Solanum lycopersicum
gb|KHG28112.1|  putative pectin methyltransferase QUA2 -like protein    101   7e-21   Gossypium arboreum [tree cotton]
gb|KJB64258.1|  hypothetical protein B456_010G039800                    100   9e-21   Gossypium raimondii
gb|KJB64260.1|  hypothetical protein B456_010G039800                    100   1e-20   Gossypium raimondii
gb|KJB64259.1|  hypothetical protein B456_010G039800                    100   1e-20   Gossypium raimondii
ref|XP_011074193.1|  PREDICTED: probable pectin methyltransferase...  97.4    1e-19   Sesamum indicum [beniseed]
ref|XP_007018751.1|  S-adenosyl-L-methionine-dependent methyltran...  96.3    3e-19   
emb|CDP01069.1|  unnamed protein product                              96.3    3e-19   Coffea canephora [robusta coffee]
ref|XP_007018750.1|  S-adenosyl-L-methionine-dependent methyltran...  96.3    3e-19   
gb|KDP41393.1|  hypothetical protein JCGZ_15800                       94.4    2e-18   Jatropha curcas
gb|EYU36493.1|  hypothetical protein MIMGU_mgv1a018181mg              89.0    4e-17   Erythranthe guttata [common monkey flower]
ref|XP_002513934.1|  S-adenosylmethionine-dependent methyltransfe...  89.0    8e-17   
ref|XP_008383924.1|  PREDICTED: probable pectin methyltransferase...  87.8    2e-16   Malus domestica [apple tree]
ref|XP_002302304.2|  hypothetical protein POPTR_0002s09820g           87.0    4e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009334333.1|  PREDICTED: probable pectin methyltransferase...  87.0    4e-16   Pyrus x bretschneideri [bai li]
ref|XP_006472585.1|  PREDICTED: probable pectin methyltransferase...  86.3    7e-16   Citrus sinensis [apfelsine]
ref|XP_009372838.1|  PREDICTED: probable pectin methyltransferase...  85.5    1e-15   Pyrus x bretschneideri [bai li]
ref|XP_009334340.1|  PREDICTED: probable pectin methyltransferase...  85.1    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_006433967.1|  hypothetical protein CICLE_v10000463mg           84.3    3e-15   Citrus clementina [clementine]
gb|KDO80996.1|  hypothetical protein CISIN_1g005417mg                 84.3    4e-15   Citrus sinensis [apfelsine]
ref|XP_010535445.1|  PREDICTED: probable pectin methyltransferase...  84.0    4e-15   Tarenaya hassleriana [spider flower]
gb|KHN44795.1|  Putative pectin methyltransferase QUA2                82.8    9e-15   Glycine soja [wild soybean]
ref|XP_003542374.1|  PREDICTED: probable pectin methyltransferase...  82.8    1e-14   Glycine max [soybeans]
ref|XP_011016595.1|  PREDICTED: probable pectin methyltransferase...  82.0    2e-14   Populus euphratica
ref|XP_008372670.1|  PREDICTED: probable pectin methyltransferase...  82.0    2e-14   
gb|KJB59032.1|  hypothetical protein B456_009G236100                  81.3    3e-14   Gossypium raimondii
gb|KJB59033.1|  hypothetical protein B456_009G236100                  81.3    3e-14   Gossypium raimondii
gb|KJB59030.1|  hypothetical protein B456_009G236100                  81.6    3e-14   Gossypium raimondii
gb|KHG17567.1|  putative pectin methyltransferase QUA2 -like protein  80.9    4e-14   Gossypium arboreum [tree cotton]
ref|XP_002306569.2|  hypothetical protein POPTR_0005s17180g           80.5    6e-14   
ref|XP_010521185.1|  PREDICTED: probable pectin methyltransferase...  79.3    1e-13   Tarenaya hassleriana [spider flower]
ref|XP_011003042.1|  PREDICTED: probable pectin methyltransferase...  79.3    2e-13   Populus euphratica
ref|XP_007225175.1|  hypothetical protein PRUPE_ppa002227mg           78.6    3e-13   Prunus persica
ref|XP_004300652.1|  PREDICTED: probable pectin methyltransferase...  78.2    3e-13   Fragaria vesca subsp. vesca
ref|XP_008219451.1|  PREDICTED: probable pectin methyltransferase...  76.3    1e-12   Prunus mume [ume]
ref|XP_006581532.1|  PREDICTED: probable pectin methyltransferase...  75.9    2e-12   Glycine max [soybeans]
gb|KHN08942.1|  Putative pectin methyltransferase QUA2                75.9    2e-12   Glycine soja [wild soybean]
gb|KHN13350.1|  Putative pectin methyltransferase QUA2                73.6    1e-11   Glycine soja [wild soybean]
ref|XP_003544795.1|  PREDICTED: probable pectin methyltransferase...  73.2    1e-11   Glycine max [soybeans]
ref|XP_007141184.1|  hypothetical protein PHAVU_008G174000g           73.2    2e-11   Phaseolus vulgaris [French bean]
ref|XP_010267469.1|  PREDICTED: probable pectin methyltransferase...  71.6    5e-11   Nelumbo nucifera [Indian lotus]
ref|XP_002285784.1|  PREDICTED: probable pectin methyltransferase...  71.6    5e-11   Vitis vinifera
gb|KHN19772.1|  Putative pectin methyltransferase QUA2                70.9    8e-11   Glycine soja [wild soybean]
ref|XP_010676321.1|  PREDICTED: probable pectin methyltransferase...  70.9    9e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010676338.1|  PREDICTED: probable pectin methyltransferase...  70.9    9e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008466224.1|  PREDICTED: probable pectin methyltransferase...  70.5    1e-10   Cucumis melo [Oriental melon]
ref|XP_003522790.1|  PREDICTED: probable pectin methyltransferase...  69.7    2e-10   Glycine max [soybeans]
ref|XP_004136285.1|  PREDICTED: probable pectin methyltransferase...  68.9    4e-10   Cucumis sativus [cucumbers]
ref|XP_007136263.1|  hypothetical protein PHAVU_009G0319000g          66.6    6e-10   Phaseolus vulgaris [French bean]
ref|XP_011100984.1|  PREDICTED: probable pectin methyltransferase...  67.4    1e-09   Sesamum indicum [beniseed]
ref|XP_004500638.1|  PREDICTED: probable pectin methyltransferase...  66.6    2e-09   
ref|XP_004500637.1|  PREDICTED: probable pectin methyltransferase...  66.6    2e-09   Cicer arietinum [garbanzo]
gb|KJB59916.1|  hypothetical protein B456_009G280800                  65.9    2e-09   Gossypium raimondii
gb|KEH34953.1|  pectin methyltransferase QUA2, putative               66.2    2e-09   Medicago truncatula
gb|KJB59918.1|  hypothetical protein B456_009G280800                  65.9    3e-09   Gossypium raimondii
gb|KJB59917.1|  hypothetical protein B456_009G280800                  65.5    4e-09   Gossypium raimondii
ref|XP_003615127.1|  hypothetical protein MTR_5g064080                62.4    5e-08   Medicago truncatula
ref|XP_004490695.1|  PREDICTED: probable pectin methyltransferase...  60.1    3e-07   Cicer arietinum [garbanzo]
ref|XP_010098612.1|  putative pectin methyltransferase QUA2           59.3    5e-07   Morus notabilis
ref|XP_006300626.1|  hypothetical protein CARUB_v10019895mg           57.0    3e-06   Capsella rubella
ref|XP_010060014.1|  PREDICTED: probable pectin methyltransferase...  56.6    3e-06   
ref|XP_006390005.1|  hypothetical protein EUTSA_v10018220mg           56.6    4e-06   Eutrema salsugineum [saltwater cress]
gb|KJB64256.1|  hypothetical protein B456_010G039800                  53.1    5e-05   Gossypium raimondii
ref|XP_010269315.1|  PREDICTED: probable pectin methyltransferase...  51.2    2e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010269316.1|  PREDICTED: probable pectin methyltransferase...  51.2    3e-04   Nelumbo nucifera [Indian lotus]



