BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF044J21

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010270927.1|  PREDICTED: uncharacterized protein LOC104607107    184   2e-50   
ref|XP_011079490.1|  PREDICTED: uncharacterized protein LOC105162997    178   1e-48   Sesamum indicum [beniseed]
emb|CDP01464.1|  unnamed protein product                                178   2e-48   Coffea canephora [robusta coffee]
ref|XP_002279803.1|  PREDICTED: uncharacterized protein LOC100264112    174   5e-47   Vitis vinifera
emb|CAN71280.1|  hypothetical protein VITISV_027089                     171   8e-46   Vitis vinifera
ref|XP_007051241.1|  TolB protein-related isoform 2                     168   2e-45   
ref|XP_009617529.1|  PREDICTED: uncharacterized protein LOC104109859    170   2e-45   Nicotiana tomentosiformis
ref|XP_004240561.1|  PREDICTED: uncharacterized protein LOC101263710    168   6e-45   Solanum lycopersicum
ref|XP_006355827.1|  PREDICTED: uncharacterized protein LOC102591696    168   6e-45   Solanum tuberosum [potatoes]
ref|XP_006492392.1|  PREDICTED: uncharacterized protein LOC102621537    167   1e-44   
ref|XP_007051240.1|  TolB protein-related isoform 1                     167   1e-44   
ref|XP_006444588.1|  hypothetical protein CICLE_v10019102mg             167   2e-44   
ref|XP_009773068.1|  PREDICTED: uncharacterized protein LOC104223342    167   2e-44   Nicotiana sylvestris
gb|EYU46868.1|  hypothetical protein MIMGU_mgv1a002606mg                166   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_006840288.1|  hypothetical protein AMTR_s00045p00058890          166   3e-44   Amborella trichopoda
gb|KJB09508.1|  hypothetical protein B456_001G146700                    166   6e-44   Gossypium raimondii
gb|KDO86848.1|  hypothetical protein CISIN_1g039497mg                   165   8e-44   Citrus sinensis [apfelsine]
ref|XP_010921344.1|  PREDICTED: uncharacterized protein LOC105044938    165   8e-44   Elaeis guineensis
ref|XP_008461387.1|  PREDICTED: uncharacterized protein LOC103499982    161   2e-42   Cucumis melo [Oriental melon]
ref|XP_006366666.1|  PREDICTED: uncharacterized protein LOC102589112    161   2e-42   Solanum tuberosum [potatoes]
ref|XP_008781198.1|  PREDICTED: uncharacterized protein LOC103701039    160   3e-42   Phoenix dactylifera
gb|KCW45418.1|  hypothetical protein EUGRSUZ_L00886                     159   8e-42   Eucalyptus grandis [rose gum]
ref|XP_006840287.1|  hypothetical protein AMTR_s00045p00058330          159   1e-41   
ref|XP_011467073.1|  PREDICTED: uncharacterized protein LOC105352244    159   1e-41   Fragaria vesca subsp. vesca
ref|XP_004240512.1|  PREDICTED: uncharacterized protein LOC101247825    156   1e-40   Solanum lycopersicum
ref|XP_009382467.1|  PREDICTED: uncharacterized protein LOC103970421    154   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004135965.1|  PREDICTED: uncharacterized protein LOC101214858    154   5e-40   Cucumis sativus [cucumbers]
ref|XP_010522850.1|  PREDICTED: uncharacterized protein LOC104801322    154   6e-40   Tarenaya hassleriana [spider flower]
ref|XP_010069735.1|  PREDICTED: uncharacterized protein LOC104456605    153   2e-39   Eucalyptus grandis [rose gum]
ref|XP_003637684.1|  Protein tolB                                       152   2e-39   
gb|KCW58166.1|  hypothetical protein EUGRSUZ_H00884                     152   5e-39   Eucalyptus grandis [rose gum]
gb|KCW45417.1|  hypothetical protein EUGRSUZ_L00885                     151   5e-39   Eucalyptus grandis [rose gum]
gb|KDP28318.1|  hypothetical protein JCGZ_14089                         151   7e-39   Jatropha curcas
ref|XP_002515212.1|  conserved hypothetical protein                     150   1e-38   Ricinus communis
ref|XP_006396381.1|  hypothetical protein EUTSA_v10029172mg             145   2e-37   
gb|AAM13860.1|  unknown protein                                         147   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192096.1|  tolB-related protein                                  147   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008227800.1|  PREDICTED: uncharacterized protein LOC103327273    147   2e-37   Prunus mume [ume]
ref|XP_006396377.1|  hypothetical protein EUTSA_v10029281mg             145   6e-37   
ref|XP_010428858.1|  PREDICTED: uncharacterized protein LOC104713446    145   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010091406.1|  hypothetical protein L484_013861                   144   2e-36   
ref|XP_002461097.1|  hypothetical protein SORBIDRAFT_02g040640          144   3e-36   Sorghum bicolor [broomcorn]
ref|XP_002872871.1|  hypothetical protein ARALYDRAFT_490390             143   6e-36   
gb|EPS68684.1|  hypothetical protein M569_06083                         142   7e-36   Genlisea aurea
gb|EAZ40813.1|  hypothetical protein OsJ_25290                          142   1e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003529216.2|  PREDICTED: uncharacterized protein LOC100814036    142   2e-35   Glycine max [soybeans]
ref|XP_010679438.1|  PREDICTED: uncharacterized protein LOC104894805    141   2e-35   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ89339.1|  predicted protein                                      141   3e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001060406.1|  Os07g0638100                                       141   3e-35   
gb|AJD80981.1|  ABA-activated 1 protein                                 141   3e-35   Lupinus luteus
ref|XP_003637686.1|  Protein tolB                                       141   3e-35   
gb|EAZ04851.1|  hypothetical protein OsI_27029                          141   3e-35   Oryza sativa Indica Group [Indian rice]
dbj|BAJ94262.1|  predicted protein                                      141   3e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX74396.1|  BnaA03g26510D                                          141   3e-35   
ref|XP_009134471.1|  PREDICTED: uncharacterized protein LOC103858800    140   4e-35   Brassica rapa
ref|XP_004498256.1|  PREDICTED: uncharacterized protein LOC101515113    140   6e-35   Cicer arietinum [garbanzo]
gb|KFK30736.1|  hypothetical protein AALP_AA6G020600                    139   1e-34   Arabis alpina [alpine rockcress]
ref|XP_010422681.1|  PREDICTED: uncharacterized protein LOC104707922    139   2e-34   Camelina sativa [gold-of-pleasure]
ref|XP_009367159.1|  PREDICTED: uncharacterized protein LOC103956844    139   3e-34   Pyrus x bretschneideri [bai li]
ref|XP_006289995.1|  hypothetical protein CARUB_v10003625mg             138   5e-34   Capsella rubella
ref|XP_006658881.1|  PREDICTED: uncharacterized protein LOC102705738    136   6e-34   Oryza brachyantha
ref|XP_007153254.1|  hypothetical protein PHAVU_003G019700g             137   7e-34   Phaseolus vulgaris [French bean]
ref|XP_007221548.1|  hypothetical protein PRUPE_ppa002534mg             135   4e-33   
ref|XP_008653395.1|  PREDICTED: uncharacterized protein LOC103633477    134   8e-33   Zea mays [maize]
gb|KCW58168.1|  hypothetical protein EUGRSUZ_H008851                    127   4e-32   Eucalyptus grandis [rose gum]
ref|XP_008343202.1|  PREDICTED: uncharacterized protein LOC103405949    130   4e-31   
ref|XP_004958463.1|  PREDICTED: uncharacterized protein LOC101757241    129   9e-31   Setaria italica
ref|XP_003562594.1|  PREDICTED: uncharacterized protein LOC100822199    128   1e-30   Brachypodium distachyon [annual false brome]
dbj|BAJ88545.1|  predicted protein                                      118   9e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_005646452.1|  tricorn protease N-terminal domain-containin...    114   3e-25   Coccomyxa subellipsoidea C-169
ref|XP_004981111.1|  PREDICTED: uncharacterized protein LOC101776730    110   5e-24   Setaria italica
ref|NP_001051846.1|  Os03g0840200                                       108   2e-23   
gb|EAY92514.1|  hypothetical protein OsI_14253                          107   5e-23   Oryza sativa Indica Group [Indian rice]
gb|EAZ29242.1|  hypothetical protein OsJ_13305                          106   8e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010510815.1|  PREDICTED: uncharacterized protein LOC104787018    105   2e-22   Camelina sativa [gold-of-pleasure]
gb|KJB29176.1|  hypothetical protein B456_005G088400                    104   5e-22   Gossypium raimondii
ref|NP_564146.1|  uncharacterized protein                               104   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010270269.1|  PREDICTED: uncharacterized protein LOC104606655    104   6e-22   Nelumbo nucifera [Indian lotus]
ref|XP_010466457.1|  PREDICTED: uncharacterized protein LOC104746...    104   6e-22   
ref|XP_003562684.2|  PREDICTED: uncharacterized protein LOC100824160    104   6e-22   
ref|XP_010466456.1|  PREDICTED: uncharacterized protein LOC104746...    103   6e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002890451.1|  hypothetical protein ARALYDRAFT_472405             103   1e-21   Arabidopsis lyrata subsp. lyrata
gb|KCW71232.1|  hypothetical protein EUGRSUZ_F04330                     102   2e-21   Eucalyptus grandis [rose gum]
ref|XP_010063935.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    102   2e-21   Eucalyptus grandis [rose gum]
ref|XP_009411896.1|  PREDICTED: uncharacterized protein LOC103993528    102   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010911317.1|  PREDICTED: uncharacterized protein LOC105037336    102   4e-21   Elaeis guineensis
ref|XP_010477408.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    100   8e-21   
ref|XP_010488216.1|  PREDICTED: uncharacterized protein LOC104766097    100   8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_007137456.1|  hypothetical protein PHAVU_009G128300g           99.4    3e-20   Phaseolus vulgaris [French bean]
ref|XP_004502520.1|  PREDICTED: uncharacterized protein LOC101497096  97.1    1e-19   Cicer arietinum [garbanzo]
ref|XP_006416278.1|  hypothetical protein EUTSA_v10006965mg           96.7    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_008644344.1|  PREDICTED: uncharacterized protein LOC103625729  96.3    3e-19   Zea mays [maize]
gb|KHN46997.1|  Replication factor C subunit 4                        94.0    5e-19   Glycine soja [wild soybean]
emb|CDY04661.1|  BnaC05g16990D                                        95.5    6e-19   
ref|XP_007019162.1|  DPP6 N-terminal domain-like protein              95.1    8e-19   
ref|XP_008466749.1|  PREDICTED: uncharacterized protein LOC103504088  94.4    1e-18   Cucumis melo [Oriental melon]
gb|KFK44273.1|  hypothetical protein AALP_AA1G236600                  93.2    4e-18   Arabis alpina [alpine rockcress]
ref|XP_011069633.1|  PREDICTED: uncharacterized protein LOC105155456  92.8    4e-18   Sesamum indicum [beniseed]
ref|XP_009149685.1|  PREDICTED: uncharacterized protein LOC103873008  92.8    4e-18   Brassica rapa
ref|XP_002993781.1|  hypothetical protein SELMODRAFT_187603           92.4    6e-18   
ref|XP_011027475.1|  PREDICTED: uncharacterized protein LOC105127763  92.4    7e-18   Populus euphratica
emb|CDP10970.1|  unnamed protein product                              92.0    8e-18   Coffea canephora [robusta coffee]
ref|XP_002985152.1|  hypothetical protein SELMODRAFT_121622           92.0    8e-18   
ref|XP_002466125.1|  hypothetical protein SORBIDRAFT_01g001880        91.7    1e-17   Sorghum bicolor [broomcorn]
gb|KDP32822.1|  hypothetical protein JCGZ_12114                       91.7    1e-17   Jatropha curcas
ref|XP_006386357.1|  hypothetical protein POPTR_0002s08010g           91.3    1e-17   Populus trichocarpa [western balsam poplar]
ref|XP_011027472.1|  PREDICTED: uncharacterized protein LOC105127760  91.3    2e-17   Populus euphratica
gb|EYU32510.1|  hypothetical protein MIMGU_mgv1a026619mg              90.9    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_003630471.1|  Protein tolB                                     90.9    2e-17   
ref|XP_003527947.1|  PREDICTED: uncharacterized protein LOC100791865  90.9    2e-17   Glycine max [soybeans]
ref|XP_004249849.1|  PREDICTED: uncharacterized protein LOC101257324  90.1    3e-17   Solanum lycopersicum
ref|XP_002520326.1|  conserved hypothetical protein                   89.7    5e-17   Ricinus communis
emb|CDY08187.1|  BnaA06g15390D                                        89.4    6e-17   Brassica napus [oilseed rape]
ref|XP_004160721.1|  PREDICTED: protein TolB-like                     88.2    2e-16   
gb|KFK44274.1|  hypothetical protein AALP_AA1G237000                  87.4    3e-16   Arabis alpina [alpine rockcress]
ref|XP_004149439.1|  PREDICTED: protein TolB-like                     87.4    3e-16   Cucumis sativus [cucumbers]
ref|XP_006351203.1|  PREDICTED: uncharacterized protein LOC102604753  86.7    5e-16   Solanum tuberosum [potatoes]
ref|XP_002993240.1|  hypothetical protein SELMODRAFT_136782           86.7    6e-16   Selaginella moellendorffii
ref|XP_006416277.1|  hypothetical protein EUTSA_v10009943mg           86.3    8e-16   Eutrema salsugineum [saltwater cress]
ref|NP_564147.1|  DPP6 N-terminal domain-like protein                 85.5    1e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KDO80522.1|  hypothetical protein CISIN_1g004971mg                 85.5    2e-15   Citrus sinensis [apfelsine]
ref|XP_010672499.1|  PREDICTED: uncharacterized protein LOC104889058  84.3    4e-15   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN73514.1|  hypothetical protein VITISV_037210                   84.3    4e-15   Vitis vinifera
ref|XP_002285876.2|  PREDICTED: uncharacterized protein LOC100267814  84.0    4e-15   Vitis vinifera
emb|CDY04662.1|  BnaC05g17000D                                        83.6    5e-15   
emb|CDP10971.1|  unnamed protein product                              83.6    6e-15   Coffea canephora [robusta coffee]
ref|XP_009149686.1|  PREDICTED: uncharacterized protein LOC103873010  83.6    6e-15   Brassica rapa
ref|XP_010095431.1|  hypothetical protein L484_013388                 83.6    7e-15   
ref|XP_010477409.1|  PREDICTED: uncharacterized protein LOC104756505  83.6    7e-15   Camelina sativa [gold-of-pleasure]
ref|XP_009593179.1|  PREDICTED: uncharacterized protein LOC104089880  83.6    7e-15   Nicotiana tomentosiformis
ref|XP_009796392.1|  PREDICTED: uncharacterized protein LOC104242978  83.2    9e-15   Nicotiana sylvestris
ref|XP_010539663.1|  PREDICTED: uncharacterized protein LOC104813673  82.8    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_006472827.1|  PREDICTED: uncharacterized protein LOC102617553  82.8    1e-14   Citrus sinensis [apfelsine]
ref|XP_002890452.1|  hypothetical protein ARALYDRAFT_472406           82.4    2e-14   
ref|XP_006304666.1|  hypothetical protein CARUB_v10011878mg           81.6    2e-14   Capsella rubella
emb|CDX84088.1|  BnaC08g07650D                                        81.3    3e-14   
ref|XP_006434259.1|  hypothetical protein CICLE_v10000425mg           80.9    5e-14   Citrus clementina [clementine]
ref|XP_010521282.1|  PREDICTED: uncharacterized protein LOC104800...  80.9    5e-14   Tarenaya hassleriana [spider flower]
ref|XP_010498624.1|  PREDICTED: uncharacterized protein LOC104776288  80.5    6e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010521281.1|  PREDICTED: uncharacterized protein LOC104800...  80.5    6e-14   Tarenaya hassleriana [spider flower]
ref|XP_002515210.1|  conserved hypothetical protein                   79.3    1e-13   
ref|XP_008338671.1|  PREDICTED: uncharacterized protein LOC103401727  78.6    2e-13   
emb|CDY08186.1|  BnaA06g15400D                                        78.2    3e-13   Brassica napus [oilseed rape]
gb|ABR17080.1|  unknown                                               78.2    4e-13   Picea sitchensis
ref|XP_002448903.1|  hypothetical protein SORBIDRAFT_05g001167        72.0    8e-13   
ref|XP_009343980.1|  PREDICTED: uncharacterized protein LOC103935890  76.3    2e-12   Pyrus x bretschneideri [bai li]
ref|XP_001780675.1|  predicted protein                                74.3    7e-12   
ref|XP_004290903.2|  PREDICTED: uncharacterized protein LOC101292474  74.3    7e-12   Fragaria vesca subsp. vesca
ref|XP_008219596.1|  PREDICTED: uncharacterized protein LOC103319783  73.9    8e-12   Prunus mume [ume]
gb|EAY93383.1|  hypothetical protein OsI_15178                        67.8    7e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010675830.1|  PREDICTED: uncharacterized protein LOC104891773  61.2    1e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010675837.1|  PREDICTED: uncharacterized protein LOC104891780  58.5    8e-07   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010675836.1|  PREDICTED: uncharacterized protein LOC104891779  57.4    2e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010675829.1|  PREDICTED: uncharacterized protein LOC104891772  54.3    2e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010102639.1|  hypothetical protein L484_010931                 53.5    4e-05   Morus notabilis
ref|XP_011003182.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.1    4e-04   Populus euphratica
ref|XP_010235117.1|  PREDICTED: uncharacterized protein LOC100846313  49.7    8e-04   
ref|XP_003574472.1|  PREDICTED: uncharacterized protein LOC100838501  49.3    0.001   Brachypodium distachyon [annual false brome]



>ref|XP_010270927.1| PREDICTED: uncharacterized protein LOC104607107, partial [Nelumbo 
nucifera]
Length=715

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 117/155 (75%), Gaps = 4/155 (3%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  350
            M+P GTI+F++VGR +YGFDIFSV LPS          EHRLTDG+S+NFNG F+DE +T
Sbjct  62   MNPKGTIIFTSVGRPYYGFDIFSVSLPSIIAA-TTSWKEHRLTDGISVNFNGQFVDEDET  120

Query  351  FVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  530
             V+VSER+G  R+YL +   A++ KP QL S + +LFHDRP+V+DGRL ++SAHEP  + 
Sbjct  121  LVYVSERTGYARVYLNQ---ANSPKPKQLPSVADSLFHDRPIVKDGRLYFVSAHEPADKH  177

Query  531  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             KSWSALYST L   +I RLTPY AVD+SPS+SQS
Sbjct  178  LKSWSALYSTLLDHGKIERLTPYKAVDYSPSISQS  212