>ref|XP_009629595.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
tomentosiformis]
Length=697

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            N     DDSQMKDK EKED + ++SAGDQ+ LS+KFL RIL  D SP+K  + ENG LS+
Sbjct  18   NGPDIWDDSQMKDKTEKEDLERNRSAGDQTPLSIKFLSRILFPDNSPSKQSLGENGLLSD  77

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PFSPG GR+++K+TLLL++LSLV I++LALTGSFWWTISITSSSRG+IYHGYR+L EQV
Sbjct  78   PFSPGTGRNRLKYTLLLIRLSLVVIIILALTGSFWWTISITSSSRGQIYHGYRQLQEQV  136



>ref|XP_009760349.1| PREDICTED: probable pectin methyltransferase QUA2 [Nicotiana 
sylvestris]
Length=697

 Score =   118 bits (295),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            N     DDSQMKDK EKED + +++AGDQ+ LS+KFL R+L  D SP+K  + ENG LS+
Sbjct  18   NGPDIWDDSQMKDKTEKEDLERNRAAGDQTHLSIKFLSRMLFPDNSPSKQSLGENGLLSD  77

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PFSPG GR+++K+TLLL++LSLV I++LALTGSFWWTISITSSSRG+IYHGYR+L EQV
Sbjct  78   PFSPGTGRNRLKYTLLLIRLSLVVIIILALTGSFWWTISITSSSRGQIYHGYRQLQEQV  136



>ref|XP_006367734.1| PREDICTED: probable pectin methyltransferase QUA2-like [Solanum 
tuberosum]
Length=697

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            N   F DDSQMKDKIEKED + ++S GDQ++   KFL RIL  D SP+K+ + ENG LS+
Sbjct  18   NGPDFWDDSQMKDKIEKEDLERNRSPGDQTYSPTKFLCRILFPDNSPSKHNLGENGLLSD  77

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PFSPG GR+++K+ L L++LSLV IV+LALTGSFWWTISITSSSRG IYHGYR+L EQV
Sbjct  78   PFSPGTGRNRLKYALGLIRLSLVGIVLLALTGSFWWTISITSSSRGHIYHGYRQLQEQV  136



>ref|XP_010320179.1| PREDICTED: probable pectin methyltransferase QUA2 [Solanum lycopersicum]
Length=697

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 96/119 (81%), Gaps = 0/119 (0%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            N   F DDSQMKDKIEKED + ++S GD ++   KFL RIL  D SP+K+ + ENG LS+
Sbjct  18   NGPDFWDDSQMKDKIEKEDLERNRSPGDLTYSPTKFLCRILFPDNSPSKHNLGENGLLSD  77

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PFSPG GR+++K+ L+L++LSLV I++LALTGSFWWTISITSSSRG IYHGYR+L EQV
Sbjct  78   PFSPGTGRNRLKYALVLIRLSLVVIILLALTGSFWWTISITSSSRGHIYHGYRQLQEQV  136



>gb|KHG28112.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=697

 Score =   101 bits (251),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K GV+ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGVTENGFASD  76

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSFWWT+SI++ SRG I+HGYRRL EQ+
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSFWWTLSISTLSRGHIFHGYRRLQEQL  135



>gb|KJB64258.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64261.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=630

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSFWWT+SI++ SRG I+HGYRRL EQ+
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSFWWTLSISTLSRGHIFHGYRRLQEQL  135



>gb|KJB64260.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=697

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSFWWT+SI++ SRG I+HGYRRL EQ+
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSFWWTLSISTLSRGHIFHGYRRLQEQL  135



>gb|KJB64259.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=691

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D S++KDK EKED D ++ A DQS+LS++F  R+L  D SP+K G++ENG+ S+
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSLRFPFRLLCPDNSPSKYGITENGFASD  76

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PFS G+ RS+ K T+L LKLSLV IV+LALTGSFWWT+SI++ SRG I+HGYRRL EQ+
Sbjct  77   PFSVGSPRSRHKLTVLFLKLSLVVIVILALTGSFWWTLSISTLSRGHIFHGYRRLQEQL  135



>ref|XP_011074193.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074194.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011074195.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=697

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAG-DQSFLSMKFLLRILSTDKSPTKNGVSENGYLS  450
            NSQ F +DSQMK++ EKED D S++ G D +FLS+KF  R L TD   +K+  SENG++S
Sbjct  19   NSQDFWEDSQMKERTEKEDLDRSRANGADNTFLSLKFPFRYLFTDNLSSKH-FSENGFMS  77

Query  451  NPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            +PFSPG  RS+ K TL LLK SLV IV+LALTGSFWWT+SITS++RG+I+ GYRRL EQ+
Sbjct  78   DPFSPGPLRSRHKVTLTLLKFSLVVIVILALTGSFWWTLSITSTTRGQIFRGYRRLQEQL  137



>ref|XP_007018751.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY15976.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=658

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D SQ+K K EK+D D ++S  DQS+LS++F  R+L  D SP K+GV+ENG+ S+
Sbjct  17   NSNDFWD-SQVKAKTEKDDLDRNRSP-DQSYLSLRFPFRLLFPDSSPLKHGVTENGFASD  74

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PFS G  RS+ K T+L LKLSL+ IV+LALTGSFWWTISI++SSRG I+HGYRRL EQ+
Sbjct  75   PFSVGTPRSRHKLTMLFLKLSLIVIVILALTGSFWWTISISTSSRGHIFHGYRRLQEQL  133



>emb|CDP01069.1| unnamed protein product [Coffea canephora]
Length=696

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  292  DDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGA  471
            DDSQMKDK+EKED D      DQ++LS++   R L TD S +K+G+ ENG++S+PFSPG 
Sbjct  22   DDSQMKDKLEKEDVDRKSPNADQTYLSIRQPFRFLLTDNSSSKHGLMENGFVSDPFSPGV  81

Query  472  GRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
             R++ K TLLLL+LSLV IV+LALTGSFWWTISIT+SSRG++Y GYRRL +Q+
Sbjct  82   LRNRHKRTLLLLRLSLVVIVILALTGSFWWTISITTSSRGQVYRGYRRLQQQL  134



>ref|XP_007018750.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY15975.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=695

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D SQ+K K EK+D D ++S  DQS+LS++F  R+L  D SP K+GV+ENG+ S+
Sbjct  17   NSNDFWD-SQVKAKTEKDDLDRNRSP-DQSYLSLRFPFRLLFPDSSPLKHGVTENGFASD  74

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PFS G  RS+ K T+L LKLSL+ IV+LALTGSFWWTISI++SSRG I+HGYRRL EQ+
Sbjct  75   PFSVGTPRSRHKLTMLFLKLSLIVIVILALTGSFWWTISISTSSRGHIFHGYRRLQEQL  133



>gb|KDP41393.1| hypothetical protein JCGZ_15800 [Jatropha curcas]
Length=690

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 3/120 (3%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLS  450
            NSQ  L DSQMKDK EKED D ++S+ DQS+L++KF LR+L  D  SP+K G  ENG+ S
Sbjct  16   NSQE-LWDSQMKDKTEKEDLDRNRSS-DQSYLALKFPLRVLFPDNSSPSKYGTGENGFAS  73

Query  451  NPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            +PFS G  RS+ KFTLLLLKLSL  I+VLALTGSFWWTISI++SSR +I H YRRL EQ+
Sbjct  74   DPFSIGTPRSRHKFTLLLLKLSLAVILVLALTGSFWWTISISTSSRVQILHNYRRLQEQL  133



>gb|EYU36493.1| hypothetical protein MIMGU_mgv1a018181mg, partial [Erythranthe 
guttata]
Length=497

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAG-DQSFLSMKFLLRILSTDKSPTKNGVSENGYLS  450
            NS    +DSQMK++ +KED D  ++ G D +  S+KFL R L  D   +K+G++EN ++S
Sbjct  21   NSHDLWEDSQMKERPDKEDVDPKRTNGADHTHSSIKFLFRYLFPDNLSSKHGLNENSFMS  80

Query  451  NPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            +PFSPG  RS+ K TL  LKLSLV IV+LALTGSF+WT+SITS+SRG+I+ GYRRL EQV
Sbjct  81   DPFSPGPTRSRHKVTLSFLKLSLVVIVILALTGSFYWTLSITSTSRGQIFRGYRRLQEQV  140



>ref|XP_002513934.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48517.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=656

 Score = 89.0 bits (219),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 93/115 (81%), Gaps = 2/115 (2%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSP  465
            L DSQMKDK EKE+ + ++S+ DQS+L+++F  R+L  D  SP+K G +ENG  S+PFS 
Sbjct  21   LWDSQMKDKPEKEELEKNRSS-DQSYLALRFPFRVLFPDNVSPSKYGSTENGIASDPFSI  79

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            G  RS+ KFTLLLLKLSLV I+VLALTGSFWWTISIT+SSRG+I+H YRRL EQ+
Sbjct  80   GTPRSRHKFTLLLLKLSLVVILVLALTGSFWWTISITTSSRGQIFHNYRRLQEQL  134



>ref|XP_008383924.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008383925.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 88/112 (79%), Gaps = 1/112 (1%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQMKDK +KED D   S+ + SF + KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASSDNNSF-AFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ K TLLLLKLSLV IV+LALTGSFWWT+SI+++SRG IYHGYRRL +Q+
Sbjct  82   RSRHKLTLLLLKLSLVLIVILALTGSFWWTLSISTTSRGHIYHGYRRLQQQL  133



>ref|XP_002302304.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
 gb|EEE81577.2| hypothetical protein POPTR_0002s09820g [Populus trichocarpa]
Length=694

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL-STDKSPTKNGVSENGYLSNPFSP  465
            L DSQMKDK EKED D ++S+ DQS+L+++F  R+L   + SP+K G  ENG+ S+PF  
Sbjct  21   LWDSQMKDKTEKEDLDRNRSS-DQSYLALRFPFRVLFPENNSPSKYGSGENGFASDPFIV  79

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            G+ RS+ K+ LLLLKLSL  IV+LALTGSFWWTISIT+ SRG+I H YRRL EQ+
Sbjct  80   GSPRSRHKWALLLLKLSLAVIVILALTGSFWWTISITTMSRGQILHNYRRLQEQL  134



>ref|XP_009334333.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334334.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334335.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQMKDK +KED D   S+ + S L+ KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASSDNNS-LAFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ K  LLLLKLSLV IV+LALTGSFWWT+SI+++SRG IYHGYRRL +Q+
Sbjct  82   RSRHKLALLLLKLSLVLIVILALTGSFWWTLSISTTSRGHIYHGYRRLQQQL  133



>ref|XP_006472585.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Citrus sinensis]
 ref|XP_006472586.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Citrus sinensis]
Length=697

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 87/114 (76%), Gaps = 3/114 (3%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  468
            DS+MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DSEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  469  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRL EQ+
Sbjct  82   TPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQL  135



>ref|XP_009372838.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372846.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009372855.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 90/118 (76%), Gaps = 2/118 (2%)
 Frame = +1

Query  277  SQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNP  456
            S  FLD SQMKDK +KED D   S+ + SF + +  +R+L  D SP+K+G +ENG+ S+P
Sbjct  18   SNDFLD-SQMKDKTDKEDLDRRASSDNNSF-AFRLPVRVLFPDNSPSKHGNTENGFASDP  75

Query  457  FSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            F  G  RS+ K  LLLLKLSLV IV+LALTGSFWWT+SI+++SRG+I+HGYRRL EQ+
Sbjct  76   FMAGTPRSRHKLMLLLLKLSLVLIVILALTGSFWWTLSISTTSRGRIHHGYRRLQEQL  133



>ref|XP_009334340.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334341.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
 ref|XP_009334342.1| PREDICTED: probable pectin methyltransferase QUA2 [Pyrus x bretschneideri]
Length=695

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 87/112 (78%), Gaps = 1/112 (1%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            +SQMKDK +KED D   S+ + S L+ KF +R+L  D SP+K+G +ENG+ S+PF  G  
Sbjct  23   NSQMKDKTDKEDLDRRASSDNNS-LAFKFPIRVLFPDNSPSKHGNTENGFTSDPFMAGTP  81

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ K  LLLLKLSLV IV+LALTGSFWWT+SI+++SRG IYHGYRRL +Q+
Sbjct  82   RSRHKLALLLLKLSLVLIVILALTGSFWWTLSISTTSRGHIYHGYRRLQQQL  133



>ref|XP_006433967.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
 gb|ESR47207.1| hypothetical protein CICLE_v10000463mg [Citrus clementina]
Length=697

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 3/114 (3%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  468
            D +MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  469  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRL EQ+
Sbjct  82   TPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQL  135