>ref|XP_011079490.1| PREDICTED: uncharacterized protein LOC105162997 [Sesamum indicum]
Length=659

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 121/157 (77%), Gaps = 6/157 (4%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP-ASEHRLTDGVSINFNGHFLDEGD  347
            M+P GTIVF++VGR +YGFD+FS+QLPS+ +      +SEH LTDG+SINFNG F+DEG 
Sbjct  1    MEPTGTIVFTSVGRPYYGFDLFSLQLPSNLDASLLDFSSEHPLTDGISINFNGQFVDEGK  60

Query  348  TFVFVSERSGSPRIYLQENRSASAGKPPQLL-SPSGTLFHDRPVVRDGRLLYISAHEPPK  524
            T V++SER+GS RI+L    +A+    PQLL SP  +LFHDRP++++ RL +ISAHEPP+
Sbjct  61   TLVYISERTGSARIFLNSPGNAN----PQLLHSPPESLFHDRPLIKNHRLYFISAHEPPE  116

Query  525  EVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            +  +SWSALYST L  K   RLTPYG+VD+SP++S S
Sbjct  117  KPLRSWSALYSTRLHEKTAVRLTPYGSVDYSPAISHS  153



>emb|CDP01464.1| unnamed protein product [Coffea canephora]
Length=719

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 124/183 (68%), Gaps = 16/183 (9%)
 Frame = +3

Query  90   YAISHRFFPLCTQILSSLRIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQD  269
            + I+   FPL     S L   KP    MDP GTIVFSTVG + YGFDIFSV+LP+     
Sbjct  45   FTIATTTFPLH----SPLVYLKPSNFSMDPSGTIVFSTVGVTQYGFDIFSVKLPN-----  95

Query  270  RRPASEHRLTDGVSINFNGHFLDEGD-TFVFVSERSGSPRIYLQENRSASAGKPPQLLSP  446
                ++ RLTDGVSINFNG FLDE + + VFVSERSGSPRIYL +       +P  L SP
Sbjct  96   ---LTQRRLTDGVSINFNGQFLDENEESLVFVSERSGSPRIYLSK---PELSEPELLPSP  149

Query  447  SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSV  626
              +LFHDRPV+++ R  +ISAHE P ++FKSWSALYST L  K++ RLTP G  D+SPSV
Sbjct  150  PESLFHDRPVIKNQRAYFISAHEEPDKLFKSWSALYSTRLDDKKVRRLTPPGVADYSPSV  209

Query  627  SQS  635
            SQS
Sbjct  210  SQS  212



>ref|XP_002279803.1| PREDICTED: uncharacterized protein LOC100264112 [Vitis vinifera]
Length=677

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 115/164 (70%), Gaps = 10/164 (6%)
 Frame = +3

Query  144  RIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFN  323
            R P P    M+P GTI F+TVGR HYGFD+FS+ L  +        SE RLT G SINFN
Sbjct  23   RTPPP----MEPTGTIAFTTVGRPHYGFDLFSLNLDPNLINH---TSERRLTGGTSINFN  75

Query  324  GHFLDEGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYI  503
            GHFLDE  T V+VSERSGSPRIY          KP QLLS  G+L+HDRP+V++GRL ++
Sbjct  76   GHFLDENQTLVYVSERSGSPRIY---QIRPGVTKPEQLLSVPGSLYHDRPIVKNGRLYFV  132

Query  504  SAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            SAHE P++ F SWSA+YST L  K + +LTP+G VD+SP++S+S
Sbjct  133  SAHERPEKPFISWSAVYSTGLDDKAVVQLTPHGVVDYSPAISRS  176



>emb|CAN71280.1| hypothetical protein VITISV_027089 [Vitis vinifera]
Length=677

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 113/164 (69%), Gaps = 10/164 (6%)
 Frame = +3

Query  144  RIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFN  323
            R P P    M+P GTI F+TVGR HYGFD+FS+ L  +        SE RLT G SINFN
Sbjct  23   RTPPP----MEPTGTIAFTTVGRPHYGFDLFSLNLDPNLINH---TSERRLTGGTSINFN  75

Query  324  GHFLDEGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYI  503
            GHFLDE  T V+VSE SGSPRIY          KP QLLS  G+L+HDRP+V++GRL ++
Sbjct  76   GHFLDENQTLVYVSEXSGSPRIY---QIRPGVTKPEQLLSVPGSLYHDRPIVKNGRLYFV  132

Query  504  SAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            SAHE P++ F SWSA+YST L  K +  LTP+G VD+SP++S+S
Sbjct  133  SAHERPEKPFISWSAVYSTGLDDKAVVXLTPHGVVDYSPAISRS  176



>ref|XP_007051241.1| TolB protein-related isoform 2, partial [Theobroma cacao]
 gb|EOX95398.1| TolB protein-related isoform 2, partial [Theobroma cacao]
Length=481

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  350
            M+P GT+VF++VGR  YGFDIF+V L  +   +  P  EHRLTD +SINFN  F++E  +
Sbjct  51   MNPKGTVVFTSVGRPQYGFDIFTVNLNQTPITNSTP--EHRLTDCISINFNAQFINEDQS  108

Query  351  FVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  530
             VF+SERSGSPRIYL         KP QL S   +LFHDRP++++ RL +ISAHE P + 
Sbjct  109  IVFISERSGSPRIYLTH---PDLPKPEQLTSAPSSLFHDRPIIQNHRLYFISAHEQPDQP  165

Query  531  FKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQS  635
            FKSWSALYST L G ++ TRL+PYG  D+SP++S+S
Sbjct  166  FKSWSALYSTELRGKRDTTRLSPYGVADYSPAISKS  201



>ref|XP_009617529.1| PREDICTED: uncharacterized protein LOC104109859 [Nicotiana tomentosiformis]
Length=700

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 134/212 (63%), Gaps = 28/212 (13%)
 Frame = +3

Query  27   TFDVSLYRRL*NSRADDDVMPYAISHRFFPLCTQILSSLRIPKPPIMIMD---PHGTIVF  197
            TF +   RRL        V+   + +  FP   QI+++         IMD   PHG+I+F
Sbjct  6    TFHLPKLRRL------SQVLQLQLYNYHFPAAEQIINN---------IMDSQSPHGSIIF  50

Query  198  STVGRSHYGFDIFSVQLPSSFEQD--RRPASEHRLTDGVSINFNGHFLDEGDTFVFVSER  371
            STVGR++YGFDIFS++ P SF         +E RLTDG S+NFNG F+DE  T VFVSER
Sbjct  51   STVGRTNYGFDIFSLKSPFSFFNSPLHTFPTEQRLTDGTSVNFNGQFVDEDQTLVFVSER  110

Query  372  SGSPRIYLQENRSASAGKPPQLLSPSG---TLFHDRPVVRDGRLLYISAHEPPKEVFKSW  542
            SGSPRIYLQ  R +  G+  QL  P G   + F DRP++R+  L YISAH+ PK++F SW
Sbjct  111  SGSPRIYLQ--RPSHLGEIEQL--PDGSPDSPFLDRPLLRNKCLYYISAHQSPKQIFTSW  166

Query  543  SALYSTHLG-LKEITRLTPYGAVDFSPSVSQS  635
            SALYST L   K   RLTPYG VD+SP++SQS
Sbjct  167  SALYSTTLDHEKTAVRLTPYGCVDYSPAISQS  198



>ref|XP_004240561.1| PREDICTED: uncharacterized protein LOC101263710 [Solanum lycopersicum]
Length=697

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 117/161 (73%), Gaps = 10/161 (6%)
 Frame = +3

Query  168  IMD----PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL  335
            IMD    PHG+I+FSTVGR++YGFDIFS++ P SF        EHRLTDG SIN+NG F+
Sbjct  40   IMDSQSSPHGSIIFSTVGRTNYGFDIFSIKSPFSFLNS---PVEHRLTDGTSINYNGQFV  96

Query  336  DEGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHE  515
            DE  T VFVSERSG+PRIYL+    +S  +  QL +P  +LF DRP +R+ +L YISAH+
Sbjct  97   DEDQTLVFVSERSGAPRIYLRH--PSSQVQMEQLPTPIDSLFLDRPFLRNKQLYYISAHQ  154

Query  516  PPKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQS  635
             PK+VF S SALYST++     I RLTPYG VD+SP++SQS
Sbjct  155  QPKQVFTSSSALYSTNIEDNSNIIRLTPYGCVDYSPAISQS  195



>ref|XP_006355827.1| PREDICTED: uncharacterized protein LOC102591696 [Solanum tuberosum]
Length=698

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 118/161 (73%), Gaps = 10/161 (6%)
 Frame = +3

Query  168  IMD----PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL  335
            IMD    PHG+I+FSTVGR++YGFDIFS++ P SF        EHRLTDG SIN+NG F+
Sbjct  40   IMDSQSSPHGSIIFSTVGRTNYGFDIFSIKSPFSFLNS---PVEHRLTDGTSINYNGQFV  96

Query  336  DEGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHE  515
            DE  T VFVSERSG+PRIYL+  R +S  +  QL +   +LF DRP +R+ RL YISAH+
Sbjct  97   DEDQTLVFVSERSGAPRIYLR--RPSSQVQIEQLPTSIDSLFLDRPFLRNRRLYYISAHQ  154

Query  516  PPKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQS  635
             PK+VF S SALYST++    +ITRLTPYG  D+SP++SQS
Sbjct  155  QPKQVFTSSSALYSTNIEDGSKITRLTPYGFADYSPAISQS  195



>ref|XP_006492392.1| PREDICTED: uncharacterized protein LOC102621537 [Citrus sinensis]
Length=700

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 111/158 (70%), Gaps = 7/158 (4%)
 Frame = +3

Query  165  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG  344
            M M+P GTIVF+TVGR +YGFD+FS++ P     +     EHRLTDG SINFN  F+D  
Sbjct  47   MYMEPKGTIVFTTVGRPYYGFDVFSIKSPFV---NAPKFHEHRLTDGTSINFNAQFVDGQ  103

Query  345  D-TFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPP  521
            D T  F+SERSGSPRIY  + R  S+ K   L S   +LFHDRPV R+ +L +ISAHE P
Sbjct  104  DQTIAFISERSGSPRIY--QTRPGSS-KTELLPSIPCSLFHDRPVARNNKLFFISAHEQP  160

Query  522  KEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             ++FKSWSALYST L   + TRLTPYG VD+SPSVS S
Sbjct  161  DQIFKSWSALYSTDLKASKFTRLTPYGVVDYSPSVSYS  198



>ref|XP_007051240.1| TolB protein-related isoform 1 [Theobroma cacao]
 gb|EOX95397.1| TolB protein-related isoform 1 [Theobroma cacao]
Length=704

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  350
            M+P GT+VF++VGR  YGFDIF+V L  +   +  P  EHRLTD +SINFN  F++E  +
Sbjct  51   MNPKGTVVFTSVGRPQYGFDIFTVNLNQTPITNSTP--EHRLTDCISINFNAQFINEDQS  108

Query  351  FVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  530
             VF+SERSGSPRIYL         KP QL S   +LFHDRP++++ RL +ISAHE P + 
Sbjct  109  IVFISERSGSPRIYLTH---PDLPKPEQLTSAPSSLFHDRPIIQNHRLYFISAHEQPDQP  165

Query  531  FKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQS  635
            FKSWSALYST L G ++ TRL+PYG  D+SP++S+S
Sbjct  166  FKSWSALYSTELRGKRDTTRLSPYGVADYSPAISKS  201



>ref|XP_006444588.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
 gb|ESR57828.1| hypothetical protein CICLE_v10019102mg [Citrus clementina]
Length=700

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 111/158 (70%), Gaps = 7/158 (4%)
 Frame = +3

Query  165  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG  344
            M M+P GTIVF+TVGR +YGFD+FS++ P     +     EHRLTDG SINFN  F+D  
Sbjct  47   MYMEPKGTIVFTTVGRPYYGFDVFSIKSPFV---NAPKFHEHRLTDGTSINFNAQFVDGQ  103

Query  345  D-TFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPP  521
            D T  F+SERSGSPRIY  + R  S+ K   L S   +LFHDRPV R+ +L +ISAHE P
Sbjct  104  DQTIAFISERSGSPRIY--QTRPGSS-KTELLPSIPCSLFHDRPVARNDKLFFISAHEQP  160

Query  522  KEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             ++FKSWSALYST L   + TRLTPYG VD+SPSVS S
Sbjct  161  DQIFKSWSALYSTDLKASKFTRLTPYGVVDYSPSVSYS  198



>ref|XP_009773068.1| PREDICTED: uncharacterized protein LOC104223342 [Nicotiana sylvestris]
Length=663

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 115/160 (72%), Gaps = 13/160 (8%)
 Frame = +3

Query  180  HGTIVFSTVGRSHYGFDIFSVQLPSSFEQDR----RPASEHRLTDGVSINFNGHFLDEGD  347
            HG+I+FSTVGR++YGFDIF ++ P SF   +    +  +EHRLTDG S+NFNG F+DE  
Sbjct  7    HGSIIFSTVGRTNYGFDIFCLKSPFSFLDSQLHSTQYPTEHRLTDGSSVNFNGQFVDEDQ  66

Query  348  TFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSG---TLFHDRPVVRDGRLLYISAHEP  518
            T VFVSERSGSPRIYLQ     S  K  QL  P G   +LF DRP++ + RL YISAH+P
Sbjct  67   TLVFVSERSGSPRIYLQR---PSQLKIEQL--PDGSPDSLFLDRPLLGNKRLYYISAHQP  121

Query  519  PKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQS  635
            P+++F SWSALYST L   K   RLTPYG VD+SP++SQS
Sbjct  122  PEQIFTSWSALYSTTLDDEKTAVRLTPYGCVDYSPAISQS  161



>gb|EYU46868.1| hypothetical protein MIMGU_mgv1a002606mg [Erythranthe guttata]
Length=654

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 115/158 (73%), Gaps = 7/158 (4%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  350
            M+P GTIVF++VGR  YGFD++SV LPS+        +E RLTD  S+NFNG F+D+  T
Sbjct  1    MEPTGTIVFTSVGRPDYGFDVYSVHLPSN-SLSHWNFTEQRLTDCASVNFNGQFVDDDST  59

Query  351  FVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  530
             VF+SER+GS RI+L  NR  +A  P QL SP  +LFHDRP +++GRL +ISAH+ P + 
Sbjct  60   LVFISERTGSARIFL--NRPGNAA-PEQLHSPPESLFHDRPFIKNGRLYFISAHQQPDKP  116

Query  531  FKSWSALYSTHLGL---KEITRLTPYGAVDFSPSVSQS  635
            FKSW+ALYST   L   K + RLTPYG+VD+SP++SQS
Sbjct  117  FKSWTALYSTGGLLDVNKAVVRLTPYGSVDYSPAISQS  154



>ref|XP_006840288.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
 gb|ERN01963.1| hypothetical protein AMTR_s00045p00058890 [Amborella trichopoda]
Length=652

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 111/156 (71%), Gaps = 4/156 (3%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD-  347
            M   GTI+FSTVGR+ YGFDIF+V + +         +E RLTDG S+NFNG F D+ D 
Sbjct  1    MMGKGTIIFSTVGRASYGFDIFAVTVHNLLNGAAANWTERRLTDGKSVNFNGQFTDDEDG  60

Query  348  TFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  527
            T VF+SER+G+ +IYLQ  +  +   P QLL  SG+LFHDRP  R+GR+ ++SAHEP ++
Sbjct  61   TVVFISERNGASKIYLQLPKCET---PKQLLGASGSLFHDRPTFRNGRVFFVSAHEPAEK  117

Query  528  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            +  SW+A+YST +  +E TRL P+G VD+SPS+SQS
Sbjct  118  LLNSWAAIYSTCMESQETTRLNPHGTVDYSPSISQS  153



>gb|KJB09508.1| hypothetical protein B456_001G146700 [Gossypium raimondii]
Length=710

 Score =   166 bits (419),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 113/160 (71%), Gaps = 14/160 (9%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP----ASEHRLTDGVSINFNGHFLD  338
            MDP G +VF++VGRS YGFDIF+V L      ++ P     SEHRLTDG+SIN+N  F++
Sbjct  57   MDPKGIVVFTSVGRSQYGFDIFTVNL------NQTPITGSTSEHRLTDGISINYNAQFVN  110

Query  339  EGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEP  518
            E  + VF+SERSG PRIYL         KP QL S   +LFHDRP+++   L +ISAHE 
Sbjct  111  EDQSIVFISERSGCPRIYLTRR---GLSKPEQLPSVPDSLFHDRPIIKSHHLYFISAHEQ  167

Query  519  PKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQS  635
            P++ F+SWSALYST L G ++I RL+PYG VD+SP++S+S
Sbjct  168  PEKPFQSWSALYSTELHGKRKIIRLSPYGVVDYSPAISKS  207



>gb|KDO86848.1| hypothetical protein CISIN_1g039497mg [Citrus sinensis]
Length=642

 Score =   165 bits (418),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 110/156 (71%), Gaps = 7/156 (4%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD-  347
            M+P GTIVF+TVGR +YGFD+FS++ P     +     EHRLTDG SINFN  F+D  D 
Sbjct  1    MEPKGTIVFTTVGRPYYGFDVFSIKSPFV---NAPKFHEHRLTDGTSINFNAQFVDGQDQ  57

Query  348  TFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  527
            T  F+SERSGSPRIY  + R  S+ K   L S   +LFHDRPV R+ +L +ISAHE P +
Sbjct  58   TIAFISERSGSPRIY--QTRPGSS-KTELLPSIPCSLFHDRPVARNNKLFFISAHEQPDQ  114

Query  528  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            +FKSWSALYST L   + TRLTPYG VD+SPSVS S
Sbjct  115  IFKSWSALYSTDLKASKFTRLTPYGVVDYSPSVSYS  150



>ref|XP_010921344.1| PREDICTED: uncharacterized protein LOC105044938 [Elaeis guineensis]
Length=656

 Score =   165 bits (417),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  350
            M+P GTIVFSTVG  +YGFD+FS  LP++ +      +E R TDGVS+NFN  F+DEG T
Sbjct  1    MEPQGTIVFSTVGLLYYGFDVFSTPLPANLDAAVNKVTERRHTDGVSVNFNAQFVDEGPT  60

Query  351  FVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  530
              FVSER+GSPR+Y+ ++      KP  L +   +L HDRP V++G + ++SAHEPP E 
Sbjct  61   VAFVSERTGSPRLYVAQSPDH---KPKPLPNIPESLHHDRPTVKNGLVYFVSAHEPPSEP  117