>gb|KDO80996.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
 gb|KDO80997.1| hypothetical protein CISIN_1g005417mg [Citrus sinensis]
Length=697

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 86/114 (75%), Gaps = 3/114 (3%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK--SPTKNGVSENGYLSNPFSPG  468
            D +MK++ EKED +   S  DQS+L+++F  R LS D   SP+K G+SENG+ S+ FS G
Sbjct  23   DLEMKERNEKEDLEKDHST-DQSYLALRFPFRFLSHDNNTSPSKYGISENGFTSDIFSSG  81

Query  469  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              RS+  FT+L LK SL+AIV LALTGSFWWTISI++SSRG IYHGYRRL EQ+
Sbjct  82   TPRSRQNFTMLFLKFSLIAIVFLALTGSFWWTISISTSSRGHIYHGYRRLQEQL  135



>ref|XP_010535445.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=689

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  468
            L DSQMKDK EK D D S+S  D +FL+++F    L ++ S  KNG++ENG+ S+P+  G
Sbjct  21   LWDSQMKDKTEKGDLDRSRSM-DNTFLALRFPFGFLFSNHSSPKNGINENGFASDPYISG  79

Query  469  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              RS+ +  +LLLK+SLV IV++ALTGSFWWTISI++SSRG IYH YRRL EQ+
Sbjct  80   TARSRHRLMMLLLKISLVVIVIVALTGSFWWTISISTSSRGHIYHNYRRLQEQL  133



>gb|KHN44795.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=670

 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 88/116 (76%), Gaps = 3/116 (3%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  462
            L DSQ KDK EKED D ++ + D S  +++F LR+L  + S +K  NG++ENG+ S+PF 
Sbjct  23   LWDSQSKDKTEKEDLD-TRGSSDHSPFTLRFPLRVLLGNNSDSKYGNGIAENGFASDPFM  81

Query  463  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
             G  RS++K  LL LK SLV IVVLALTGSFWWT+SI+SSSRG+IYHGYRRL E++
Sbjct  82   VGTPRSRLKLMLLSLKFSLVFIVVLALTGSFWWTLSISSSSRGQIYHGYRRLQEKL  137



>ref|XP_003542374.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006593562.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=694

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 88/116 (76%), Gaps = 3/116 (3%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  462
            L DSQ KDK EKED D ++ + D S  +++F LR+L  + S +K  NG++ENG+ S+PF 
Sbjct  23   LWDSQSKDKTEKEDLD-TRGSSDHSPFTLRFPLRVLLGNNSDSKYGNGIAENGFASDPFM  81

Query  463  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
             G  RS++K  LL LK SLV IVVLALTGSFWWT+SI+SSSRG+IYHGYRRL E++
Sbjct  82   VGTPRSRLKLMLLSLKFSLVFIVVLALTGSFWWTLSISSSSRGQIYHGYRRLQEKL  137



>ref|XP_011016595.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
 ref|XP_011016602.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=693

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 87/115 (76%), Gaps = 2/115 (2%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDK-SPTKNGVSENGYLSNPFSP  465
            L DSQMKDK EKED D ++S+ DQS+L+++F  R+L  D  SP+K G  ENG+ S+PF  
Sbjct  21   LWDSQMKDKTEKEDLDRNRSS-DQSYLALRFPFRVLFPDNNSPSKYGSGENGFASDPFIV  79

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            G+ RS+ K  LLLLKLSL  IV+LAL GSFWWTISIT+ SRG+I H YRRL EQ+
Sbjct  80   GSPRSRHKLALLLLKLSLAVIVILALAGSFWWTISITTMSRGQILHNYRRLQEQL  134



>ref|XP_008372670.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
 ref|XP_008372733.1| PREDICTED: probable pectin methyltransferase QUA2 [Malus domestica]
Length=695

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQMKDK +KED D   S+ + SF + +  +R+L  D SP+K G +ENG+ S+PF  G  
Sbjct  23   DSQMKDKTDKEDLDRRASSDNNSF-AFRMPIRVLFPDNSPSKXGNTENGFASDPFMAGTP  81

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ K  LLLLKLSLV IV+LALTGSFWWT+SI+++SRG I+HGYRRL +Q+
Sbjct  82   RSRHKLMLLLLKLSLVLIVILALTGSFWWTLSISTTSRGHIHHGYRRLQQQL  133



>gb|KJB59032.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=597

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PF  G  RS+ + T+L LKLSLV IV+LALTGSFWWTISI++SSRG I+ GYRRL EQ+
Sbjct  75   PFGGGTPRSRHRLTMLFLKLSLVVIVILALTGSFWWTISISTSSRGHIFRGYRRLQEQL  133



>gb|KJB59033.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
 gb|KJB59034.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=644

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSS-SQSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PF  G  RS+ + T+L LKLSLV IV+LALTGSFWWTISI++SSRG I+ GYRRL EQ+
Sbjct  75   PFGGGTPRSRHRLTMLFLKLSLVVIVILALTGSFWWTISISTSSRGHIFRGYRRLQEQL  133



>gb|KJB59030.1| hypothetical protein B456_009G236100 [Gossypium raimondii]
Length=696

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 87/119 (73%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D +++KD  EKED D + S+  QSFLS++   R    D SP+K GV+ENG+ ++
Sbjct  17   NSNDFWD-AEVKDNTEKEDLDRNHSSS-QSFLSLRSPFRFFFQDNSPSKYGVTENGFTAD  74

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PF  G  RS+ + T+L LKLSLV IV+LALTGSFWWTISI++SSRG I+ GYRRL EQ+
Sbjct  75   PFGGGTPRSRHRLTMLFLKLSLVVIVILALTGSFWWTISISTSSRGHIFRGYRRLQEQL  133



>gb|KHG17567.1| putative pectin methyltransferase QUA2 -like protein [Gossypium 
arboreum]
Length=696

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D +++KDK EKE+ D + S+  QSFLS++   R+   D SP K GV+ENG+ S+
Sbjct  17   NSNDFWD-AEVKDKTEKEESDRNHSSS-QSFLSLRSPFRLFFQDNSPPKYGVTENGFTSD  74

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            PF  G  RS+ + T+L LKLSLV IV+LALTGSFWWTISI++SSRG I+ GYRRL EQ+
Sbjct  75   PFRGGTPRSRHRLTMLFLKLSLVVIVILALTGSFWWTISISTSSRGHIFRGYRRLQEQL  133



>ref|XP_002306569.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
 gb|EEE93565.2| hypothetical protein POPTR_0005s17180g [Populus trichocarpa]
Length=718

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTD-KSPTKNGVSENGYLSNPFSP  465
            L DSQMKDK EKED D ++S+ DQS+L++KF  R+L  D  SP+K    E+G+ S+PFS 
Sbjct  45   LWDSQMKDKTEKEDMDRNRSS-DQSYLALKFPFRVLFPDNNSPSKYVNGESGFASDPFSV  103