Query  531  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            FKSWSA+Y+  L   E  RLTP G VDFSP+VS+S
Sbjct  118  FKSWSAVYAARLDTNETVRLTPPGVVDFSPAVSRS  152



>ref|XP_008461387.1| PREDICTED: uncharacterized protein LOC103499982 [Cucumis melo]
Length=647

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 110/155 (71%), Gaps = 11/155 (7%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTF  353
            +P G ++F+T+G + YGFDIFSV L S       P  E RLTDG+S+NFN  FL+   + 
Sbjct  3    NPTGAVLFTTIGLNQYGFDIFSVALNS-------PTVERRLTDGISVNFNAQFLNNQLSV  55

Query  354  VFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVF  533
            VF+SERSGS RIYL ++ ++S   P  L S  G+ FHDRP+VR+GRLL+ISAHE P + F
Sbjct  56   VFISERSGSSRIYLSDSPNSS---PKLLASAPGSCFHDRPIVRNGRLLFISAHENPHKPF  112

Query  534  KSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQS  635
             SW+ALYST L G   ITRLTP G+VDFSP+VS S
Sbjct  113  TSWAALYSTPLDGDDSITRLTPLGSVDFSPAVSGS  147



>ref|XP_006366666.1| PREDICTED: uncharacterized protein LOC102589112 [Solanum tuberosum]
Length=658

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 114/154 (74%), Gaps = 7/154 (5%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            P+G+I+FSTVGR++YGFDIFS++ P SF     P +EHRLTDG S+NFNG F+DE  T V
Sbjct  6    PNGSIIFSTVGRTNYGFDIFSLKSPLSFLNS--PITEHRLTDGASVNFNGQFIDEDQTLV  63

Query  357  FVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFK  536
            FVSERSG+PRIYL+++ S     P  +     +LF D P++R+ RL YISAH+  ++ F 
Sbjct  64   FVSERSGAPRIYLRQHPSGIELIPTSI----NSLFLDCPILRNNRLYYISAHQHSEKKFT  119

Query  537  SWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQS  635
            S SALY T++ G  E+TRLTP G+VD+SPS+S+S
Sbjct  120  SSSALYCTNIEGDNEVTRLTPEGSVDYSPSISKS  153



>ref|XP_008781198.1| PREDICTED: uncharacterized protein LOC103701039 [Phoenix dactylifera]
Length=656

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 104/155 (67%), Gaps = 3/155 (2%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  350
            M+P GTIVFSTVG  +YGFD+FS  LP+  +       E R TDG S+NFN  F+DEG T
Sbjct  1    MEPQGTIVFSTVGLLYYGFDVFSTPLPADLDAAVNKLRERRHTDGTSVNFNAQFVDEGQT  60

Query  351  FVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  530
              FVSER+GS ++YL E+      KP  L +   +L  DRP V++G + ++SAHEPP E 
Sbjct  61   VAFVSERTGSSQLYLAESPDH---KPKPLPTTLESLHQDRPTVKNGLVYFVSAHEPPSEP  117

Query  531  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            FKSWSA+YST L   E  RLTP G VDFSP+VS+S
Sbjct  118  FKSWSAVYSTRLDTNETVRLTPPGVVDFSPAVSRS  152



>gb|KCW45418.1| hypothetical protein EUGRSUZ_L00886 [Eucalyptus grandis]
Length=648

 Score =   159 bits (403),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 109/162 (67%), Gaps = 19/162 (12%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG---  344
            +P GT++F+TVGR +YGFD+FS+ L S     RR   E RLTDGVSINFN  F   G   
Sbjct  3    EPTGTVLFTTVGRPYYGFDVFSLDLAS-----RR---ERRLTDGVSINFNAQFASAGDDE  54

Query  345  -----DTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISA  509
                 +  VFVSER+G PR+YL     +   +P  LLS  G+LFHDRP++R+G L +ISA
Sbjct  55   DDDDPEAVVFVSERTGCPRVYLAR---SGFSQPEPLLSAPGSLFHDRPILRNGLLYFISA  111

Query  510  HEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            HE P + F  WSALYS  L  +EI RLTPYG+VD+SP+VSQS
Sbjct  112  HEAPDKPFAGWSALYSADLEGREIARLTPYGSVDYSPAVSQS  153



>ref|XP_006840287.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
 gb|ERN01962.1| hypothetical protein AMTR_s00045p00058330 [Amborella trichopoda]
Length=642

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 107/150 (71%), Gaps = 4/150 (3%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFVS  365
            TIVFSTVGR  YGFDIFSV +P + + D R  +E RLTDG S+N+NGHF +E  T VFVS
Sbjct  6    TIVFSTVGRPSYGFDIFSVTVPKNLD-DMRDWTERRLTDGKSVNYNGHFTEEDGTVVFVS  64

Query  366  ERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWS  545
            ERSG  ++Y+Q     +  KP +L S   +LFHD P + +GRL ++SA+EP  +  KSW+
Sbjct  65   ERSGCSKLYIQ---LPNTNKPLELPSVPDSLFHDHPTINNGRLFFVSANEPADKPLKSWA  121

Query  546  ALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            A+YST L  ++ TRLTP G VD+SP+VS+S
Sbjct  122  AMYSTCLDSQKTTRLTPVGTVDYSPAVSES  151



>ref|XP_011467073.1| PREDICTED: uncharacterized protein LOC105352244 [Fragaria vesca 
subsp. vesca]
Length=685

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 113/170 (66%), Gaps = 14/170 (8%)
 Frame = +3

Query  132  LSSLRIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVS  311
            L+  R    P M   P GT+VFST+GR  YGFD+FS++L SS         EHRLTDG S
Sbjct  27   LTLTRSHSNPKMEQQPKGTLVFSTIGRPQYGFDLFSLRLHSS-------NLEHRLTDGRS  79

Query  312  INFNGHFLDEGDTFVFVSERSGSPRIYLQENRSASAGKP-PQLL-SPSGTLFHDRPVVRD  485
            INFN  F D   + VF+SER+GSP I+L        G P PQLL S  G+LFHDRPV+++
Sbjct  80   INFNAQFADSHQSIVFISERTGSPAIFLTR-----PGNPTPQLLHSVPGSLFHDRPVIKN  134

Query  486  GRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             +L +ISAH+ P  +FKSWSALYST L   + TRLTP G+VD+SP+VS S
Sbjct  135  RKLYFISAHQHPDRLFKSWSALYSTDLDENKTTRLTPLGSVDYSPAVSLS  184



>ref|XP_004240512.1| PREDICTED: uncharacterized protein LOC101247825 [Solanum lycopersicum]
Length=660

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 109/155 (70%), Gaps = 8/155 (5%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            P+G+I+FSTVGR++YGFDIFS++ P SF     P +EH LTDG S+NFNG F+DE  T V
Sbjct  6    PNGSIIFSTVGRTNYGFDIFSLKSPLSFLNS--PITEHCLTDGASVNFNGQFIDEDQTLV  63

Query  357  FVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFK  536
            FVSERSG+PRI+L    S     P  +     TLF DRP++R+ RL YISAH+  +++F 
Sbjct  64   FVSERSGAPRIHLSRRHSGIELIPISI----NTLFLDRPILRNNRLYYISAHQHSEKIFT  119

Query  537  SWSALY--STHLGLKEITRLTPYGAVDFSPSVSQS  635
            S SALY  ST  G  E+ RLTP G VD+SPS+S+S
Sbjct  120  SSSALYCTSTVEGDNEVKRLTPQGYVDYSPSISKS  154



>ref|XP_009382467.1| PREDICTED: uncharacterized protein LOC103970421 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/155 (51%), Positives = 102/155 (66%), Gaps = 3/155 (2%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  350
            M+P GTIVF+TVG  HYGFD+FSV +    +      +E R TDG S+NFN  F+DEGD+
Sbjct  1    MEPQGTIVFTTVGLPHYGFDVFSVPVSPDLDDPAAQLTERRHTDGTSVNFNAQFVDEGDS  60

Query  351  FVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  530
              FVSER+GS R++   +R  +   P  L + S +LFHDRP VR+GR+ ++SAHE P E 
Sbjct  61   IAFVSERTGSARLFRSSSRDPA---PVPLPAFSDSLFHDRPTVRNGRVFFVSAHERPAEP  117

Query  531  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            F+SW A+YS  L   E  RLTP G  D SP+VS S
Sbjct  118  FRSWCAVYSARLDSGETARLTPPGFADMSPAVSCS  152



>ref|XP_004135965.1| PREDICTED: uncharacterized protein LOC101214858 [Cucumis sativus]
 ref|XP_004158170.1| PREDICTED: uncharacterized protein LOC101226808 [Cucumis sativus]
 gb|KGN45063.1| hypothetical protein Csa_7G419590 [Cucumis sativus]
Length=642

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 109/155 (70%), Gaps = 11/155 (7%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTF  353
            +P G ++F+TVG + YGFDIFSV L S          E +LTDG+S+NFN  FL+   + 
Sbjct  3    NPTGAVLFTTVGLNQYGFDIFSVPLNSL-------TVERQLTDGISVNFNAQFLNNQLSV  55

Query  354  VFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVF  533
            VF+SERSGS RIYL ++ ++S   P  L S  G+ FHDRP+V +GRLL+ISAHE P + F
Sbjct  56   VFISERSGSSRIYLSDSPNSS---PKLLASAPGSCFHDRPIVTNGRLLFISAHENPHKPF  112

Query  534  KSWSALYSTHL-GLKEITRLTPYGAVDFSPSVSQS  635
             SW+ALYST L G   +TRLTP G+VDFSP+VS+S
Sbjct  113  TSWAALYSTPLDGHDSVTRLTPLGSVDFSPAVSES  147



>ref|XP_010522850.1| PREDICTED: uncharacterized protein LOC104801322 [Tarenaya hassleriana]
Length=649

 Score =   154 bits (389),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 108/155 (70%), Gaps = 13/155 (8%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLD-EGDTF  353
            P GTI+F+TVGR++YGFD+FS  +PS        A+E RLTDGVS+NFNGHF D +G + 
Sbjct  4    PRGTIIFTTVGRTYYGFDLFSFHIPS--------ATERRLTDGVSVNFNGHFSDGDGHSV  55

Query  354  VFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVF  533
            VFVSER+ S R+Y     + +   P QL     +LFHDRPVVRD RL ++SAHE P   F
Sbjct  56   VFVSERTASARVYRTRPDNPT---PEQLPGAPDSLFHDRPVVRDNRLYFVSAHEQPDCHF  112

Query  534  KSWSALYSTHLGL-KEITRLTPYGAVDFSPSVSQS  635
            KSWSALY+  LG  ++ TRLTP  A D+SP+VS+S
Sbjct  113  KSWSALYAAELGSDRKPTRLTPPSAADYSPAVSRS  147



>ref|XP_010069735.1| PREDICTED: uncharacterized protein LOC104456605 [Eucalyptus grandis]
Length=702

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 124/202 (61%), Gaps = 34/202 (17%)
 Frame = +3

Query  99   SHRFF----PLCTQILSSLRIP-----KPPI------MIMDPHGTIVFSTVGRSHYGFDI  233
            S RFF    P  T I +++R        P +      ++ +P GT++F+TVGR ++GFD+
Sbjct  7    SRRFFTSLHPATTTIFTAVRFSISRSLAPSVTRFLHHLMDEPTGTVLFTTVGRPYFGFDV  66

Query  234  FSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL--------DEGDTFVFVSERSGSPRI  389
            FS+ L S          E RLTDG+SINFN  F         D+ +  VFVS+R+G PR+
Sbjct  67   FSLDLAS--------GRERRLTDGLSINFNAQFASAGGEDGEDDPEAVVFVSDRTGCPRV  118

Query  390  YLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLG  569
            YL   RS S+ +P  L S  G+LFHDRPV+R+GRL +ISAHE P + F SWSALYS  L 
Sbjct  119  YLA--RSGSS-QPEPLPSAPGSLFHDRPVLRNGRLYFISAHEDPSKPFASWSALYSADLE  175

Query  570  LKEITRLTPYGAVDFSPSVSQS  635
              +  RLTPYG+ D+SP+VS+S
Sbjct  176  GTQFARLTPYGSADYSPAVSRS  197



>ref|XP_003637684.1| Protein tolB [Medicago truncatula]
 gb|KEH40612.1| translocation protein TolB [Medicago truncatula]
Length=657

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 103/156 (66%), Gaps = 16/156 (10%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD-TF  353
            P GTIVFST+GR+ YGFD+F   L +    D      H LTDG+SINFN  F D+   T 
Sbjct  4    PIGTIVFSTIGRAQYGFDVFYTNLKNHSNHD------HCLTDGISINFNAQFTDDDQKTI  57

Query  354  VFVSERSGSPRIYLQENRSASAGKPPQLL-SPSGTLFHDRPVVRDGRLLYISAHEPPKEV  530
            VFVSER+GSPR YL     +  G  P+LL SP   +F DRP +R+G+L ++S HE P E+
Sbjct  58   VFVSERTGSPRFYL-----SKLGNEPELLPSPLNAVFLDRPTIRNGKLYFVSTHEQPNEL  112

Query  531  FKSWSALYSTHL---GLKEITRLTPYGAVDFSPSVS  629
            FKSW+A+YST +   G    TRLTPYG VD+SP+VS
Sbjct  113  FKSWTAVYSTAINSAGTSTFTRLTPYGVVDYSPAVS  148



>gb|KCW58166.1| hypothetical protein EUGRSUZ_H00884 [Eucalyptus grandis]
Length=658

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 109/162 (67%), Gaps = 19/162 (12%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL------  335
            +P GT++F+TVGR ++GFD+FS+ L S          E RLTDG+SINFN  F       
Sbjct  3    EPTGTVLFTTVGRPYFGFDVFSLDLAS--------GRERRLTDGLSINFNAQFASAGGED  54

Query  336  --DEGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISA  509
              D+ +  VFVS+R+G PR+YL   RS S+ +P  L S  G+LFHDRPV+R+GRL +ISA
Sbjct  55   GEDDPEAVVFVSDRTGCPRVYLA--RSGSS-QPEPLPSAPGSLFHDRPVLRNGRLYFISA  111

Query  510  HEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            HE P + F SWSALYS  L   +  RLTPYG+ D+SP+VS+S
Sbjct  112  HEDPSKPFASWSALYSADLEGTQFARLTPYGSADYSPAVSRS  153



>gb|KCW45417.1| hypothetical protein EUGRSUZ_L00885 [Eucalyptus grandis]
Length=531

 Score =   151 bits (381),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 109/163 (67%), Gaps = 20/163 (12%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL------  335
            +P GT++F+T+G  +YGFD+FS+ L S          E RLTDG+SINFN  F       
Sbjct  3    EPKGTVLFTTIGCPYYGFDVFSLDLTSH--------REPRLTDGLSINFNAQFASVSASD  54

Query  336  ---DEGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYIS  506
               DE +  VFVSE +G PR+YL   RS S+ +P  LLS  G+LFHDRPV+R+ RL +IS
Sbjct  55   EDDDEPEAVVFVSEWTGCPRVYL--TRSGSS-QPQPLLSAPGSLFHDRPVLRNRRLYFIS  111

Query  507  AHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            AHE P + F  WSALYS  L  +EI RLTPYG+VD+SP+VS+S
Sbjct  112  AHEEPDKPFAGWSALYSPDLEGREIARLTPYGSVDYSPAVSRS  154



>gb|KDP28318.1| hypothetical protein JCGZ_14089 [Jatropha curcas]
Length=703

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 113/159 (71%), Gaps = 7/159 (4%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS-EHRLTDGVSINFNGHFLDE-G  344
            M+P GTIVF+TVGR +YGFD+F V+LPS+ +  +   S E+RLTDGVSINFN  F++E  
Sbjct  47   MNPTGTIVFTTVGRPNYGFDVFFVRLPSNLKDFKFSNSDENRLTDGVSINFNAQFINEHN  106

Query  345  DTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPK  524
             + V+VSER+G  RIYL ++  +   + P +     +LFHDRP++++ RL ++SAHE P 
Sbjct  107  QSIVYVSERTGCSRIYLSKSGVSETERLPFVPE---SLFHDRPIIKNNRLYFVSAHERPD  163

Query  525  EVFKSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQS  635
            + F+SW ALY+T L    + ITRLTP G +D+SP++S S
Sbjct  164  QPFRSWCALYATDLNDQKRNITRLTPPGVIDYSPAISHS  202



>ref|XP_002515212.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47196.1| conserved hypothetical protein [Ricinus communis]
Length=666

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 109/164 (66%), Gaps = 13/164 (8%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS-EHRLTDGVSINFNGHFLDE---  341
            +P GT+VF+TVGR  YGFD+FS++LPS         S EH LTDG SIN+N  F+ +   
Sbjct  3    NPKGTVVFTTVGRPSYGFDVFSIKLPSDLNSFHFSNSDEHCLTDGTSINYNAQFVTQQHH  62

Query  342  -GDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEP  518
               + V++SERSG P +YL +    +  KP QL S   +LFHDRP++++ RL +ISAHE 
Sbjct  63   QNQSIVYISERSGFPAMYLSK---PNLSKPEQLPSAPESLFHDRPIIKNDRLYFISAHEK  119

Query  519  PKEVFKSWSALYSTHLGL-----KEITRLTPYGAVDFSPSVSQS  635
            P ++F+SWSALYST L         +TRLTP+G VDFSP++S S
Sbjct  120  PDQLFRSWSALYSTDLSHSRREGDNVTRLTPFGVVDFSPAISLS  163



>ref|XP_006396381.1| hypothetical protein EUTSA_v10029172mg, partial [Eutrema salsugineum]
 gb|ESQ37834.1| hypothetical protein EUTSA_v10029172mg, partial [Eutrema salsugineum]
Length=430

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 101/156 (65%), Gaps = 14/156 (9%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            P GTI+F+TVGR+HYGFD+FS+ + S        A E RLTDGVS+NFN  F ++    V
Sbjct  4    PSGTIIFTTVGRTHYGFDVFSLHINS--------AVERRLTDGVSVNFNAQFANDNGDVV  55

Query  357  FVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEVF  533
            FVSER+GS RI+          KP QL     + FHDRPV+ ++ RL +ISAHE P   F
Sbjct  56   FVSERAGSARIFRTR---PGDSKPEQLPGAPQSFFHDRPVITQNNRLYFISAHEQPDRHF  112

Query  534  KSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQS  635
            K+WSALYS  L    +E+TR+TP    DFSP+VSQS
Sbjct  113  KNWSALYSVKLDGEEREVTRVTPLDTADFSPAVSQS  148



>gb|AAM13860.1| unknown protein [Arabidopsis thaliana]
Length=657

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 15/157 (10%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  353
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F+ D+ D  
Sbjct  9    PKGTIIFTTVGRTHYGFDVFSLNIATSVER--------RLTDGVSVNFNAQFVNDKSDDV  60