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            G+ RS+ K TLLLLKLSL  IVVLALTGSFWWTISI++ SRG+I H YRRL EQ+
Sbjct  104  GSPRSRHKLTLLLLKLSLAVIVVLALTGSFWWTISISTLSRGQILHTYRRLQEQL  158



>ref|XP_010521185.1| PREDICTED: probable pectin methyltransferase QUA2 [Tarenaya hassleriana]
Length=696

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  468
            L DSQMKDKIEKED + S+S  D + L+++     L  + S +KNG+SENG  S+P+S  
Sbjct  21   LWDSQMKDKIEKEDLNRSRSM-DNTSLALRSPFGFLFNNHSSSKNGISENGVTSDPYSGS  79

Query  469  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              RS+ +F LL LK+SLV IVV+ALTGSF WTI+I+SSSRG IYH YRRL EQ+
Sbjct  80   NSRSRQRFMLLFLKISLVGIVVVALTGSFLWTIAISSSSRGHIYHNYRRLQEQL  133



>ref|XP_011003042.1| PREDICTED: probable pectin methyltransferase QUA2 [Populus euphratica]
Length=694

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL-STDKSPTKNGVSENGYLSNPFSP  465
            L DSQMKDK EKED D ++S+ DQS+L++KF  R+L   + SP+K    E+G+ S+PFS 
Sbjct  21   LWDSQMKDKTEKEDMDSNRSS-DQSYLALKFPFRVLFPYNNSPSKYVNGESGFASDPFSV  79

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            G+ RS+ K TLLLLKLSL  IVVLALTGSFWWTISI++ SRG+I H YRRL EQ+
Sbjct  80   GSPRSRHKLTLLLLKLSLAVIVVLALTGSFWWTISISTLSRGQILHTYRRLQEQL  134



>ref|XP_007225175.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
 gb|EMJ26374.1| hypothetical protein PRUPE_ppa002227mg [Prunus persica]
Length=698

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 101/138 (73%), Gaps = 2/138 (1%)
 Frame = +1

Query  217  MARPlhrglsvggggrhsgNSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRIL  396
            M+RPLHRG S   G R SGNS  F D SQMKDK +KED +   S+ D + ++ +F +R+L
Sbjct  1    MSRPLHRGSSGAAGERISGNSNDFWD-SQMKDKTDKEDLERRASS-DNNSIAFRFPIRVL  58

Query  397  STDKSPTKNGVSENGYLSNPFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisit  576
              D SP+K+G + NG+ S+P      RS+ K  LLLLKLSLV IV+LALTGSFWWTISI+
Sbjct  59   FPDNSPSKHGNTGNGFASDPLIASTPRSRHKLALLLLKLSLVLIVILALTGSFWWTISIS  118

Query  577  sssRGKIYHGYRRLXEQV  630
            ++SRG++YHGYRRL +Q+
Sbjct  119  TTSRGRVYHGYRRLQQQL  136



>ref|XP_004300652.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465516.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465517.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465518.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011465519.1| PREDICTED: probable pectin methyltransferase QUA2 [Fragaria vesca 
subsp. vesca]
Length=693

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQMKDK +KED D   S+ DQ+  S +  +R+L  + SP+K GV ENG+ S P    + 
Sbjct  20   DSQMKDKTDKEDLDRRASS-DQNSFSFRIPVRLLLGENSPSKQGVGENGFASEPLLAVSP  78

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ K  LLLLKLSLV IV+ ALTGSFWWTISI+++SRG IYHGYRRL +Q+
Sbjct  79   RSRHKLALLLLKLSLVLIVIFALTGSFWWTISISTTSRGHIYHGYRRLQQQL  130



>ref|XP_008219451.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
 ref|XP_008219452.1| PREDICTED: probable pectin methyltransferase QUA2 [Prunus mume]
Length=698

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 85/112 (76%), Gaps = 1/112 (1%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQMKDK +KED +   S+ D + ++ +F +R+L  D SP+K+G + NG+ S+P      
Sbjct  26   DSQMKDKTDKEDLERRASS-DNNSIAFRFPIRVLFPDNSPSKHGNTGNGFASDPLIASTP  84

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ K  LLLLKLSLV IV+LALTGSFWWTISI+++SRG++YHGYRRL +Q+
Sbjct  85   RSRHKLALLLLKLSLVLIVILALTGSFWWTISISTTSRGRVYHGYRRLQQQL  136



>ref|XP_006581532.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Glycine max]
 ref|XP_006581533.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
 ref|XP_006581534.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X3 [Glycine max]
 ref|XP_006581535.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X4 [Glycine max]
Length=690

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  468
            L DSQ KDK EKE  D   S+G  S L   F  R+L +D S +K G+SENG+ S+PF  G
Sbjct  21   LWDSQSKDKSEKEGLDRRGSSGHPSPLRSPF--RLLFSDNSNSKYGISENGFSSDPFIIG  78

Query  469  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              RS++K  LL L+ SLV IV+LAL GSFWWTISI+++SRG IYHGYRRL E++
Sbjct  79   TPRSRLKLVLLFLRFSLVFIVILALAGSFWWTISISTASRGHIYHGYRRLQEKL  132



>gb|KHN08942.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 81/114 (71%), Gaps = 2/114 (2%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  468
            L DSQ KDK EKE  D   S+G  S L   F  R+L +D S +K G+SENG+ S+PF  G
Sbjct  21   LWDSQSKDKSEKEGLDRRGSSGHPSPLRSPF--RLLFSDNSNSKYGISENGFSSDPFIIG  78

Query  469  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              RS++K  LL L+ SLV IV+LAL GSFWWTISI+++SRG IYHGYRRL E++
Sbjct  79   TPRSRLKLVLLFLRFSLVFIVILALAGSFWWTISISTASRGHIYHGYRRLQEKL  132



>gb|KHN13350.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=693

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNG--VSENGYLSNPFS  462
            L DSQ KDKIEKED D   SA D S  +++F LR+L  + S +K G   +ENG+ S+PF 
Sbjct  22   LWDSQSKDKIEKEDLDRRGSA-DHSPFALRFPLRVLLGNNSESKYGNVKAENGFASDPFM  80

Query  463  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
             G  RS +K  LL LK SLV IVVLALTGSFWWT+SI+SSSRG IYHGYRRL E++
Sbjct  81   VGTPRSLLKLMLLSLKFSLVFIVVLALTGSFWWTLSISSSSRGHIYHGYRRLQEKL  136



>ref|XP_003544795.1| PREDICTED: probable pectin methyltransferase QUA2-like isoformX1 
[Glycine max]
 ref|XP_006596348.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Glycine max]
Length=693

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNG--VSENGYLSNPFS  462
            L DSQ KDKIEKED D   SA D S  +++F LR+L  + S +K G   +ENG+ S+PF 
Sbjct  22   LWDSQSKDKIEKEDLDKRGSA-DHSPFALRFPLRVLLGNNSESKYGNVKAENGFASDPFM  80

Query  463  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
             G  RS +K  LL LK SLV IVVLALTGSFWWT+SI+SSSRG IYHGYRRL E++
Sbjct  81   VGTPRSLLKLMLLSLKFSLVFIVVLALTGSFWWTLSISSSSRGHIYHGYRRLQEKL  136



>ref|XP_007141184.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
 gb|ESW13178.1| hypothetical protein PHAVU_008G174000g [Phaseolus vulgaris]
Length=693

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 84/116 (72%), Gaps = 3/116 (3%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTK--NGVSENGYLSNPFS  462
            L DSQ KDK EKED D   S+ D S L+++F L +L  + S +K  NG+ ENG+ S+ F 
Sbjct  22   LWDSQSKDKTEKEDLDKRGSS-DHSPLALRFPLGLLLGNNSDSKYGNGIGENGFASDSFI  80

Query  463  PGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              + RS++K  LL LK SLV IVVLALTGSFWWT+SI+SSSRG IYHGYRRL E++
Sbjct  81   VSSPRSRLKLMLLSLKFSLVVIVVLALTGSFWWTLSISSSSRGHIYHGYRRLQEKL  136



>ref|XP_010267469.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
 ref|XP_010267476.1| PREDICTED: probable pectin methyltransferase QUA2 [Nelumbo nucifera]
Length=700

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 60/115 (52%), Positives = 86/115 (75%), Gaps = 3/115 (3%)
 Frame = +1

Query  295  DSQMKDK---IEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSP  465
            DSQMK +    EKED D ++S+ D + LS++FL+ +   D S  K+G+++NG+ S+PF+ 
Sbjct  25   DSQMKSRSPRTEKEDVDRNRSSPDHTSLSLRFLVNLFFPDNSSFKSGLTDNGFGSDPFNM  84

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            G+ RS+   TLL L++SLV IV+LAL+GS WWTISI++SSRG I+ GYRRL EQ+
Sbjct  85   GSSRSRQNLTLLFLRISLVLIVILALSGSLWWTISISTSSRGYIFRGYRRLQEQL  139



>ref|XP_002285784.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 ref|XP_010664337.1| PREDICTED: probable pectin methyltransferase QUA2 [Vitis vinifera]
 emb|CBI19170.3| unnamed protein product [Vitis vinifera]
Length=696

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 4/114 (4%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQMK K EKED + ++S+ D + LS KF   +   D S +K+G+SENG+ S+ FS G+ 
Sbjct  23   DSQMKVKTEKEDSEKNRSS-DHTCLSFKFP-SVPFPDNSSSKHGISENGFASDTFSAGSP  80

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIY--HGYRRLXEQV  630
            RS+ K T+L+LKLSLV IVVLALTGSF WTISIT+SSRG+I+  HGYRRL EQ+
Sbjct  81   RSRHKLTMLVLKLSLVLIVVLALTGSFLWTISITTSSRGQIFHSHGYRRLYEQL  134



>gb|KHN19772.1| Putative pectin methyltransferase QUA2 [Glycine soja]
Length=690

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 76/114 (67%), Gaps = 2/114 (2%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  468
            L DSQ KDK EKE  D   S G  S L   F  R+L +D S  K G+ ENG+ S+PF  G
Sbjct  21   LWDSQSKDKTEKEGLDRRGSFGHPSPLRSPF--RLLFSDNSNPKYGIGENGFSSDPFIIG  78

Query  469  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              RS+ K  LL LK SLV IV+LAL GSFWWTISI+++SRG IYHGYRRL E +
Sbjct  79   TPRSRHKLVLLFLKFSLVLIVILALAGSFWWTISISTASRGHIYHGYRRLQENL  132



>ref|XP_010676321.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010676329.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=697

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQMK+K EK+D   S+S  DQ + S+K    + S D   +K GV+ENG+ ++ FS  + 
Sbjct  28   DSQMKEKSEKDDTRASRSLSDQGYSSLKLPFHLNSLDNGHSKLGVNENGFTTDLFSSKSP  87

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            R++ KF LL+L++SLV IV+LALTGSFWWTISI++SSRG I+H YRRL EQ+
Sbjct  88   RNRHKFILLMLRISLVFIVILALTGSFWWTISISTSSRGHIFHSYRRLQEQL  139



>ref|XP_010676338.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=666

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQMK+K EK+D   S+S  DQ + S+K    + S D   +K GV+ENG+ ++ FS  + 
Sbjct  28   DSQMKEKSEKDDTRASRSLSDQGYSSLKLPFHLNSLDNGHSKLGVNENGFTTDLFSSKSP  87

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            R++ KF LL+L++SLV IV+LALTGSFWWTISI++SSRG I+H YRRL EQ+
Sbjct  88   RNRHKFILLMLRISLVFIVILALTGSFWWTISISTSSRGHIFHSYRRLQEQL  139



>ref|XP_008466224.1| PREDICTED: probable pectin methyltransferase QUA2 [Cucumis melo]
Length=690

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQMKDK +KE+ D   S      L+ +   R+L  D SP+K+G +ENG+ S+ F  G  
Sbjct  23   DSQMKDKTDKEEVDRKGSLDHGGNLAPRLPFRLLLPDNSPSKHGGTENGFASDSFLVGNS  82

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ +F L +L+LSLV I++LALTGSFWWT+SI+ SS+ +I+HGYRRL EQ+
Sbjct  83   RSRQQFILQMLRLSLVLIIILALTGSFWWTLSISGSSQVQIFHGYRRLQEQL  134



>ref|XP_003522790.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
1 [Glycine max]
Length=690

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 77/114 (68%), Gaps = 2/114 (2%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  468
            L DSQ KDK EKE  D   S G  S L   F  ++L +D S +K G+ ENG+ S+PF  G
Sbjct  21   LWDSQSKDKTEKEGLDRRGSFGHPSPLRSPF--KLLFSDNSNSKYGIGENGFSSDPFIIG  78

Query  469  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              RS+ K  LL LK SLV IV+LAL GSFWWTISI+++SRG IYHGYRRL E +
Sbjct  79   TPRSRHKLVLLFLKFSLVFIVILALAGSFWWTISISTASRGHIYHGYRRLQENL  132



>ref|XP_004136285.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cucumis 
sativus]
 ref|XP_004160281.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cucumis 
sativus]
 gb|KGN60218.1| hypothetical protein Csa_3G889740 [Cucumis sativus]
Length=690

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 78/112 (70%), Gaps = 0/112 (0%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQMKDK +KE+ D   S      L+ +   R+L  D SP+K G +ENG+ S+ F  G  
Sbjct  23   DSQMKDKTDKEEVDRKGSLDHGGNLAPRLPFRLLLPDNSPSKYGGTENGFASDSFLVGNS  82

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ +F L +L+ SLV I++LALTGSFWWT+SI+ SS+ +I+HGYRRL EQ+
Sbjct  83   RSRQQFILQMLRFSLVLIIILALTGSFWWTLSISGSSQVQIFHGYRRLQEQL  134