Query  354  VFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEV  530
            VFVSER+GS RIY  + RS  + KP Q+     + FHDRP++ ++ RL +ISAHE P   
Sbjct  61   VFVSERNGSARIY--KTRSGIS-KPEQIPGAPESYFHDRPIITQNNRLYFISAHEQPDRY  117

Query  531  FKSWSALYSTHL--GLKEITRLTPYGAVDFSPSVSQS  635
            FK+WSALY+  L    +E+TR+TP    DFSP+VSQS
Sbjct  118  FKNWSALYTVELNSAKREVTRVTPPDTTDFSPAVSQS  154



>ref|NP_192096.1| tolB-related protein [Arabidopsis thaliana]
 gb|AAD22649.1|AC007138_13 predicted protein of unknown function [Arabidopsis thaliana]
 emb|CAB80680.1| predicted protein of unknown function [Arabidopsis thaliana]
 gb|AAP04154.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99158.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE82088.1| tolB-related protein [Arabidopsis thaliana]
Length=652

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 108/157 (69%), Gaps = 15/157 (10%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  353
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F+ D+ D  
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLNIATSVER--------RLTDGVSVNFNAQFVNDKSDDV  55

Query  354  VFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEV  530
            VFVSER+GS RIY  + RS  + KP Q+     + FHDRP++ ++ RL +ISAHE P   
Sbjct  56   VFVSERNGSARIY--KTRSGIS-KPEQIPGAPESYFHDRPIITQNNRLYFISAHEQPDRY  112

Query  531  FKSWSALYSTHL--GLKEITRLTPYGAVDFSPSVSQS  635
            FK+WSALY+  L    +E+TR+TP    DFSP+VSQS
Sbjct  113  FKNWSALYTVELNSAKREVTRVTPPDTADFSPAVSQS  149



>ref|XP_008227800.1| PREDICTED: uncharacterized protein LOC103327273 [Prunus mume]
Length=712

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 112/171 (65%), Gaps = 20/171 (12%)
 Frame = +3

Query  159  PIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-  335
            PI + DP GT+VFSTVGR HYGFD+FS+ L S+F      ASEHRL+DG+S+NFN  F  
Sbjct  49   PITMNDPKGTVVFSTVGRPHYGFDLFSLPLHSAFNN---LASEHRLSDGISVNFNAQFAN  105

Query  336  DEGDTFVFVSERSGSPRIYLQENRSASAGKP-PQLL-SPSGTLFHDRPVVRDGRLLYISA  509
            D+  + VF+SER+G P IYL        G P P+LL S  G+LFHDRP++++  L +ISA
Sbjct  106  DDPHSVVFISERTGLPAIYLTR-----PGLPTPKLLHSEPGSLFHDRPILKNDILYFISA  160

Query  510  HEPPKEVFKSWSALYSTHLGL---------KEITRLTPYGAVDFSPSVSQS  635
            H+ P   FKSWSALYST              + TRLTP  +VD+SP++S S
Sbjct  161  HQHPNRPFKSWSALYSTTTTFLLDEDQNQNTKTTRLTPSDSVDYSPAISLS  211



>ref|XP_006396377.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
 gb|ESQ37830.1| hypothetical protein EUTSA_v10029281mg [Eutrema salsugineum]
Length=601

 Score =   145 bits (366),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 103/156 (66%), Gaps = 14/156 (9%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            P GTI+F+TVGR+HYGFD+FS+ + S        A E RLTDGVS+NFN  F ++    V
Sbjct  4    PSGTIIFTTVGRTHYGFDVFSLHINS--------AVERRLTDGVSVNFNAQFANDNGDVV  55

Query  357  FVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEVF  533
            FVSER+GS RI+    R   + KP QL     + FHDRPV+ ++ RL +ISAHE P   F
Sbjct  56   FVSERAGSARIF--RTRPGDS-KPEQLPGAPQSFFHDRPVITQNNRLYFISAHEQPDRHF  112

Query  534  KSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQS  635
            K+WSALYS  L    +E+TR+TP    DFSP+VSQS
Sbjct  113  KNWSALYSVKLDGEEREVTRVTPLDTADFSPAVSQS  148



>ref|XP_010428858.1| PREDICTED: uncharacterized protein LOC104713446 [Camelina sativa]
Length=651

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 105/156 (67%), Gaps = 15/156 (10%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F   GD  V
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLHIATSVER--------RLTDGVSVNFNAQFT-SGDDVV  54

Query  357  FVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEVF  533
            FVSER+GS RI+    R  ++ +P QL    G+ FHDRP+V +  RL +ISAHE P   F
Sbjct  55   FVSERNGSARIF--RTRPGNS-EPEQLPGAPGSYFHDRPIVTQSNRLYFISAHEQPDRHF  111

Query  534  KSWSALYSTHLGLK--EITRLTPYGAVDFSPSVSQS  635
            K+WSALY+  L  K  E+TR+TP    DFSP+VSQS
Sbjct  112  KNWSALYTVELNDKKREVTRITPPDVADFSPAVSQS  147



>ref|XP_010091406.1| hypothetical protein L484_013861 [Morus notabilis]
 gb|EXB44443.1| hypothetical protein L484_013861 [Morus notabilis]
Length=662

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 105/162 (65%), Gaps = 18/162 (11%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT  350
            MDP GTIVF+TVGR  YGFD+FS+ L  S         E RL+D +SINFNG F D  D 
Sbjct  1    MDPKGTIVFTTVGRPSYGFDLFSLPLDHS-------GPERRLSDALSINFNGQFSDSDDV  53

Query  351  FVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEV  530
             VFVSER+GSPR+YL         +P  L     +LFHDRPV+++G+L +ISAH+ P + 
Sbjct  54   -VFVSERTGSPRVYLTR---PGLPRPKSLPFVPESLFHDRPVLKNGKLYFISAHQRPDQP  109

Query  531  FKSWSALYSTHLGLKE-------ITRLTPYGAVDFSPSVSQS  635
            FKSWSALYST L   +       ITRLTP G+ D+SP+VS S
Sbjct  110  FKSWSALYSTSLIKGDYNPDEIVITRLTPQGSADYSPAVSLS  151



>ref|XP_002461097.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
 gb|EER97618.1| hypothetical protein SORBIDRAFT_02g040640 [Sorghum bicolor]
Length=669

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 105/164 (64%), Gaps = 9/164 (5%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA------SEHRLTDGVSINFNGHF  332
            M+P GTIVF++VG +++GFD+FSV +P+    +           E R TDGVS+NFN  F
Sbjct  1    MEPTGTIVFASVGVTNFGFDVFSVAVPTPASAEAEAGVSAQELDERRHTDGVSVNFNAQF  60

Query  333  LDE-GDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISA  509
             D+ GD   FVSER+G+  ++L     + + +P  L +  G+LFHDRP VR GR+ ++SA
Sbjct  61   ADDAGDAVAFVSERTGAASLFLSRPPGSESDRPEPLPAAEGSLFHDRPTVRGGRVYFVSA  120

Query  510  HEPPKEVFKSWSALYSTHLGLK--EITRLTPYGAVDFSPSVSQS  635
            HE P   F+SW+A+Y+  +G +  E  RLTP G VD SP+VS S
Sbjct  121  HEKPDRTFQSWAAVYAARVGERKAEPERLTPRGVVDMSPAVSAS  164



>ref|XP_002872871.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49130.1| hypothetical protein ARALYDRAFT_490390 [Arabidopsis lyrata subsp. 
lyrata]
Length=652

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 102/157 (65%), Gaps = 15/157 (10%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  353
            P GTI+F+TVGR+HYGFD+FS+ + +        A E RLTDGVS+NFN  F+ D+ D  
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLHIAT--------AVERRLTDGVSVNFNAQFVNDKSDDV  55

Query  354  VFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVV-RDGRLLYISAHEPPKEV  530
            VFVSER+GS RIY          +P QL     + FHDRP++ +  RL +ISAHE P   
Sbjct  56   VFVSERNGSARIYKTR---PGISEPEQLPGAPESYFHDRPIITQSNRLYFISAHEQPDRH  112

Query  531  FKSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQS  635
            FK+WSALY+  L    +E+TR+TP    DFSP+VSQS
Sbjct  113  FKNWSALYTVELNGEEREVTRVTPLDTADFSPAVSQS  149



>gb|EPS68684.1| hypothetical protein M569_06083, partial [Genlisea aurea]
Length=638

 Score =   142 bits (359),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/154 (51%), Positives = 105/154 (68%), Gaps = 14/154 (9%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE-GDTFVF  359
            GT++FSTV R  YGFD+FSV L  +        SE  LTDGVS+NFN  F D+ G + VF
Sbjct  2    GTVIFSTVDRQFYGFDVFSVGLTPN-------TSEQLLTDGVSVNFNAQFADDVGKSIVF  54

Query  360  VSERSGSPRIYLQENRSASAGKPPQLL-SPSGTLFHDRPVVRDGRLLYISAHEPPKEVFK  536
            +SER+G+PRI+L  +       PPQ L S  G+LFHDRP+V +GRL +ISAHE P + F+
Sbjct  55   ISERTGAPRIFLLRD----GDSPPQELGSVRGSLFHDRPIVNNGRLYFISAHELPGKPFR  110

Query  537  SWSALYSTHLGL-KEITRLTPYGAVDFSPSVSQS  635
            SW+ALYS  + + +E  RL+P G  D+SP++S+S
Sbjct  111  SWTALYSVAIDVEEEAVRLSPPGCADYSPAISKS  144



>gb|EAZ40813.1| hypothetical protein OsJ_25290 [Oryza sativa Japonica Group]
Length=594

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 104/157 (66%), Gaps = 8/157 (5%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLP-SSFEQDRRPASEHRLTDGVSINFNGHFLDEG-  344
            M+P GTIVF+TVG +++GFD+FS  +P    E+D    +E R TDGVS+NFN  F+D+G 
Sbjct  1    MEPTGTIVFATVGVTNFGFDVFSAAVPLPPMEED----AERRHTDGVSVNFNAQFVDDGG  56

Query  345  DTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPK  524
            +   FVSER G+  ++    R     +   L +  G+LFHDRP VR GRL ++SAHE P 
Sbjct  57   EEVAFVSERGGAAGLF--RCRPGPEQRAEPLPTVEGSLFHDRPTVRGGRLYFVSAHEQPP  114

Query  525  EVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
              F+SW+A+Y+T +G KE  R++P G VD SP+VS S
Sbjct  115  APFRSWAAVYATEIGSKETVRVSPPGVVDMSPAVSDS  151



>ref|XP_003529216.2| PREDICTED: uncharacterized protein LOC100814036 [Glycine max]
Length=704

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 102/156 (65%), Gaps = 7/156 (4%)
 Frame = +3

Query  168  IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD  347
            ++ P GTIVF+TVGR  YGFD+FSV L    +      ++HRLTDGVSINFN  F++  +
Sbjct  49   MLPPAGTIVFNTVGRVQYGFDVFSVDLNHQ-QPPPHATADHRLTDGVSINFNAQFINPQN  107

Query  348  TFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  527
              VFVSER+GSPR Y+ +  +    KP  L      LFHDRP+V++G+L ++S HE    
Sbjct  108  DVVFVSERTGSPRFYITKPDT----KPQPLPFLPNALFHDRPIVKNGKLYFVSTHEENDA  163

Query  528  VFKSWSALYSTHL--GLKEITRLTPYGAVDFSPSVS  629
            VF SWSA+YST +      + RLTP G VD+SP+VS
Sbjct  164  VFTSWSAVYSTAIDDSTATVKRLTPRGEVDYSPAVS  199



>ref|XP_010679438.1| PREDICTED: uncharacterized protein LOC104894805 [Beta vulgaris 
subsp. vulgaris]
Length=668

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 102/149 (68%), Gaps = 11/149 (7%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  362
            G+IVFSTVGR+ YGFDIF V L     QD   A+EH LTDG+SINFNG F+D+ +T VF+
Sbjct  17   GSIVFSTVGRTEYGFDIFCVSL-----QDT--ATEHCLTDGISINFNGQFVDDNNTLVFI  69

Query  363  SERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSW  542
            SER+G P++YL   R  S+  P +L S   +LFHDRP++    L ++SAHEP   ++KS 
Sbjct  70   SERNGVPQVYLT--RPNSSDSPEKLPSAPRSLFHDRPILYGDCLYFVSAHEPTDSLYKSC  127

Query  543  SALYSTHLGLKEITRLTPYGAVDFSPSVS  629
            SA+YS    +   TRLTP G  DFSP++S
Sbjct  128  SAVYSIQSNIP--TRLTPPGTADFSPALS  154



>dbj|BAJ89339.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 102/156 (65%), Gaps = 5/156 (3%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA-SEHRLTDGVSINFNGHFLDE-GD  347
            +P GT+VF++VG + +GFD+FSV +P + E       +E R TDGVS+NFN  F D+ G+
Sbjct  6    EPTGTVVFASVGVTSFGFDVFSVAVPQTPESVSAAGLAERRHTDGVSVNFNAQFADDVGE  65

Query  348  TFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  527
               FVSER+GS  ++L    S  A   P +    G+LFHDRP VR GRL ++S+HE P  
Sbjct  66   EVAFVSERTGSAGLFLCRPESERAVPLPVV---EGSLFHDRPAVRGGRLYFVSSHEKPAA  122

Query  528  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             F+SW+A+Y+T LG +E  R+TP G  D SP+VS S
Sbjct  123  WFRSWAAVYATELGSEETVRVTPQGVADMSPAVSTS  158



>ref|NP_001060406.1| Os07g0638100 [Oryza sativa Japonica Group]
 dbj|BAC45195.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22320.1| Os07g0638100 [Oryza sativa Japonica Group]
Length=659

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 104/157 (66%), Gaps = 8/157 (5%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLP-SSFEQDRRPASEHRLTDGVSINFNGHFLDEG-  344
            M+P GTIVF+TVG +++GFD+FS  +P    E+D    +E R TDGVS+NFN  F+D+G 
Sbjct  1    MEPTGTIVFATVGVTNFGFDVFSAAVPLPPMEED----AERRHTDGVSVNFNAQFVDDGG  56

Query  345  DTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPK  524
            +   FVSER G+  ++    R     +   L +  G+LFHDRP VR GRL ++SAHE P 
Sbjct  57   EEVAFVSERGGAAGLF--RCRPGPEQRAEPLPTVEGSLFHDRPTVRGGRLYFVSAHEQPP  114

Query  525  EVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
              F+SW+A+Y+T +G KE  R++P G VD SP+VS S
Sbjct  115  APFRSWAAVYATEIGSKETVRVSPPGVVDMSPAVSDS  151



>gb|AJD80981.1| ABA-activated 1 protein [Lupinus luteus]
Length=647

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 103/158 (65%), Gaps = 11/158 (7%)
 Frame = +3

Query  168  IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLD---  338
            ++ P GTIVF+TVGR  YGFD+FSV L     Q     ++HRLTDGVSINFN  F+D   
Sbjct  1    MLPPAGTIVFNTVGRPQYGFDVFSVDL---HHQPPHAVTDHRLTDGVSINFNAQFIDNDE  57

Query  339  EGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEP  518
            E ++ VF+SER+GSPR YL    +    KP  L     +LFHDR  +++G++ ++S H+ 
Sbjct  58   EQNSIVFISERTGSPRCYL----TRPGNKPQPLPFVPNSLFHDRATIKNGKMYFVSTHDE  113

Query  519  PKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVS  629
               VFKSWSA+YST + G   + RLTP   VD+SP+VS
Sbjct  114  NDTVFKSWSAVYSTDIDGDGTVIRLTPKDVVDYSPAVS  151



>ref|XP_003637686.1| Protein tolB [Medicago truncatula]
 gb|KEH40586.1| translocation protein TolB [Medicago truncatula]
 gb|KEH40614.1| translocation protein TolB [Medicago truncatula]
Length=650

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/154 (49%), Positives = 104/154 (68%), Gaps = 14/154 (9%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            P GTIVF+TVGR+ YGFD+F   L ++        ++HRLTDG+S+NFN  F ++  T V
Sbjct  4    PSGTIVFNTVGRTQYGFDVFYTHLNNNH-------NDHRLTDGISVNFNAQFTNDHQTIV  56

Query  357  FVSERSGSPRIYLQENRSASAGKPPQLLS--PSGTLFHDRPVVRDGRLLYISAHEPPKEV  530
            FVSER+GSPR YL    + S  KP  LL   P+ TLF D P++++ ++ + S H+ P  +
Sbjct  57   FVSERTGSPRFYL----TRSENKPELLLPSLPNNTLFQDCPIIKNSKIYFSSTHDQPNAL  112

Query  531  FKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVS  629
            FKS SA+YST + G   +TRLTP+G VD+SP+VS
Sbjct  113  FKSASAVYSTAVDGTGTLTRLTPHGVVDYSPAVS  146



>gb|EAZ04851.1| hypothetical protein OsI_27029 [Oryza sativa Indica Group]
Length=659

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 104/157 (66%), Gaps = 8/157 (5%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLP-SSFEQDRRPASEHRLTDGVSINFNGHFLDEG-  344
            M+P GTIVF+TVG +++GFD+FS  +P    E+D    +E R TDGVS+NFN  F+D+G 
Sbjct  1    MEPTGTIVFATVGVTNFGFDVFSAAVPLPPMEED----AERRHTDGVSVNFNAQFVDDGG  56

Query  345  DTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPK  524
            +   FVSER G+  ++    R     +   L +  G+LFHDRP VR GRL ++SAHE P 
Sbjct  57   EEVAFVSERGGAAGLF--RCRPGPEQRAEPLPTVEGSLFHDRPTVRGGRLYFVSAHEQPP  114

Query  525  EVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
              F+SW+A+Y+T +G KE  R++P G VD SP+VS S
Sbjct  115  APFRSWAAVYATEIGSKETVRVSPPGVVDMSPAVSDS  151



>dbj|BAJ94262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 102/156 (65%), Gaps = 5/156 (3%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA-SEHRLTDGVSINFNGHFLDE-GD  347
            +P GT+VF++VG + +GFD+FSV +P + E       +E R TDGVS+NFN  F D+ G+
Sbjct  6    EPTGTVVFASVGVTSFGFDVFSVAVPQTPESVSAAGLAERRHTDGVSVNFNAQFADDVGE  65

Query  348  TFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  527
               FVSER+GS  ++L    S  A   P +    G+LFHDRP VR GRL ++S+HE P  
Sbjct  66   EVAFVSERTGSAGLFLCRPESERAVPLPVV---EGSLFHDRPAVRGGRLYFVSSHEKPAA  122