>ref|XP_007136263.1| hypothetical protein PHAVU_009G0319000g, partial [Phaseolus vulgaris]
 ref|XP_007136264.1| hypothetical protein PHAVU_009G0319000g, partial [Phaseolus vulgaris]
 gb|ESW08257.1| hypothetical protein PHAVU_009G0319000g, partial [Phaseolus vulgaris]
 gb|ESW08258.1| hypothetical protein PHAVU_009G0319000g, partial [Phaseolus vulgaris]
Length=285

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 76/112 (68%), Gaps = 5/112 (4%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQ KDK EKE FD   S+   S L       +L +D S +K G++ENG LS+P+  G  
Sbjct  22   DSQSKDKTEKEGFDKRFSSPHPSPLR-----SLLLSDNSNSKLGITENGLLSDPYIIGTP  76

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            R++ K  L  LK SLV +V+LAL GSFWWTISI+++SRG IYHGYRRL EQ+
Sbjct  77   RNRHKLILFFLKFSLVFVVILALAGSFWWTISISTASRGHIYHGYRRLHEQL  128



>ref|XP_011100984.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011100985.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
 ref|XP_011100986.1| PREDICTED: probable pectin methyltransferase QUA2 [Sesamum indicum]
Length=693

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 80/115 (70%), Gaps = 4/115 (3%)
 Frame = +1

Query  286  FLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSP  465
            F +D QMK++IEK+  + + S    ++LS K+  R L T+   + + + ++G++S+PF P
Sbjct  23   FSEDCQMKERIEKDRTNGAVS----TYLSSKYPFRFLFTNNLSSNHSLGDHGFISDPFGP  78

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
             A RS  K TL LLK SL  IV+LAL GSFWWT+S+TS SRG+I HGYRRL EQ+
Sbjct  79   RAPRSLHKVTLCLLKFSLAVIVILALIGSFWWTLSVTSMSRGQIVHGYRRLQEQL  133



>ref|XP_004500638.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X2 [Cicer arietinum]
Length=659

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQ KDK EK+  D   S+ D S L +K   R+L  D S  KNG++ENG+  +PF  G  
Sbjct  23   DSQSKDKTEKDGLDKKGSS-DPSPLPLKSPFRLLFADNS--KNGITENGFSPDPFILGTP  79

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ K  LL +K S+V IV+LAL GSFWWT+SI+++SRG I+HGYRRL E++
Sbjct  80   RSRHKLILLFMKFSIVFIVILALAGSFWWTVSISTTSRGHIFHGYRRLQEKL  131



>ref|XP_004500637.1| PREDICTED: probable pectin methyltransferase QUA2-like isoform 
X1 [Cicer arietinum]
Length=689

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 78/112 (70%), Gaps = 3/112 (3%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQ KDK EK+  D   S+ D S L +K   R+L  D S  KNG++ENG+  +PF  G  
Sbjct  23   DSQSKDKTEKDGLDKKGSS-DPSPLPLKSPFRLLFADNS--KNGITENGFSPDPFILGTP  79

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ K  LL +K S+V IV+LAL GSFWWT+SI+++SRG I+HGYRRL E++
Sbjct  80   RSRHKLILLFMKFSIVFIVILALAGSFWWTVSISTTSRGHIFHGYRRLQEKL  131



>gb|KJB59916.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=432

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 82/115 (71%), Gaps = 8/115 (7%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSP  465
            L DSQ+K++ EKE+FD +QS       S +F    L +D SP TK   ++NG+ S+PF+ 
Sbjct  21   LLDSQVKEQTEKEEFDRNQS-------SHRFPFWSLFSDNSPLTKYDATDNGFASDPFTV  73

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            G  RS+ + T+LLLK SLV IV+LALTGSFWWT+SI++SSRG I+H  RRL EQ+
Sbjct  74   GTPRSRHRLTMLLLKSSLVVIVILALTGSFWWTLSISTSSRGHIFHSSRRLQEQL  128



>gb|KEH34953.1| pectin methyltransferase QUA2, putative [Medicago truncatula]
Length=693

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (70%), Gaps = 2/113 (2%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSPGA  471
            DSQ KDK EK+  D   S+ DQS L +    R+L  D S  +K GV+ENG+  +PF  G 
Sbjct  23   DSQSKDKTEKDGLDRRGSS-DQSPLHLSSPFRLLFADNSSHSKFGVTENGFSPDPFILGT  81

Query  472  GRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
             RS+ K  LL +K S+V IV+LAL GSFWWT+SI+++SRG+IYHGYRRL E++
Sbjct  82   PRSRHKLILLFMKFSIVLIVILALAGSFWWTVSISTTSRGQIYHGYRRLQEKL  134



>gb|KJB59918.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=690

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 82/115 (71%), Gaps = 8/115 (7%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSP  465
            L DSQ+K++ EKE+FD +QS+    F S       L +D SP TK   ++NG+ S+PF+ 
Sbjct  21   LLDSQVKEQTEKEEFDRNQSSHRFPFWS-------LFSDNSPLTKYDATDNGFASDPFTV  73

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            G  RS+ + T+LLLK SLV IV+LALTGSFWWT+SI++SSRG I+H  RRL EQ+
Sbjct  74   GTPRSRHRLTMLLLKSSLVVIVILALTGSFWWTLSISTSSRGHIFHSSRRLQEQL  128



>gb|KJB59917.1| hypothetical protein B456_009G280800 [Gossypium raimondii]
Length=592

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 82/115 (71%), Gaps = 8/115 (7%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSP-TKNGVSENGYLSNPFSP  465
            L DSQ+K++ EKE+FD +QS       S +F    L +D SP TK   ++NG+ S+PF+ 
Sbjct  21   LLDSQVKEQTEKEEFDRNQS-------SHRFPFWSLFSDNSPLTKYDATDNGFASDPFTV  73

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            G  RS+ + T+LLLK SLV IV+LALTGSFWWT+SI++SSRG I+H  RRL EQ+
Sbjct  74   GTPRSRHRLTMLLLKSSLVVIVILALTGSFWWTLSISTSSRGHIFHSSRRLQEQL  128



>ref|XP_003615127.1| hypothetical protein MTR_5g064080 [Medicago truncatula]
 gb|AES98085.1| S-adenosylmethionine-dependent methyltransferase, putative [Medicago 
truncatula]
Length=675

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 78/112 (70%), Gaps = 10/112 (9%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQ KDK EK+DFD   S+ D + L+++  L++ S DK        ENG+ S+P S G+ 
Sbjct  25   DSQSKDKSEKDDFDRRGSS-DHTPLALRSPLKLFS-DK--------ENGFASDPISVGSP  74

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ K  + L+K SLV IVV AL GSF WT++++SSSRG++YHGYRRL E++
Sbjct  75   RSRFKLMMFLVKFSLVFIVVFALVGSFLWTLNLSSSSRGRVYHGYRRLQEKL  126



>ref|XP_004490695.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cicer 
arietinum]
 ref|XP_004505832.1| PREDICTED: probable pectin methyltransferase QUA2-like [Cicer 
arietinum]
Length=683