Query  528  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             F+SW+A+Y+T LG +E  R+TP G  D SP+VS S
Sbjct  123  WFRSWAAVYATELGSEETVRVTPQGVADMSPAVSTS  158



>emb|CDX74396.1| BnaA03g26510D [Brassica napus]
Length=650

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 108/160 (68%), Gaps = 16/160 (10%)
 Frame = +3

Query  171  MD-PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE-G  344
            MD P GTI+F+TVGR+HYGFD+FS+ + SS E+        RLTDGVS+NFN  F D+ G
Sbjct  1    MDTPSGTIIFTTVGRTHYGFDVFSLHIASSVER--------RLTDGVSVNFNAQFADDNG  52

Query  345  DTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVV-RDGRLLYISAHEPP  521
            +  VFVSER+GS RI+    R  ++ KP QL     + FHDRP++ +D  L +ISAHE P
Sbjct  53   NDIVFVSERAGSARIF--RTRPGNS-KPEQLPGAPESFFHDRPIITQDNTLYFISAHEQP  109

Query  522  KEVFKSWSALYSTHLGLKE--ITRLTPYGAVDFSPSVSQS  635
               FK+W+ALYS +   KE  +TR+TP    DFSP++S+S
Sbjct  110  DRHFKNWTALYSVNPNSKEKAVTRVTPPDTADFSPTISKS  149



>ref|XP_009134471.1| PREDICTED: uncharacterized protein LOC103858800 [Brassica rapa]
Length=650

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 108/160 (68%), Gaps = 16/160 (10%)
 Frame = +3

Query  171  MD-PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE-G  344
            MD P GTI+F+TVGR+HYGFD+FS+ + SS E+        RLTDGVS+NFN  F D+ G
Sbjct  1    MDTPSGTIIFTTVGRTHYGFDVFSLHIASSVER--------RLTDGVSVNFNAQFADDNG  52

Query  345  DTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVV-RDGRLLYISAHEPP  521
            +  VFVSER+GS RI+    R  ++ KP QL     + FHDRP++ +D  L +ISAHE P
Sbjct  53   NDIVFVSERAGSARIF--RTRPGNS-KPEQLPGAPESFFHDRPIITQDNTLYFISAHEQP  109

Query  522  KEVFKSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQS  635
               FK+W+ALYS +     KE+TR+TP    DFSP++S+S
Sbjct  110  DRHFKNWTALYSVNPNSQEKEVTRVTPPDTADFSPAISKS  149



>ref|XP_004498256.1| PREDICTED: uncharacterized protein LOC101515113 [Cicer arietinum]
Length=652

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 109/161 (68%), Gaps = 14/161 (9%)
 Frame = +3

Query  165  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP---ASEHRLTDGVSINFNGHFL  335
            M  +  GTIVF+TVGR+ YGFD+FSV L     Q+  P   + EH LTDG S+NFN  F 
Sbjct  1    MANELTGTIVFNTVGRAQYGFDVFSVNL-----QNDTPFQISHEHCLTDGTSVNFNAQFT  55

Query  336  D--EGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISA  509
            +  +  + VF+SER+GSPRIY+ +    +  +P   +S S  LFHDRP++++ +L ++SA
Sbjct  56   ESKQNQSIVFISERTGSPRIYITQPEKENPVEPLAFVSES--LFHDRPIIKNEKLYFVSA  113

Query  510  HEPPKEVFKSWSALYSTHL-GLKEITRLTPYGAVDFSPSVS  629
            H+ P  +FKSW A+YST + G   ITR+TP+G VD+SP+VS
Sbjct  114  HD-PNVLFKSWCAVYSTSVNGDGNITRITPHGIVDYSPAVS  153



>gb|KFK30736.1| hypothetical protein AALP_AA6G020600 [Arabis alpina]
Length=648

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 103/156 (66%), Gaps = 13/156 (8%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            P GTI+F+T+GR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F ++ +  V
Sbjct  4    PRGTIIFTTIGRTHYGFDVFSLNIATSVER--------RLTDGVSVNFNAQFTND-NNIV  54

Query  357  FVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLY-ISAHEPPKEVF  533
            FVSER+GS R+Y     + ++ KP QL     + FHDRP++     LY ISAHE P   F
Sbjct  55   FVSERAGSARLYKTRPGTENS-KPEQLPGAPDSFFHDRPILTHNNTLYFISAHEQPDRHF  113

Query  534  KSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQS  635
            K+W+ALY+  L    +EITR+TP    DFSP+VS+S
Sbjct  114  KNWTALYAVKLNDDEREITRVTPLNTADFSPAVSKS  149



>ref|XP_010422681.1| PREDICTED: uncharacterized protein LOC104707922 [Camelina sativa]
Length=651

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 102/156 (65%), Gaps = 15/156 (10%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            P GTI+F+TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F   GD  V
Sbjct  4    PKGTIIFTTVGRTHYGFDVFSLHIATSLER--------RLTDGVSVNFNAQFT-SGDNVV  54

Query  357  FVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLY-ISAHEPPKEVF  533
            FVSER+GS  I+    R  ++ +P QL     + FHDRP+V    +LY ISAHE P   F
Sbjct  55   FVSERNGSATIF--RTRPGNS-EPEQLPGAPDSYFHDRPIVTQSNILYFISAHEQPDRHF  111

Query  534  KSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQS  635
            K+WSALY+  L    +E+TR+TP    DFSP+VSQS
Sbjct  112  KNWSALYAVELNGEKREVTRVTPPDVADFSPAVSQS  147



>ref|XP_009367159.1| PREDICTED: uncharacterized protein LOC103956844 [Pyrus x bretschneideri]
Length=715

 Score =   139 bits (350),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/167 (51%), Positives = 108/167 (65%), Gaps = 17/167 (10%)
 Frame = +3

Query  159  PIMIMDPHGTIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGH  329
            P M  DP GT+VFSTVGR +YGFDIF++ +   PSS         E RL+DG SINFN  
Sbjct  53   PTMNTDPKGTVVFSTVGRPNYGFDIFALPILLHPSS----TNIGPERRLSDGRSINFNAQ  108

Query  330  FLD---EGDTFVFVSERSGSPRIYLQENRSASAGKP-PQLL-SPSGTLFHDRPVVRDGRL  494
            F D   E  + VF+SER+G P IYL        G P PQ+L S  G+LFHDRP++++  L
Sbjct  109  FADNNHEPHSLVFISERTGFPAIYLTR-----PGLPHPQVLHSEPGSLFHDRPIIKNHTL  163

Query  495  LYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             ++SAH+ P   FKSWSALYS+ L  K  TRLTP  +VD+SP++S S
Sbjct  164  YFVSAHQDPGRYFKSWSALYSSTLHDKITTRLTPSDSVDYSPALSLS  210



>ref|XP_006289995.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
 gb|EOA22893.1| hypothetical protein CARUB_v10003625mg [Capsella rubella]
Length=650

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 101/157 (64%), Gaps = 17/157 (11%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            P GTI+++TVGR+HYGFD+FS+ + +S E+        RLTDGVS+NFN  F   GD  V
Sbjct  4    PKGTIIYTTVGRTHYGFDVFSLHIATSVER--------RLTDGVSVNFNAQFT--GDDVV  53

Query  357  FVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVV--RDGRLLYISAHEPPKEV  530
            FVSER+GS R+Y          +P QL     + FHDRP++  +  +L +ISAHE P   
Sbjct  54   FVSERTGSARVYRTR---PGKPEPEQLPGAPDSYFHDRPIIVSQSNKLYFISAHEQPDRH  110

Query  531  FKSWSALYSTHLG--LKEITRLTPYGAVDFSPSVSQS  635
            FK+WSALY+  L    +E+TR+TP    DFSP+VSQS
Sbjct  111  FKNWSALYAVELNGDKREVTRVTPPDVADFSPAVSQS  147



>ref|XP_006658881.1| PREDICTED: uncharacterized protein LOC102705738, partial [Oryza 
brachyantha]
Length=502

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 99/156 (63%), Gaps = 4/156 (3%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG-D  347
            M+P GTIVF+TVG + +GFD+FS  +P    Q   P +E R TDGVS+NFN  F+D+  +
Sbjct  1    MEPTGTIVFATVGVTSFGFDVFSSPVPPPPLQSTAPGAERRHTDGVSVNFNAQFVDDAAE  60

Query  348  TFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEPPKE  527
               FVSER G+  +++       A   P +    G+LFHDRP VR GR+ ++SAHE P  
Sbjct  61   EVAFVSERGGAAGLFVCRPGDERAEPLPAV---EGSLFHDRPTVRGGRMYFVSAHERPPV  117

Query  528  VFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             F+SW+A+Y T L  KE  R++P G VD SP+VS S
Sbjct  118  PFRSWAAVYVTDLARKETARVSPPGVVDMSPAVSAS  153



>ref|XP_007153254.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
 gb|ESW25248.1| hypothetical protein PHAVU_003G019700g [Phaseolus vulgaris]
Length=687

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 102/162 (63%), Gaps = 17/162 (10%)
 Frame = +3

Query  168  IMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP----ASEHRLTDGVSINFNGHFL  335
            ++ P GT+VF+TVGR  YGFD+FSV L        RP    +++HRLTDG+SINFN  F+
Sbjct  32   MLPPPGTVVFNTVGRPQYGFDVFSVDL-----HRHRPPPHASTDHRLTDGLSINFNAQFI  86

Query  336  DEGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHE  515
               +  VFVSER+GSPR Y+    +    KP  L      LF DRP++R+G L ++S H 
Sbjct  87   SHQNDVVFVSERTGSPRFYI----TRPDNKPQPLSFLPNALFLDRPIIRNGNLYFVSTHH  142

Query  516  PPKEVFKSWSALYSTHL----GLKEITRLTPYGAVDFSPSVS  629
             P EVF SWSA+YS+ +        +TRLTP G VD+SP+VS
Sbjct  143  QPDEVFTSWSAVYSSAVEEGATAATVTRLTPPGEVDYSPAVS  184



>ref|XP_007221548.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
 gb|EMJ22747.1| hypothetical protein PRUPE_ppa002534mg [Prunus persica]
Length=661

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 108/165 (65%), Gaps = 20/165 (12%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-DEGDTF  353
            P GT+VFSTVGR HYGFD+FS  LP  F  +   A EHRL+DG+S+NFN  F  D+  + 
Sbjct  4    PKGTVVFSTVGRPHYGFDLFS--LPLHFSSNNL-ALEHRLSDGISVNFNAQFANDDPHSV  60

Query  354  VFVSERSGSPRIYLQENRSASAGKP-PQLL-SPSGTLFHDRPVVRDGRLLYISAHEPPKE  527
            VF+SER+G P IYL        G P P+LL S  G+LFHDRP++++  L +ISAH+ P  
Sbjct  61   VFISERTGLPAIYLTR-----PGLPTPKLLHSEPGSLFHDRPILKNDILYFISAHQHPNR  115

Query  528  VFKSWSALYSTHLGLK---------EITRLTPYGAVDFSPSVSQS  635
             FKSWSALYST   L          + TRLTP  +VD+SP++SQS
Sbjct  116  PFKSWSALYSTTTTLLLDEDQNQNPKTTRLTPSDSVDYSPAISQS  160



>ref|XP_008653395.1| PREDICTED: uncharacterized protein LOC103633477 [Zea mays]
 tpg|DAA63832.1| TPA: putative WD40-like beta propeller repeat family protein 
[Zea mays]
Length=667

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 104/167 (62%), Gaps = 16/167 (10%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASE----HRLTDGVSINFNGHFLD  338
            M+P GTIVF++VG +++GFD+FS  +P+    +   ++E     R TDG+S+NFN  F D
Sbjct  1    MEPAGTIVFASVGVTNFGFDVFSATVPAPTSAEAGVSAEDLDERRHTDGISVNFNAQFAD  60

Query  339  E-GDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHE  515
            + GD   FVSER+G+  ++L    S    +P  L +  G+LFHDRP VR GR+ ++SAHE
Sbjct  61   DAGDAVAFVSERTGAASLFL----SRPGSEPDPLPAAEGSLFHDRPTVRGGRVYFVSAHE  116

Query  516  PPKEVFKSWSALYSTHLGLK-------EITRLTPYGAVDFSPSVSQS  635
             P   F+SW+A+Y+  LG         +  RLTP G VD SP+VS S
Sbjct  117  KPDRPFRSWAAVYAAELGAGRERNPEPQPQRLTPRGVVDMSPAVSAS  163



>gb|KCW58168.1| hypothetical protein EUGRSUZ_H008851, partial [Eucalyptus grandis]
Length=251

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 100/162 (62%), Gaps = 33/162 (20%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG---  344
            +P GT++F+TVGR +YGFD+FS+ L S     RR   E RLTDG+SINFN  F   G   
Sbjct  3    EPTGTVLFTTVGRPYYGFDVFSLDLAS-----RR---ERRLTDGLSINFNAQFASAGDDE  54

Query  345  -----DTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISA  509
                 +  VFVSER+G PR+YL  +      +P  L S  G+LFHDRP++R+G L +ISA
Sbjct  55   DDDDPEAVVFVSERTGCPRVYLARS---GFSQPEPLPSAPGSLFHDRPILRNGLLYFISA  111

Query  510  HEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            HE                +G +EI RLTPYG+VD+SP+VSQ+
Sbjct  112  HE-------------RRQVG-REIARLTPYGSVDYSPAVSQT  139



>ref|XP_008343202.1| PREDICTED: uncharacterized protein LOC103405949 [Malus domestica]
Length=661

 Score =   130 bits (326),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 102/160 (64%), Gaps = 14/160 (9%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFE-QDRRPASEHRLTDGVSINFNGHFLD---EG  344
            P GT+VFSTVGR HYGFDIF+  LP+           E RL+DG SINFN  F D   E 
Sbjct  4    PKGTVVFSTVGRPHYGFDIFA--LPTLLHPSSTNIGPERRLSDGRSINFNAQFADNSHEP  61

Query  345  DTFVFVSERSGSPRIYLQENRSASAGKP-PQLL-SPSGTLFHDRPVVRDGRLLYISAHEP  518
             + VF+SER+G P IYL        G P PQL  S  G+LFHDRP+ ++  L ++SAH+ 
Sbjct  62   HSLVFISERTGFPAIYLTR-----PGLPHPQLXHSEPGSLFHDRPIJKNHTLYFVSAHQD  116

Query  519  PKEVFKSWSALYSTHLGLKEI-TRLTPYGAVDFSPSVSQS  635
            P   FKSWSALYS+ L   +I TRLTP  +VD+SP++S S
Sbjct  117  PSRYFKSWSALYSSTLLHDKITTRLTPSDSVDYSPALSLS  156



>ref|XP_004958463.1| PREDICTED: uncharacterized protein LOC101757241 [Setaria italica]
Length=666

 Score =   129 bits (324),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 98/161 (61%), Gaps = 9/161 (6%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDE  341
            M+P GTIVF++ G S +GFD+FSV +P +   D   A    E R TDGVS+NFN  F D+
Sbjct  1    MEPTGTIVFASFGVSRFGFDVFSVAVPPAAPDDVPDAKMLDERRHTDGVSVNFNAQFADD  60

Query  342  G-DTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHEP  518
              D   FVSER+G+  ++L    S    +P  L +  G+LFHDRP VR GR+ ++SAHE 
Sbjct  61   ASDAVAFVSERTGAASLFLSRPGSE---RPEPLPAAEGSLFHDRPTVRGGRVYFVSAHEK  117

Query  519  PKEVFKSWSALY--STHLGLKEITRLTPYGAVDFSPSVSQS  635
            P   F+SW+A++          + R+TP G VD SP+VS S
Sbjct  118  PDRPFRSWAAVHAAGLGGEGGAVERVTPRGVVDMSPAVSAS  158



>ref|XP_003562594.1| PREDICTED: uncharacterized protein LOC100822199 [Brachypodium 
distachyon]
Length=674

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 98/159 (62%), Gaps = 10/159 (6%)
 Frame = +3

Query  177  PHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRL-TDGVSINFNGHFLD----E  341
            P GTI F++VG + +GFD+FSV +P S E         R  TDGVS+NFN  F D    E
Sbjct  9    PTGTIAFASVGVTSFGFDVFSVAVPQSPETTTAEELAERCHTDGVSVNFNAQFTDDEAGE  68

Query  342  GDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLLYISAHE-P  518
             +   FVSER+GS  ++L        G+   L +   +LFHDRP +R GRL ++SAHE P
Sbjct  69   EEEVAFVSERTGSAALFLCR----PGGRATPLPAVEESLFHDRPTLRRGRLYFVSAHEKP  124

Query  519  PKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            P   F+SW+ALY+T L  +E +R+TP G VD SP+VS S
Sbjct  125  PGAPFRSWAALYATDLESQETSRVTPEGVVDMSPAVSPS  163



>dbj|BAJ88545.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=706

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 95/169 (56%), Gaps = 18/169 (11%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  362
            GTIVF+T+GRS Y FD++++ L  S      PA+E RLTDG S+N+NG+F    D  +FV
Sbjct  31   GTIVFTTLGRSRYAFDVYALPLAPSLSIPASPAAELRLTDGASVNYNGNFAPSSDALLFV  90

Query  363  SERSGSPRIYLQENRSASAGKPPQLLSPSG----------------TLFHDRPVV-RDG-  488
            SER+GS  IYL     +S+ +   L    G                    DRP + RDG 
Sbjct  91   SERNGSLNIYLSPAPPSSSSRREALQLEDGDSSPAAPPMPLLPWDPVALRDRPALTRDGS  150

Query  489  RLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            RL+Y+S   P     +SW+A+Y+THL     TRLTP G  DFSP+VS S
Sbjct  151  RLVYVSTAVPAAAPRRSWAAVYATHLPSGRATRLTPPGVADFSPAVSPS  199



>ref|XP_005646452.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE21908.1| tricorn protease N-terminal domain-containing protein [Coccomyxa 
subellipsoidea C-169]
Length=732

 Score =   114 bits (284),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 102/172 (59%), Gaps = 7/172 (4%)
 Frame = +3

Query  129  ILSSLRIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGV  308
            I S+  +     +      T+V++TVGR+ Y FDI++  + +  + +   A+E +LTDGV
Sbjct  57   IFSAESLKDTTTLDQQARTTVVYATVGRAQYAFDIYTKLMGNERDPELANAAETQLTDGV  116

Query  309  SINFNGHFLDEGDTFVFVSERSGSPRIYLQENRSASAGKPPQL--LSPSGTLFHDRPVVR  482
            S+N+NG F  +G+  +FVSER G+  +Y       + G  P L  L+ S TL  DRP+  
Sbjct  117  SVNYNGAFAGDGEALLFVSERDGNMELYKGHAEGVTGGHRPSLKRLTYSPTL-QDRPIYS  175

Query  483  -DGRLLYISAHEPPKEVFKSWSALYSTHLGLK--EITRLTPYGAVDFSPSVS  629
             DGR++++S H+P K+  + W+A+YS   G+K   + RLTP    D+SP++S
Sbjct  176  PDGRIIFVSTHQPAKKPRQGWTAIYSVS-GVKGHTVRRLTPENETDYSPAIS  226



>ref|XP_004981111.1| PREDICTED: uncharacterized protein LOC101776730 [Setaria italica]
Length=691

 Score =   110 bits (274),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 94/168 (56%), Gaps = 17/168 (10%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  362
            GTIVF+T+GRS Y FDIF++ L         PA+E RLTDG S+N+NG+F    D+ +FV
Sbjct  30   GTIVFTTLGRSRYAFDIFALPLTPLSSSSSSPAAEVRLTDGASVNYNGNFAPSSDSLLFV  89

Query  363  SERSGSPRIY---------------LQENRSASAGKPPQLLSPSGTLFHDRP-VVRDG-R  491
            SER+G+  +Y                 E   A+A  P  LL        DRP +  DG  
Sbjct  90   SERNGTLNLYAFPVPSASGSGARREALEVPEAAAALPSPLLPWDPIALKDRPSLTPDGAH  149

Query  492  LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            L+Y+S  EP +   +SW+A+Y+THL      RLTP G  DFSP+VS S
Sbjct  150  LVYVSTAEPAEAPRRSWAAVYNTHLPSGATRRLTPRGVADFSPAVSPS  197



>ref|NP_001051846.1| Os03g0840200 [Oryza sativa Japonica Group]
 gb|AAT77013.1| putative F8K7.10 protein [Oryza sativa Japonica Group]
 gb|ABF99802.1| WD40-like Beta Propeller Repeat family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13760.1| Os03g0840200 [Oryza sativa Japonica Group]
 dbj|BAG90604.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94589.1| unnamed protein product [Oryza sativa Japonica Group]
Length=688

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 97/167 (58%), Gaps = 17/167 (10%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFV  362
            GTIVF+T+GRS Y FDIFS+ L  S   +   A+E RLTDGVS+N+NG+F    D+ +FV
Sbjct  28   GTIVFTTLGRSRYEFDIFSLPLAPS-PHNPAAAAELRLTDGVSVNYNGNFAPASDSILFV  86

Query  363  SERSGSPRIYLQ----------ENRSASAGKPPQLLSP----SGTLFHDRP-VVRDG-RL  494
            SER+GS  +YL           E+ S+S+      +SP          DRP +  DG RL
Sbjct  87   SERNGSLNLYLSPVPSSRREALESASSSSSSAAATISPLLPWEPIALKDRPSLTPDGSRL  146

Query  495  LYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            +Y+S   P  E   SW+A+YST L      RLTP G  DFSP+VS S
Sbjct  147  VYVSTAVPAAEPRSSWAAVYSTELSTGRTRRLTPLGVADFSPAVSPS  193



>gb|EAY92514.1| hypothetical protein OsI_14253 [Oryza sativa Indica Group]
Length=682

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 96/164 (59%), Gaps = 16/164 (10%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEH-RLTDGVSINFNGHFLDEGDTFVF  359
            GTIVF+T+GRS Y FDIFS+ L  S      PA+E  RLTDGVS+N+NG+F    D+ +F
Sbjct  28   GTIVFTTLGRSRYEFDIFSLPLAPS---PHNPAAEELRLTDGVSVNYNGNFAPASDSILF  84

Query  360  VSERSGSPRIYLQ----------ENRSASAGKPPQLLSPSGTLFHDRP-VVRDG-RLLYI  503
            VSER+GS  +YL           E+ S+SA     LL        DRP +  DG RL+Y+
Sbjct  85   VSERNGSLNLYLSPVPSSRREALESASSSAATLSPLLPWEPIALKDRPSLTPDGSRLVYV  144

Query  504  SAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            S   P  E   SW+A+YST L      RLTP G  DFSP+VS S
Sbjct  145  STAVPAAEPRSSWAAVYSTELSTGRTRRLTPLGVADFSPAVSPS  188



>gb|EAZ29242.1| hypothetical protein OsJ_13305 [Oryza sativa Japonica Group]
Length=688

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 96/166 (58%), Gaps = 17/166 (10%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFVFVS  365
            TIVF+T+GRS Y FDIFS+ L  S   +   A+E RLTDGVS+N+NG+F    D+ +FVS
Sbjct  29   TIVFTTLGRSRYEFDIFSLPLAPS-PHNPAAAAELRLTDGVSVNYNGNFAPASDSILFVS  87

Query  366  ERSGSPRIYLQ----------ENRSASAGKPPQLLSP----SGTLFHDRPVVR-DG-RLL  497
            ER+GS  +YL           E+ S+S+      +SP          DRP +  DG RL+
Sbjct  88   ERNGSLNLYLSPVPSSRREALESASSSSSSAAATISPLLPWEPIALKDRPSLTPDGSRLV  147

Query  498  YISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            Y+S   P  E   SW+A+YST L      RLTP G  DFSP+VS S
Sbjct  148  YVSTAVPAAEPRSSWAAVYSTELSTGRTRRLTPLGVADFSPAVSPS  193



>ref|XP_010510815.1| PREDICTED: uncharacterized protein LOC104787018 [Camelina sativa]
Length=700

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/175 (39%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV---  356
            TI+F+T+GR  + FDIF+  LP++ ++   PA EHRLTDG SINFNGHF       +   
Sbjct  31   TILFTTIGRPTFEFDIFT--LPTN-KRPPSPADEHRLTDGTSINFNGHFASPSPALISLL  87

Query  357  -----------------FVSERSGSPRIYLQENRSASAGKPPQLLS--PSG---TLFHDR  470
                             +V+ER G+P +      ++ +    QL S   SG       D+
Sbjct  88   PNNSRIQLQDSSLVHLIYVTERDGTPSLNYDVVSNSGSRVRAQLFSGDKSGMAVNWMQDK  147

Query  471  PVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            PV+ +  L+Y+S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS S
Sbjct  148  PVLTNEYLVYVSTHEDPGKPMASWAAVYSTELRSKSTRRLTPPGIADFSPAVSPS  202



>gb|KJB29176.1| hypothetical protein B456_005G088400 [Gossypium raimondii]
Length=713

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 97/192 (51%), Gaps = 45/192 (23%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  350
            GTIVF+T+GRS+Y +DI++  LP+S      P++E R+TDG S+NFNGHF     +    
Sbjct  32   GTIVFTTLGRSNYAWDIYT--LPTS--DPPSPSNELRVTDGESVNFNGHFPSTSPSSVLS  87

Query  351  --------------------FVFVSERSGSPRIYLQ--------ENRSASAGKPPQLL--  440
                                 V+V+ER+G P IY            RS SA + P  L  
Sbjct  88   LLHNRSLIRTPGPQAPPPLQLVYVTERNGMPNIYYDALYYGAPGSTRSRSALEVPVRLQA  147

Query  441  -------SPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPY  599
                   S +     DRP +    L+Y+S HE P E   SW+A+YSTHLG     RLTP 
Sbjct  148  PLLGLEESKNRVSMKDRPSLSGENLIYVSTHEDPGEPRTSWAAVYSTHLGTGLTRRLTPS  207

Query  600  GAVDFSPSVSQS  635
            G  DFSP+VS S
Sbjct  208  GIADFSPAVSPS  219



>ref|NP_564146.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD41420.1|AC007727_9 F8K7.9 [Arabidopsis thaliana]
 gb|AAK59584.1| unknown protein [Arabidopsis thaliana]
 gb|AAN41381.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30137.1| uncharacterized protein AT1G21670 [Arabidopsis thaliana]
Length=703

 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 93/176 (53%), Gaps = 29/176 (16%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV---  356
            TI+F+T+GR  + FDIF+  LP+S  +   PA EHRLTDG SINFNG+F       +   
Sbjct  33   TILFTTIGRPTFEFDIFT--LPTS-HRPPSPADEHRLTDGKSINFNGYFASPSTALISLL  89

Query  357  --------------FVSERSGSPRIYLQENRSASAGKPPQLLSPSG---------TLFHD  467
                          +V+ER+G+P +      S + G   Q+   SG             D
Sbjct  90   PKRTQIQPQDVHLIYVTERAGTPSLNYDVVHSDNVGSRIQVPLFSGEEQQSGMNVNSMKD  149

Query  468  RPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             PV+ +G L+++S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS S
Sbjct  150  TPVLTNGYLVHVSTHENPGKPMASWAAVYSTELRTKSTRRLTPLGIADFSPAVSPS  205



>ref|XP_010270269.1| PREDICTED: uncharacterized protein LOC104606655 [Nelumbo nucifera]
Length=728

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 96/185 (52%), Gaps = 38/185 (21%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  350
            +IVF+T+GRS Y FDIF+  LP+S      P  E ++TDG S+NFNGHF     +     
Sbjct  30   SIVFTTLGRSRYAFDIFT--LPTS-SHTPSPVDELQITDGESVNFNGHFPSPSSSSILSN  86

Query  351  ----------------FVFVSERSGSPRIYLQEN------RSASAGKPPQ----LLSP--  446
                             V+V+ER GS  IYL         R ++   P +    LL+P  
Sbjct  87   LLSNRTLTLDPHPLQFIVYVTERHGSSNIYLDAYYHHSPIRRSALETPCRIQVPLLNPEQ  146

Query  447  --SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSP  620
               G    DRP +    L+Y+S HE  K   +SW+A+YSTH+G  E  RLTPYG  DFSP
Sbjct  147  SNGGISLKDRPSLSGYYLIYVSTHEDSKVPRRSWAAVYSTHVGTGETRRLTPYGVADFSP  206

Query  621  SVSQS  635
            ++S S
Sbjct  207  AISPS  211



>ref|XP_010466457.1| PREDICTED: uncharacterized protein LOC104746633 isoform X2 [Camelina 
sativa]
Length=701

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 93/178 (52%), Gaps = 34/178 (19%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSV---QLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            TI+F+T+GR  + FDIF++   +LP S      PA EHRLTDG SINFNGHF       +
Sbjct  32   TILFTTIGRPTFEFDIFTLPTNKLPPS------PADEHRLTDGTSINFNGHFASPSPALI  85

Query  357  --------------------FVSERSGSPRIYLQENRSASAGKPPQLLS--PSGTL---F  461
                                +V+ER G+P +      ++ +    QL S   SG      
Sbjct  86   SLLPNNSRIQLQDSSLVHLIYVTERDGTPSLNYDVVSNSGSRVRGQLFSGDKSGMAVNSM  145

Query  462  HDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             D+PV+ +  L+Y+S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS S
Sbjct  146  QDKPVLTNEYLVYVSTHEDPGKPMASWAAVYSTELRSKSTRRLTPPGIADFSPAVSPS  203



>ref|XP_003562684.2| PREDICTED: uncharacterized protein LOC100824160 [Brachypodium 
distachyon]
Length=745

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 92/173 (53%), Gaps = 23/173 (13%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFE-----QDRRPASEHRLTDGVSINFNGHFLDE--G  344
            TIVF+T+GRS Y FDIF+V L           D+  A+E RLTDG S+N+NG+F      
Sbjct  77   TIVFTTLGRSRYAFDIFAVPLNRGDHLALSPSDKSAAAEVRLTDGASVNYNGNFAASPSS  136

Query  345  DTFVFVSERSGSPRIYL--------------QENRSASAGKPPQLLSPSGTLFHDRP-VV  479
            D  +FVSER+GS  +YL              +E    S+ +   LL        DRP + 
Sbjct  137  DALLFVSERNGSLNLYLSPIPSSPTSRREALEEKEEDSSAQISPLLPWDPVALKDRPSLT  196

Query  480  RDG-RLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             DG RL+Y+S   P     +SW+A+YST L      RLTP G  DFSP+VS S
Sbjct  197  PDGTRLVYVSTAVPAGSPRRSWAAVYSTELHSGRTRRLTPEGVADFSPAVSPS  249



>ref|XP_010466456.1| PREDICTED: uncharacterized protein LOC104746633 isoform X1 [Camelina 
sativa]
Length=701

 Score =   103 bits (258),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 93/178 (52%), Gaps = 34/178 (19%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSV---QLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            TI+F+T+GR  + FDIF++   +LP S      PA EHRLTDG SINFNGHF       +
Sbjct  32   TILFTTIGRPTFEFDIFTLPTNKLPPS------PADEHRLTDGTSINFNGHFASPSPALI  85

Query  357  --------------------FVSERSGSPRIYLQENRSASAGKPPQLLS--PSGTL---F  461
                                +V+ER G+P +      ++ +    QL S   SG      
Sbjct  86   SLLPNNSRIQLQDSSLVHLIYVTERDGTPSLNYDVVSNSGSRVRGQLFSGDKSGMAVNSM  145

Query  462  HDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             D+PV+ +  L+Y+S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS S
Sbjct  146  QDKPVLTNEYLVYVSTHEDPGKPMASWAAVYSTELRSKSTRRLTPPGIADFSPAVSPS  203



>ref|XP_002890451.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66710.1| hypothetical protein ARALYDRAFT_472405 [Arabidopsis lyrata subsp. 
lyrata]
Length=703

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 93/176 (53%), Gaps = 29/176 (16%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV---  356
            TI+F+T+GR  + FDIF+  LP+S  +   PA EHRLTD  S+NFNGHF       +   
Sbjct  33   TILFTTIGRPTFEFDIFT--LPTS-HRPPSPADEHRLTDAKSVNFNGHFASPSPALISLL  89

Query  357  --------------FVSERSGSPRIY---LQENRSASAGKPP------QLLSPSGTLFHD  467
                          +V+ER G+P +Y   + +++S S  + P      Q    +     D
Sbjct  90   PNKSQIQPQDLHLIYVTERDGTPSLYYDVVHDDKSGSRVQVPLFSGEEQQSGMNVNSMKD  149

Query  468  RPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             PV+    L+Y+S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS S
Sbjct  150  TPVLTSDYLVYVSTHENPGKPMASWAAVYSTELQTKSTRRLTPPGIADFSPAVSPS  205



>gb|KCW71232.1| hypothetical protein EUGRSUZ_F04330 [Eucalyptus grandis]
Length=640

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 94/187 (50%), Gaps = 40/187 (21%)
 Frame = +3

Query  189  IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT------  350
            I+F+T+GRS Y FDIF+  LP+  ++  +PA E +LTDG S+NFNGHF            
Sbjct  49   IIFATLGRSDYAFDIFA--LPTRPDRSPKPADEVKLTDGNSVNFNGHFPSLSPAASSSLL  106

Query  351  ------------FVFVSERSGSPRIYLQ--------------ENRSASAGKPPQLLSP--  446
                         ++V+ER+GS  IY                  RSA    PP++  P  
Sbjct  107  ALSPDQTPPSLHVIYVTERNGSSSIYYDAVYDGDGGGAEGSPRRRSALEAAPPRVQVPLV  166

Query  447  -SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  614
             SGT      DRP +    L+Y+S HE       SW+A+YST +      RLTPYGA D+
Sbjct  167  GSGTSVISMKDRPSLSGENLIYVSTHEDTGVPRTSWAAVYSTDVRTGSTRRLTPYGAADY  226

Query  615  SPSVSQS  635
            SP+VS S
Sbjct  227  SPAVSPS  233



>ref|XP_010063935.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104450916 
[Eucalyptus grandis]
Length=729

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 94/187 (50%), Gaps = 40/187 (21%)
 Frame = +3

Query  189  IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT------  350
            I+F+T+GRS Y FDIF+  LP+  ++  +PA E +LTDG S+NFNGHF            
Sbjct  49   IIFATLGRSDYAFDIFA--LPTRPDRSPKPADEVKLTDGNSVNFNGHFPSLSPAASSSLL  106

Query  351  ------------FVFVSERSGSPRIYLQ--------------ENRSASAGKPPQLLSP--  446
                         ++V+ER+GS  IY                  RSA    PP++  P  
Sbjct  107  ALSPDQTPPSLHVIYVTERNGSSSIYYDAVYDGDGGGAEGSPRRRSALEAAPPRVQVPLV  166

Query  447  -SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  614
             SGT      DRP +    L+Y+S HE       SW+A+YST +      RLTPYGA D+
Sbjct  167  GSGTSVISMKDRPSLSGENLIYVSTHEDTGVPRTSWAAVYSTDVRTGSTRRLTPYGAADY  226

Query  615  SPSVSQS  635
            SP+VS S
Sbjct  227  SPAVSPS  233



>ref|XP_009411896.1| PREDICTED: uncharacterized protein LOC103993528 [Musa acuminata 
subsp. malaccensis]
Length=714

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 100/193 (52%), Gaps = 43/193 (22%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS-----EHRLTDGVSINFNGHF-----  332
            GTI+F+T+GRS Y FDIFS+ + SS  + RRP +     EHRLTDGVS+NFNG+F     
Sbjct  28   GTIIFTTLGRSRYNFDIFSLPIASSSSR-RRPIAVDRHGEHRLTDGVSVNFNGYFPSLAS  86

Query  333  -----------LDEGDTFVFVSERSGSPRIYLQENRSASAGKP-------------PQLL  440
                           D+ ++VSER+GS  IYL    ++S+                P + 
Sbjct  87   SSFLSSLLPSSSSSVDSLLYVSERNGSSAIYLDLFLASSSPSTRRDALELQTRLQFPLVP  146

Query  441  SPSGTL--------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTP  596
            +P              DRP +    L+Y+S H+P     +SW+A+YSTHL      RLTP
Sbjct  147  APDDAAAESDPNVSMKDRPSLSGDLLVYVSTHQPNPSPRQSWAAVYSTHLPTGRTRRLTP  206

Query  597  YGAVDFSPSVSQS  635
             G  DFSP+VS S
Sbjct  207  SGIADFSPAVSPS  219



>ref|XP_010911317.1| PREDICTED: uncharacterized protein LOC105037336 [Elaeis guineensis]
Length=698

 Score =   102 bits (253),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 95/181 (52%), Gaps = 33/181 (18%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA--------SEHRLTDGVSINFNGHFLDE  341
            TI+F+T+GRS YGFDIFSV  P +F               +E +LTDGVS+N+NG F   
Sbjct  27   TILFTTLGRSRYGFDIFSV--PFTFSSSSSCLHSISIEHHNELQLTDGVSVNYNGFFPSN  84

Query  342  GDTFVFVSERSGSPRIYLQEN--------RSASAGKPPQLLSP------SGTLFH-----  464
              + +++SER+G   +YL           R  +   P +L SP      S + F      
Sbjct  85   SSSLLYISERNGYCNVYLDHLSLPQSSPLRREALQLPSRLQSPLLPTPSSSSAFRSPPPI  144