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 9/112 (8%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAG  474
            DSQ KDK EK+DFD  +   D + L+++  LR   +DK        E+ ++S+PF  G  
Sbjct  24   DSQSKDKTEKDDFD-KRGVSDHTPLALRSPLRFFFSDK--------ESNFVSDPFIVGTP  74

Query  475  RSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            RS+ K  LL LK SLV IVVLAL GSF+WT+++++SSR ++YHGYRRL E++
Sbjct  75   RSRFKLMLLSLKFSLVFIVVLALVGSFYWTLTLSTSSRVRVYHGYRRLQEKL  126



>ref|XP_010098612.1| putative pectin methyltransferase QUA2 [Morus notabilis]
 gb|EXB75351.1| putative pectin methyltransferase QUA2 [Morus notabilis]
Length=696

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 78/113 (69%), Gaps = 2/113 (2%)
 Frame = +1

Query  295  DSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTD-KSPTKNGVSENGYLSNPFSPGA  471
            DSQM D+ EKED D   S+ DQ   SM+  LR++  D  SP+K G SENG+ S+      
Sbjct  23   DSQMIDRTEKEDLDRRGSS-DQGSFSMRMPLRVVFPDNNSPSKYGNSENGFSSDSLISNT  81

Query  472  GRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
             R++ K TLLLLKLSL  ++V+AL GSFWWTISI++SSRG I  GYRRL EQ+
Sbjct  82   PRNRHKLTLLLLKLSLALVIVIALFGSFWWTISISTSSRGHISLGYRRLQEQL  134



>ref|XP_006300626.1| hypothetical protein CARUB_v10019895mg [Capsella rubella]
 gb|EOA33524.1| hypothetical protein CARUB_v10019895mg [Capsella rubella]
Length=687

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 78/110 (71%), Gaps = 6/110 (5%)
 Frame = +1

Query  301  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRS  480
            QMKDK +KED    +S   +S L+++F    L ++ S +K+G  ENG+ ++P+S    RS
Sbjct  25   QMKDKTDKEDLARGRST--ESHLTLRFPFAFLFSNHSSSKHG-GENGFPADPYS---ARS  78

Query  481  QIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            + +  L+ LK+SLV IVV+AL GSFWWTISI++SSRG +YH YRRL EQ+
Sbjct  79   RHRLMLMFLKISLVLIVVVALAGSFWWTISISTSSRGHVYHNYRRLQEQL  128



>ref|XP_010060014.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 ref|XP_010060015.1| PREDICTED: probable pectin methyltransferase QUA2 [Eucalyptus 
grandis]
 gb|KCW66537.1| hypothetical protein EUGRSUZ_F00334 [Eucalyptus grandis]
Length=695

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 73/114 (64%), Gaps = 1/114 (1%)
 Frame = +1

Query  289  LDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPG  468
            L DSQMKDK EKED     S+ DQS+  +KF  ++L    SP+K    ENG+ S+P S G
Sbjct  21   LWDSQMKDKSEKEDLSRRDSS-DQSYPPLKFASQLLHPSNSPSKFTNLENGFASDPCSAG  79

Query  469  AGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            + R +    +L L+ SL  IV+LA+TGS WWTISI++SSRG I   Y+ L  +V
Sbjct  80   SPRKRHHLIMLALRSSLFLIVILAVTGSLWWTISISTSSRGHINQHYKDLHARV  133



>ref|XP_006390005.1| hypothetical protein EUTSA_v10018220mg [Eutrema salsugineum]
 gb|ESQ27291.1| hypothetical protein EUTSA_v10018220mg [Eutrema salsugineum]
Length=684

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 55/110 (50%), Positives = 77/110 (70%), Gaps = 8/110 (7%)
 Frame = +1

Query  301  QMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSPGAGRS  480
            QMKDK EKED    +S      L+++F    L +++S +K+G  ENG+ ++P+S    RS
Sbjct  25   QMKDKTEKEDLARGRSTDS---LTLRFPFAFLFSNQSSSKHG--ENGFPADPYS---ARS  76

Query  481  QIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
            + +  LL LK+SLV IVV+AL GSFWWT+SI++SSRG +YH YRRL EQ+
Sbjct  77   RHRLMLLFLKISLVLIVVIALAGSFWWTVSISTSSRGHVYHNYRRLQEQL  126



>gb|KJB64256.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64257.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64262.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
 gb|KJB64263.1| hypothetical protein B456_010G039800 [Gossypium raimondii]
Length=669

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 73/119 (61%), Gaps = 30/119 (25%)
 Frame = +1

Query  274  NSQSFLDDSQMKDKIEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSN  453
            NS  F D S++KDK EKED D ++ A DQS+LS+                          
Sbjct  19   NSNDFWD-SEVKDKTEKEDLDRNR-ASDQSYLSL--------------------------  50

Query  454  PFSPGAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
              S G+ RS+ K T+L LKLSLV IV+LALTGSFWWT+SI++ SRG I+HGYRRL EQ+
Sbjct  51   --SVGSPRSRHKLTVLFLKLSLVVIVILALTGSFWWTLSISTLSRGHIFHGYRRLQEQL  107



>ref|XP_010269315.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X1 
[Nelumbo nucifera]
Length=704

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 82/115 (71%), Gaps = 3/115 (3%)
 Frame = +1

Query  295  DSQMKDK---IEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSP  465
            DSQMK K    EK+D D ++S  D + LS++FL+ ++  + S +K+ +S++G+ S+PF+ 
Sbjct  29   DSQMKSKSPRTEKDDVDRNRSTSDHNSLSLRFLVNLIFPENSSSKSVLSDSGFGSDPFNM  88

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
             + RS+    LL L+ SLV IV+LAL GS WWTISI++SSRG I+ GYR+L EQ+
Sbjct  89   SSSRSRHNLILLFLRFSLVLIVILALFGSLWWTISISTSSRGYIFKGYRKLQEQL  143



>ref|XP_010269316.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
 ref|XP_010269317.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
 ref|XP_010269318.1| PREDICTED: probable pectin methyltransferase QUA2 isoform X2 
[Nelumbo nucifera]
Length=700

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 82/115 (71%), Gaps = 3/115 (3%)
 Frame = +1

Query  295  DSQMKDK---IEKEDFDHSQSAGDQSFLSMKFLLRILSTDKSPTKNGVSENGYLSNPFSP  465
            DSQMK K    EK+D D ++S  D + LS++FL+ ++  + S +K+ +S++G+ S+PF+ 
Sbjct  25   DSQMKSKSPRTEKDDVDRNRSTSDHNSLSLRFLVNLIFPENSSSKSVLSDSGFGSDPFNM  84

Query  466  GAGRSQIKFTllllklslvaivvlalTGSFwwtisitsssRGKIYHGYRRLXEQV  630
             + RS+    LL L+ SLV IV+LAL GS WWTISI++SSRG I+ GYR+L EQ+
Sbjct  85   SSSRSRHNLILLFLRFSLVLIVILALFGSLWWTISISTSSRGYIFKGYRKLQEQL  139



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875