Query  465  ---DRPVVRDG-RLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQ  632
               DRP +  G RL+Y+S HEP     +SW A+YSTHL      RLTP G  DFSP+VS 
Sbjct  145  SMKDRPSLISGDRLIYVSTHEPSGSPRQSWVAVYSTHLPTGRTRRLTPSGVADFSPAVSP  204

Query  633  S  635
            S
Sbjct  205  S  205



>ref|XP_010477408.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104756504 
[Camelina sativa]
Length=723

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 101/205 (49%), Gaps = 35/205 (17%)
 Frame = +3

Query  108  FFPLCTQILSSLRIPKPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASE  287
            FF +    LSS    KP         TI+FST GR  + FDIF+  LP++ ++   PA E
Sbjct  10   FFLISLFCLSSASSNKP---TTSNGSTILFSTTGRPTFEFDIFT--LPTN-KRPPSPADE  63

Query  288  HRLTDGVSINFNGHFLDEGDTFV--------------------FVSERSGSPRIYLQENR  407
            HRLTDG S+NFNGHF       +                    +V+ER G+P +      
Sbjct  64   HRLTDGNSVNFNGHFASPSPALISLLPNSSRIQPHDSSLVHLIYVTERDGTPSLNYDVVH  123

Query  408  SASAGKPPQLLSPSGTLFH---------DRPVVRDGRLLYISAHEPPKEVFKSWSALYST  560
            + ++G    +   SG   H         D PV+ +  L+Y+S HE P++   SW+A+YST
Sbjct  124  NDNSGSRVHVPLFSGDEQHSGMAVNSMKDTPVLTNKHLVYVSTHENPRKPLASWAAVYST  183

Query  561  HLGLKEITRLTPYGAVDFSPSVSQS  635
             L  K   RLTP G  DFSP+VS S
Sbjct  184  KLQSKSTRRLTPPGIADFSPAVSPS  208



>ref|XP_010488216.1| PREDICTED: uncharacterized protein LOC104766097 [Camelina sativa]
Length=701

 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 91/179 (51%), Gaps = 36/179 (20%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSV---QLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV  356
            TI+F+T+GR  + FDIF++   +LP S      PA EHRLTDG SINFNGHF       +
Sbjct  32   TILFTTIGRPTFEFDIFTLPTNKLPPS------PADEHRLTDGTSINFNGHFASPSPALI  85

Query  357  --------------------FVSERSGSPRIYLQENRSASAGKPPQLLSPSG------TL  458
                                +V+ER G+P +      ++ +    QL  P G        
Sbjct  86   SLLPNNSRIQLQDSSLVHLIYVTERDGTPSLNYNVVSNSGSRVRAQLF-PGGESGMAVNS  144

Query  459  FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
              D+PV+ +  L+Y+S H  P +   SW+A+YST L  K   RLTP G  DFSP+VS S
Sbjct  145  MKDKPVLTNEYLVYVSTHVDPGKPMASWAAVYSTELRSKSTRRLTPPGIADFSPAVSPS  203



>ref|XP_007137456.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
 gb|ESW09450.1| hypothetical protein PHAVU_009G128300g [Phaseolus vulgaris]
Length=683

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 96/179 (54%), Gaps = 31/179 (17%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  350
             TI+F+T+GR+ Y FDI+ + +    +Q   P  E +LTDG S+NFNGHF+         
Sbjct  28   ATIIFTTLGRAFYAFDIYYLPI---HQQPVNPDQELQLTDGHSVNFNGHFISNASAIQLP  84

Query  351  -------FVFVSERSGSPRIYL-----------QENRSASAGKPPQLLS-PSGTL---FH  464
                    V+V+ER+GSP IY            +E+ +A   + P L + P+ T      
Sbjct  85   THSPPLQLVYVTERNGSPTIYYDAVYTSTTRSTKESVTAERIQIPLLPNKPTDTSQLSIK  144

Query  465  DRP-VVRDGR-LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            D+P V  DG  L+Y+S HE P     SW+A+YSTHL      RLTPY   DFSP++S S
Sbjct  145  DKPSVTPDGEFLIYVSTHEDPGVPRASWAAVYSTHLQSGLTQRLTPYAVADFSPALSPS  203



>ref|XP_004502520.1| PREDICTED: uncharacterized protein LOC101497096 [Cicer arietinum]
Length=683

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 92/181 (51%), Gaps = 34/181 (19%)
 Frame = +3

Query  189  IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDE---GD----  347
            I+F+T+GR++Y FDI+S  LP        P  E ++TDG S+NFNGHFL      D    
Sbjct  28   IIFTTLGRAYYAFDIYS--LPIHLNHSTNPHQELQITDGNSVNFNGHFLSNQFPADHNPP  85

Query  348  --TFVFVSERSGSPRIYLQEN-------------RSASAGKPPQL-LSPS-------GTL  458
                V+V+ER+G P IY                  S +     QL L P+          
Sbjct  86   PLQLVYVTERNGFPSIYYDAVYTTTTSTSRRSALESVTVTDRIQLPLLPNHLKDSQLSVS  145

Query  459  FHDRP-VVRDGR-LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQ  632
              D+P V  DG  L+Y+S HE P+    SW+A+YSTHL      RLTPYG  DFSPS+S 
Sbjct  146  IKDKPSVTSDGEFLIYVSTHENPEVPRVSWTAVYSTHLKSGLTRRLTPYGVADFSPSLSP  205

Query  633  S  635
            S
Sbjct  206  S  206



>ref|XP_006416278.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
 gb|ESQ34631.1| hypothetical protein EUTSA_v10006965mg [Eutrema salsugineum]
Length=698

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 96/177 (54%), Gaps = 30/177 (17%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV---  356
            TI+F+T+GR  + FD+F+  LP+S  +   P+ EHR+T G SI+FNGHF       +   
Sbjct  33   TILFTTLGRPTFEFDLFT--LPTS-HRPPSPSDEHRITAGKSIHFNGHFASPSPALISLI  89

Query  357  -----------------FVSERSGSPRI---YLQENRSASAGKPPQL--LSPSGTL--FH  464
                             +V+ER G+P +    +Q + S ++ + P L  L    T+    
Sbjct  90   PKNSGIHSQDPSLLHLIYVTERYGAPTLSYDVVQADYSKTSAQVPLLPELQSGMTVNSMK  149

Query  465  DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            D PV+ +  L+Y+S HE P +   SW+A+YST L  +   RLTPYG  DFSP+VS S
Sbjct  150  DTPVLTNEHLVYVSTHEEPGKPKASWAAVYSTELRTRSTRRLTPYGIADFSPAVSPS  206



>ref|XP_008644344.1| PREDICTED: uncharacterized protein LOC103625729 [Zea mays]
 gb|AFW67030.1| putative WD40-like beta propeller repeat family protein [Zea 
mays]
Length=689

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 92/172 (53%), Gaps = 26/172 (15%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD---T  350
            GTIVF+T+GRS Y FD+F++ + P S       ++E RLTDG S+N+NG+F        +
Sbjct  26   GTIVFTTLGRSRYAFDVFALTIAPLSAA-----SAELRLTDGASVNYNGNFAPSSSGPPS  80

Query  351  FVFVSERSGSPRIYLQ--------------ENRSASAGKPPQLLSPSGTLFHDRP-VVRD  485
             +FVSER+GS  +YL               E     +  P  LL        DRP +  D
Sbjct  81   LLFVSERNGSLNLYLTPVPTSASARRRDALEEEEEDSAPPTPLLPWDPIALKDRPSLTPD  140

Query  486  G-RLLYISAHEPPKEVFKSWSALYSTHLGLKEIT-RLTPYGAVDFSPSVSQS  635
            G  L+Y+S  EP     +SW+A+YST L     T RLTP G  DFSP+VS S
Sbjct  141  GAHLVYVSTAEPAGAPRRSWAAVYSTSLAPGRATRRLTPRGVADFSPAVSPS  192



>gb|KHN46997.1| Replication factor C subunit 4 [Glycine soja]
Length=422

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 94/171 (55%), Gaps = 20/171 (12%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS--EHRLTDGVSINFNGHFLDEGDT--  350
             TI+F+T+GR+ Y FDI+S+ +P   +Q +  +   E  LTDG S+NFNGHFL       
Sbjct  49   ATIIFTTLGRASYAFDIYSLPVPVQQQQQQPLSPSQELLLTDGHSVNFNGHFLSNSSAIQ  108

Query  351  ---------FVFVSERSGSPRIYLQENRSASAGK---PPQLLSP--SGTLFHDRPVVR-D  485
                      V+V+ER+G P I+     S+S         LLS   S     D+P V  D
Sbjct  109  LPKHSPPLQLVYVTERNGYPTIFYDAIYSSSMVSNRIQIPLLSNHLSDASIKDKPSVTPD  168

Query  486  GR-LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            G+ LLY+S+HE P     SW+A+YST L      RLTPYG  DFSPS+S S
Sbjct  169  GQYLLYVSSHENPGVPRASWTAVYSTQLESGLTQRLTPYGVADFSPSLSPS  219



>emb|CDY04661.1| BnaC05g16990D [Brassica napus]
Length=697

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 68/180 (38%), Positives = 89/180 (49%), Gaps = 36/180 (20%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDEGDTFV  356
            TI+F+T+G S + FDIF++         RRP S   EHRLTDG SINFNGH        +
Sbjct  32   TILFTTMGSSTFEFDIFTLH------TSRRPPSPSDEHRLTDGKSINFNGHLASPSPALI  85

Query  357  --------------------FVSERSGSPRIYLQENRSASAGKPPQ--LLSP-----SGT  455
                                +V+ER G+P ++     S + G   Q  LLS      S  
Sbjct  86   SLLPNTSGVQPQDKTLLHLIYVTERDGAPTLHYDVVHSDNKGTNVQVPLLSEQQSGMSVN  145

Query  456  LFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
               D PV+ +  L+Y+S HE   +   SW+A+YST L  K   RLTP G  DFSP+VS S
Sbjct  146  SMKDTPVLTNEHLVYVSTHENSGKPMASWAAVYSTELITKATQRLTPPGIADFSPAVSPS  205



>ref|XP_007019162.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
 gb|EOY16387.1| DPP6 N-terminal domain-like protein [Theobroma cacao]
Length=710

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 95/192 (49%), Gaps = 45/192 (23%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  350
            G+IVF+T+GRS Y +DIF+  LP+    +  P++E ++TDG S+NFNGHF     +    
Sbjct  31   GSIVFTTLGRSDYAWDIFT--LPTLDPPN--PSNELQITDGESVNFNGHFPSASSSSILS  86

Query  351  --------------------FVFVSERSGSPRIYL--------QENRSASAGKPPQLL--  440
                                 ++V+ER G   IY         +  RS SA + P  +  
Sbjct  87   LLHNRSLLHPPGPQAPSPLQLIYVTERKGMSNIYYDALYHGAPRSTRSRSALEIPVRVQA  146

Query  441  -------SPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPY  599
                   S +     DRP +    L+Y+S HE P E   SW+A+YST LG     RLTPY
Sbjct  147  PLLGLEESKNRISMKDRPSLSGENLIYVSTHEDPGEPRTSWAAVYSTQLGTGVTRRLTPY  206

Query  600  GAVDFSPSVSQS  635
            G  DFSP+VS S
Sbjct  207  GIADFSPAVSPS  218



>ref|XP_008466749.1| PREDICTED: uncharacterized protein LOC103504088 [Cucumis melo]
Length=703

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 94/187 (50%), Gaps = 39/187 (21%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  332
            +IVF+T+GRS Y FDI++  LP+    +   A E  +TDG S+NFNG+F           
Sbjct  28   SIVFTTLGRSFYAFDIYT--LPADANNNPSSADEILITDGQSVNFNGYFPSSSSFSSLIS  85

Query  333  --LDEGDTF------VFVSERSGSPRIY---------LQENRSASAGKPPQLLSP-----  446
               ++  +F      V+V+ER+G  RI+         +   R +    P +L  P     
Sbjct  86   LLTNQSHSFTPDLELVYVTERNGISRIFYDAVFGGTGVSARRRSELEIPHRLQIPLLDEE  145

Query  447  ----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  614
                    F DRP +    L+Y+S HE P+E   SW+A+YS +L      RLTPYG  DF
Sbjct  146  QKNEVRVSFKDRPSLSGDYLVYVSTHEDPREFRTSWAAVYSRNLKSGVTRRLTPYGIADF  205

Query  615  SPSVSQS  635
            SPSVS S
Sbjct  206  SPSVSPS  212



>gb|KFK44273.1| hypothetical protein AALP_AA1G236600 [Arabis alpina]
Length=690

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 88/176 (50%), Gaps = 28/176 (16%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTFV---  356
            +I F+T+GR  + FDIF+  LP++      P++EHRLTDG SINFNGHF       +   
Sbjct  27   SIFFTTLGRPTFEFDIFT--LPTTNHPPPSPSNEHRLTDGKSINFNGHFASPSPALISLL  84

Query  357  -------------FVSERSGSPRIYLQENRSASAGKPPQL-------LSPSGTLFH---D  467
                         +V+ER G+  +        + G   Q+          SG   +   D
Sbjct  85   PNKSQDKSLLHLIYVTERDGTMSLRYDVVHRDNTGTTTQVPLFSDEKKKQSGMTVNSMKD  144

Query  468  RPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             P + +  L+++S HE P +   SW+A+YST L  K   RLTP G  DFSP+VS S
Sbjct  145  TPFLTNEYLVHVSTHENPNKPMASWAAVYSTELRTKSTRRLTPTGIADFSPAVSPS  200



>ref|XP_011069633.1| PREDICTED: uncharacterized protein LOC105155456 [Sesamum indicum]
Length=688

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 96/196 (49%), Gaps = 43/196 (22%)
 Frame = +3

Query  156  PPIMIMDPHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  332
            P ++ +   GT I F+T+GRS Y FDIF+  LP++      P+ E RLTDG S+NFNG+F
Sbjct  12   PLLLAVGGGGTSIAFATLGRSSYAFDIFA--LPTA-----SPSKEIRLTDGNSVNFNGYF  64

Query  333  ---------------LDEGDTFVFVSERSGSPRIYLQE----------NRSASAGKPPQ-  434
                            D+    V+++ER+GS +IYL            +RS   G     
Sbjct  65   PSSSSLSMLPHLSKNTDQATHIVYITERNGSSKIYLDALYDTPPIRSGSRSLVEGSAEST  124

Query  435  -----LLSPSGT----LFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITR  587
                 LL    T       D+P +    L+Y+S HE P     SW+A++ST L      R
Sbjct  125  RLQVLLLGDEQTGGRVSMKDKPSLVGQSLIYVSTHENPGVPRASWAAVFSTQLTTGATRR  184

Query  588  LTPYGAVDFSPSVSQS  635
            LTP G  DFSP+VS S
Sbjct  185  LTPKGVADFSPAVSPS  200



>ref|XP_009149685.1| PREDICTED: uncharacterized protein LOC103873008 [Brassica rapa]
Length=704

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 91/181 (50%), Gaps = 37/181 (20%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDEGDTFV  356
            TI+F+T+G S + FDIF+  LP+S    RRP S   EHRLTDG SINFNGH        +
Sbjct  35   TILFTTMGSSTFEFDIFT--LPTS----RRPPSPSDEHRLTDGKSINFNGHLASPSPALI  88

Query  357  --------------------FVSERSGSPRIYLQENRSASAGKPPQ--LLSP-----SGT  455
                                +V+ER G+P ++       + G   Q  LLS      S  
Sbjct  89   SLLPNTSGIQPQDKSLLHLIYVTERDGAPTLHYDVVHGDNKGTRVQVPLLSEQQSGMSVN  148

Query  456  LFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEI-TRLTPYGAVDFSPSVSQ  632
               D PVV +  L+Y+S HE   +   SW+A+YST L  K    RLTP G  DFSP+VS 
Sbjct  149  SMKDTPVVTNEHLVYVSTHENSGKPMASWAAVYSTELRTKATQQRLTPPGIADFSPAVSP  208

Query  633  S  635
            S
Sbjct  209  S  209



>ref|XP_002993781.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
 gb|EFJ05147.1| hypothetical protein SELMODRAFT_187603 [Selaginella moellendorffii]
Length=722

 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 73/239 (31%), Positives = 105/239 (44%), Gaps = 66/239 (28%)
 Frame = +3

Query  117  LCTQILSSLRIPKPPIMIMDP---HGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDR-RPA  281
            L   I+SS+ +  P           GT+ F++VGR+HY FD+F +   P   E     P 
Sbjct  3    LLWIIISSIVLSAPGFANAGDRIVEGTVAFASVGRAHYAFDVFLLDFRPWELENASLGPH  62

Query  282  SEHRLTDGVSINFNGHFLD-----------------EGD----TFVFVSERSGSPRI---  389
             E R TDGVS+N+NG  +D                 +GD      ++VSER G+  +   
Sbjct  63   LEFRATDGVSVNYNGALVDDSQRRVIFEALDFRGEQQGDGSQGILIYVSERDGAAEVRFN  122

Query  390  -YLQENRS--------------ASAGKPPQLLSPSG----------------------TL  458
             + Q  R                S G     L   G                      T 
Sbjct  123  LFYQGQRDRGERSLGNIESGSQESHGNRRDALEIHGDRGNSQNFIDLGKLWSSSEVEPTA  182

Query  459  FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             +DRP V DGR++++S  +P ++  +SW+A+YS  +  K+ITRLTP G  D+SPSVS S
Sbjct  183  LYDRPSVADGRVIFVSTRKPREQSRQSWAAVYSMDIVTKKITRLTPEGVTDYSPSVSPS  241



>ref|XP_011027475.1| PREDICTED: uncharacterized protein LOC105127763 [Populus euphratica]
Length=712

 Score = 92.4 bits (228),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 92/191 (48%), Gaps = 42/191 (22%)
 Frame = +3

Query  177  PHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD--  347
            P GT I+F+T+GR  Y FDIF+  LP+     +   +E R+TDG S+NFNGHF       
Sbjct  27   PRGTSIIFATLGRLDYDFDIFT--LPTGEPPTK--TNELRITDGESVNFNGHFPSPSPSL  82

Query  348  ---------------------TFVFVSERSGSPRIYL--------QENRSASAGKPPQ--  434
                                   ++V+ER GS  I+         +  RS SA + P+  
Sbjct  83   LSLLTNKTLINPPGQQNPSPLNLIYVTERGGSSNIFYDAVYVDPPRSARSRSALEIPKRV  142

Query  435  ----LLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  602
                L    G    D+P V    L+Y+S HE P E   SW+A+Y+T L      RLTP+G
Sbjct  143  QVPLLNGKGGISMKDKPTVSGDYLVYVSTHENPGEPRTSWAAVYATELTTGLTRRLTPHG  202

Query  603  AVDFSPSVSQS  635
              DFSP+VS S
Sbjct  203  IADFSPAVSPS  213



>emb|CDP10970.1| unnamed protein product [Coffea canephora]
Length=715

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 95/199 (48%), Gaps = 56/199 (28%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  350
            +IVF+T+GRS Y FDI+S+ L   P+S       ++E RLTDGVS+NFNG+F        
Sbjct  38   SIVFATLGRSSYHFDIYSLPLWVAPAS-------SNELRLTDGVSVNFNGYFPSPSSVSM  90

Query  351  ------------------FVFVSERSGSPRIYLQE----------NRSASAGKPPQLLSP  446
                              FV+V+ER+G+  ++L            +R+     P +    
Sbjct  91   LFRAPDWTPADVSPPPLHFVYVTERNGNSHVFLDSLYYRGREHTGSRAILEEDPSEPTRS  150

Query  447  SGTLFH----------------DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKE  578
              T F                 D+P +    L+Y+S HE P     SW+A+YSTHL  + 
Sbjct  151  ELTRFQFPLVGLEESDGRVSMKDKPTLVGEYLIYVSTHENPGVPRTSWTAVYSTHLKTRS  210

Query  579  ITRLTPYGAVDFSPSVSQS  635
              RLTPYG  DFSP+VS S
Sbjct  211  TRRLTPYGVADFSPAVSPS  229



>ref|XP_002985152.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
 gb|EFJ13646.1| hypothetical protein SELMODRAFT_121622 [Selaginella moellendorffii]
Length=669

 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 93/173 (54%), Gaps = 24/173 (14%)
 Frame = +3

Query  165  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEG  344
            M  D  GT+VF++VGRSHY FD F++ + +          E  LTDGVS+NFN  F+++ 
Sbjct  1    MANDGGGTVVFASVGRSHYAFDAFALDIAT--------LKEEVLTDGVSVNFNAQFVEDD  52

Query  345  ---DTFVFVSERSGSPRIYLQ---------ENRSASAGKPPQLLSPSGTLFHDRPVVR-D  485
                  +FVSER+G+  I+L+          +  +S  K   L +  G L+ DRP V   
Sbjct  53   PKPSAVIFVSERTGASNIFLRRQSLTSKSDRDDHSSTLKLGSLDAGDGFLYCDRPCVAGG  112

Query  486  GRLLYISAHEPP---KEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            GR+++ S    P   + + +  +A++S  L +    RLTP G  D+SP++S S
Sbjct  113  GRIIFASTKSSPEISQNLRQPSTAIFSACLRIGLTRRLTPEGVADYSPALSPS  165



>ref|XP_002466125.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
 gb|EER93123.1| hypothetical protein SORBIDRAFT_01g001880 [Sorghum bicolor]
Length=690

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 95/172 (55%), Gaps = 23/172 (13%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT----  350
            GTIVF+T+GRS Y FDIF++ L          ++E RLTDGVS+N+NG+F     +    
Sbjct  24   GTIVFTTLGRSRYAFDIFALPLSPLSSAAA--SAELRLTDGVSVNYNGNFAPSSSSSEPP  81

Query  351  -FVFVSERSGSPRIYLQE-NRSASAGKPPQLL-----SPSGT--------LFHDRP-VVR  482
              +FVSER+GS  +Y      SASA +  + L     SP+ T           DRP +  
Sbjct  82   SLLFVSERNGSLNLYRTPVPLSASAARRREALEEEDDSPTLTPLLPWDPIALKDRPSLTP  141

Query  483  DG-RLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            DG  L+Y+S  EP     +SW+A+YST L      RLTP G  DFSP+VS S
Sbjct  142  DGAHLVYVSTAEPAGSPRRSWAAVYSTSLASGATRRLTPRGVADFSPAVSPS  193



>gb|KDP32822.1| hypothetical protein JCGZ_12114 [Jatropha curcas]
Length=699

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 92/188 (49%), Gaps = 41/188 (22%)
 Frame = +3

Query  186  TIVFSTVG-RSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---------  335
            +I+F+T+G RS Y FDIF+  LP+       PA+E ++TDG S+NFNGHF          
Sbjct  29   SIIFATLGSRSDYAFDIFT--LPTQGPPPT-PANELQITDGRSLNFNGHFPSPSSSLLSL  85

Query  336  ------------DEGDTFVFVSERSGSPRIYL--------QENRSASA--------GKPP  431
                         E  + V+V+ER GS  IY         +  R  SA         + P
Sbjct  86   LSNQTLTSATQNSEPVSLVYVTERGGSSNIYYDTVYFSIPRSTRLRSALEIEIPVRVQVP  145

Query  432  QLLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVD  611
             L    G    D+P V    L+Y+S HE  K+   SW+A+YST L      RLTPYG  D
Sbjct  146  LLKGIDGISMKDKPTVSGDYLIYVSTHEDSKKPRTSWAAVYSTELKTGLTRRLTPYGIAD  205

Query  612  FSPSVSQS  635
            FSP+VS S
Sbjct  206  FSPAVSPS  213



>ref|XP_006386357.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
 gb|ERP64154.1| hypothetical protein POPTR_0002s08010g [Populus trichocarpa]
Length=712

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 92/191 (48%), Gaps = 42/191 (22%)
 Frame = +3

Query  177  PHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGD--  347
            P GT I+F+T+GR  Y FDIF+  LP+     +   +E R+TDG S+NFNGHF       
Sbjct  27   PSGTSIIFATLGRLDYDFDIFT--LPTGDPPTK--TNELRITDGESVNFNGHFPSPSSSL  82

Query  348  ---------------------TFVFVSERSGSPRIYL--------QENRSASAGKPPQ--  434
                                   ++V+ER GS  I+         +  RS SA + P+  
Sbjct  83   LSLLTNKTLINPPGQQNPSPLNLIYVTERGGSSNIFYDAVYVDIPRSARSRSALEIPKRV  142

Query  435  ----LLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  602
                L    G    D+P V    L+Y+S HE P E   SW+A+Y+T L      RLTP+G
Sbjct  143  QVPLLDGKGGISMKDKPTVSGDYLVYVSTHENPGEPRTSWAAVYATELTTGLTRRLTPHG  202

Query  603  AVDFSPSVSQS  635
              DFSP+VS S
Sbjct  203  IADFSPAVSPS  213



>ref|XP_011027472.1| PREDICTED: uncharacterized protein LOC105127760 [Populus euphratica]
Length=712

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 93/191 (49%), Gaps = 42/191 (22%)
 Frame = +3

Query  177  PHGT-IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDTF  353
            P GT I+F+T+GR  Y FDIF+  LP+     +   +E R+TDG S+NFNGHF     + 
Sbjct  27   PSGTSIIFATLGRLDYDFDIFT--LPTGEPPTK--TNELRITDGESVNFNGHFPSPSPSL  82

Query  354  -----------------------VFVSERSGSPRIYL--------QENRSASAGKPPQ--  434
                                   ++V+ER GS  I+         +  RS SA + P+  
Sbjct  83   LSRLTNKTLINPPGQQNPSPLNLIYVTERGGSSNIFYDAVYVDPPRSARSRSALEIPKRV  142

Query  435  ----LLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  602
                L    G    D+P V    L+Y+S HE P E   SW+A+Y+T L      RLTP+G
Sbjct  143  QVPLLNGKGGISMKDKPTVSGDYLVYVSTHENPGEPRTSWAAVYATELTTGVTRRLTPHG  202

Query  603  AVDFSPSVSQS  635
              DFSP+VS S
Sbjct  203  IADFSPAVSPS  213



>gb|EYU32510.1| hypothetical protein MIMGU_mgv1a026619mg [Erythranthe guttata]
Length=716

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 90/185 (49%), Gaps = 39/185 (21%)
 Frame = +3

Query  189  IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF------------  332
            I F+T+GRS YGFDI++  LP++      P  E RLTDG S+N+NG+F            
Sbjct  43   IAFATLGRSSYGFDIYA--LPTTTTTIASP-EEIRLTDGNSVNYNGYFPSSSSLSVFPLL  99

Query  333  ---LDEGDTFVFVSERSGSPRIYLQE------NRSASAGKPPQLLSPSGTL---------  458
                D    F++V+ER+GS +IYL         ++ S        S S  L         
Sbjct  100  PDQPDPTTHFIYVTERNGSSQIYLDALYGTLPLKTGSRSMLESFPSKSNQLQIRLVGGEQ  159

Query  459  ------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSP  620
                    DRP +    L+Y+S HE P E   SW+A++ST L      RLTP G  DFSP
Sbjct  160  ENGRVSMKDRPSLVGRSLIYVSTHEDPGEPRASWAAVFSTELATGLTRRLTPSGVADFSP  219

Query  621  SVSQS  635
            +VS S
Sbjct  220  AVSPS  224



>ref|XP_003630471.1| Protein tolB [Medicago truncatula]
 gb|KEH35326.1| DPP6 amino-terminal domain protein [Medicago truncatula]
Length=684

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 88/173 (51%), Gaps = 30/173 (17%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT-----  350
            +I+F+T+GR  Y FDI+S+ +   +        E +LTDG S+NFNG FL    +     
Sbjct  33   SIIFTTLGRPDYAFDIYSLPIHHHYHH-----QELQLTDGHSVNFNGQFLPNLTSIKLLT  87

Query  351  --------FVFVSERSGSPRIYLQENRSASAGKPPQLLSP----------SGTLFHDRPV  476
                     V+V+ER+G P IY     + +     ++  P          S     D+P 
Sbjct  88   HQDPPPLQLVYVTERTGFPTIYYDAVYTTTTKINDRIQLPLLPNHLTQTQSQLSIKDKPS  147

Query  477  VR-DGR-LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  629
            +  DG+ L+Y+S HE P     SW+A+YSTHL      RLTPYG  DFSP+VS
Sbjct  148  LSSDGQYLIYVSTHEDPGVQRVSWTAVYSTHLKSGNTRRLTPYGVADFSPAVS  200



>ref|XP_003527947.1| PREDICTED: uncharacterized protein LOC100791865 [Glycine max]
Length=723

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 94/171 (55%), Gaps = 20/171 (12%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS--EHRLTDGVSINFNGHFLDEGDT--  350
             +I+F+T+GR+ Y FDI+S+ +P   +Q +  +   E  LTDG S+NFNGHFL       
Sbjct  65   ASIIFTTLGRASYAFDIYSLPVPVQQQQQQPLSPSQELLLTDGHSVNFNGHFLSNSSAIQ  124

Query  351  ---------FVFVSERSGSPRIYLQENRSASAGKPP---QLLSP--SGTLFHDRP-VVRD  485
                      V+V+ER+G P I+     S+S         LLS   S     D+P V  D
Sbjct  125  LPKHSPPLQLVYVTERNGYPTIFYDAIYSSSMVSNRIQIPLLSNHLSDASIKDKPSVTPD  184

Query  486  GR-LLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            G+ LLY+S+HE P     SW+A+YST L      RLTPYG  DFSPS+S S
Sbjct  185  GQYLLYVSSHENPGVPRASWTAVYSTQLESGLTQRLTPYGVADFSPSLSPS  235



>ref|XP_004249849.1| PREDICTED: uncharacterized protein LOC101257324 [Solanum lycopersicum]
Length=675

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 91/174 (52%), Gaps = 31/174 (18%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  332
            +I+F+T+GRS Y FDIF+  LP++      P +E +LTDG S+NFNGHF           
Sbjct  23   SIIFTTLGRSSYAFDIFA--LPTT-----HPQTEFQLTDGNSVNFNGHFPATLPPSLLSR  75

Query  333  ------LDEGDTFVFVSERSGSPRIY-------LQENRSASAGKPPQLLSPSGTLFHDRP  473
                  ++ G   ++V+ER+G+  ++       + E  S +  + P +         D+P
Sbjct  76   LPDDDSVNSGFHLIYVTERNGTHHVFYDAVFHDILEFPSQTRLQVPLVGFEQSVSMKDKP  135

Query  474  VVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             +    L+Y+S HE       SW+A+YSTHL      RLTP G  DFSP+VS S
Sbjct  136  SLSGEFLIYVSTHEDSGVPRTSWAAVYSTHLVSGFTQRLTPKGVADFSPAVSPS  189



>ref|XP_002520326.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42112.1| conserved hypothetical protein [Ricinus communis]
Length=708

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 68/188 (36%), Positives = 95/188 (51%), Gaps = 42/188 (22%)
 Frame = +3

Query  186  TIVFSTVG-RSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF----------  332
            +I+F+T+G RS   FDIF+  LP++   D   ++E ++TDG S++FNGHF          
Sbjct  32   SIIFATLGSRSSNAFDIFA--LPTTTPPDS--SNEIQITDGKSLSFNGHFPSPTSLVSLF  87

Query  333  ------------LDEGDTFVFVSERSGSPRIYL--------QENRSASA-GKPPQLLSP-  446
                             T ++V+ER GS  IYL        +  RS SA   PP++  P 
Sbjct  88   PNQTLIHSSAHQNSASITVIYVTERGGSSTIYLDVLSYDTARSARSRSALETPPRVQIPL  147

Query  447  -----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVD  611
                  G  F D+P +    L+Y+S HE   +   SW+A+YST L      RLTPYG  D
Sbjct  148  LKGNNVGVSFKDKPTINGNYLVYLSTHEDAGKPRASWAAVYSTELNTGLTRRLTPYGVAD  207

Query  612  FSPSVSQS  635
            FSP+VS S
Sbjct  208  FSPAVSPS  215



>emb|CDY08187.1| BnaA06g15390D [Brassica napus]
Length=704

 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 90/181 (50%), Gaps = 37/181 (20%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHFLDEGDTFV  356
            TI+F+T+G S + FDIF+  LP+S    RRP S   EHRLTD  SINFNGH        +
Sbjct  35   TILFTTMGSSTFEFDIFT--LPTS----RRPPSPSDEHRLTDRKSINFNGHLASPSPALI  88

Query  357  --------------------FVSERSGSPRIYLQENRSASAGKPPQ--LLSP-----SGT  455
                                +V+ER G+P ++       + G   Q  LLS      S  
Sbjct  89   SLLPNTSGIQPQDKSLLHLIYVTERDGAPTLHYDVVHGDNKGTRVQVPLLSEQQSGMSVN  148

Query  456  LFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEI-TRLTPYGAVDFSPSVSQ  632
               D PVV +  L+Y+S HE   +   SW+A+YST L  K    RLTP G  DFSP+VS 
Sbjct  149  SMKDTPVVTNEHLVYVSTHENSGKPMASWAAVYSTELRTKATQQRLTPPGIADFSPAVSP  208

Query  633  S  635
            S
Sbjct  209  S  209



>ref|XP_004160721.1| PREDICTED: protein TolB-like [Cucumis sativus]
Length=703

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 93/187 (50%), Gaps = 39/187 (21%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  332
            +IVF+T+GRS Y FDI++  LP+   ++     E  +TDG  +NFNG+F           
Sbjct  28   SIVFTTLGRSFYAFDIYT--LPADANKNPSLPDEILITDGQYVNFNGYFPSSTSSSSLIS  85

Query  333  --LDEGDTF------VFVSERSGSPRIY---------LQENRSASAGKPPQLLSP-----  446
               ++  +F      V+V+ER+G   I+         +   R +    P +L  P     
Sbjct  86   LLTNQSHSFTPDFELVYVTERNGISTIFYDAVFGGIGVSARRRSELEIPHRLQIPLLDEE  145

Query  447  ----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  614
                +   F DRP +    L+Y+S HE P+E   SW+A+YS +L      RLTPYG  DF
Sbjct  146  QKNEAKVSFKDRPSLSGDYLVYVSTHEDPRESRTSWAAVYSRNLKSGLTRRLTPYGIADF  205

Query  615  SPSVSQS  635
            SPSVS S
Sbjct  206  SPSVSPS  212



>gb|KFK44274.1| hypothetical protein AALP_AA1G237000 [Arabis alpina]
Length=703

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 95/195 (49%), Gaps = 51/195 (26%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHF---------  332
            TI+F+T+GRSHY FDIFS+    P S       + E +LTDG S+NFNG+F         
Sbjct  33   TIIFTTLGRSHYEFDIFSLSTTHPPSI------SVELQLTDGESVNFNGYFPSPSPALIS  86

Query  333  ---------LDEGD--TFVFVSERSGSPRIYL-------------QENRSASAGKPPQLL  440
                     L++      ++V+ER+G+  IY               + RS     P ++ 
Sbjct  87   LLPDETLIQLEDSSPLHLIYVTERNGTSSIYYDLVSSSNYSDTTSNQRRSVLEAAPSRVQ  146

Query  441  SP-------SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRL  590
             P       SGT+   F D+P +    L+Y+S HE   E   SW+A+YST L      RL
Sbjct  147  IPLLSSSHRSGTIVNSFKDKPSLIGEFLVYVSTHENSGEPRTSWTAVYSTELRTGLTRRL  206

Query  591  TPYGAVDFSPSVSQS  635
            TP G  DFSP+VS S
Sbjct  207  TPSGIADFSPAVSPS  221



>ref|XP_004149439.1| PREDICTED: protein TolB-like [Cucumis sativus]
 gb|KGN47697.1| hypothetical protein Csa_6G382360 [Cucumis sativus]
Length=703

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 93/187 (50%), Gaps = 39/187 (21%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  332
            +IVF+T+GRS Y FDI++  LP+   ++     E  +TDG  +NFNG+F           
Sbjct  28   SIVFTTLGRSFYAFDIYT--LPADANKNPSLPDEILITDGQYVNFNGYFPSSTSSSSLIS  85

Query  333  --LDEGDTF------VFVSERSGSPRIY---------LQENRSASAGKPPQLLSP-----  446
               ++  +F      V+V+ER+G   I+         +   R +    P +L  P     
Sbjct  86   LLTNQSHSFTPDFELVYVTERNGISTIFYDAVFGGIGVSARRRSELEIPHRLQIPLLDEE  145

Query  447  ----SGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  614
                +   F DRP +    L+Y+S HE P+E   SW+A+YS +L      RLTPYG  DF
Sbjct  146  QKNEARVSFKDRPSLSGDYLVYVSTHEDPRESRTSWAAVYSRNLKSGLTRRLTPYGIADF  205

Query  615  SPSVSQS  635
            SPSVS S
Sbjct  206  SPSVSPS  212



>ref|XP_006351203.1| PREDICTED: uncharacterized protein LOC102604753 [Solanum tuberosum]
Length=696

 Score = 86.7 bits (213),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 94/189 (50%), Gaps = 46/189 (24%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  332
            +I+F+T+GRS Y FDIF+  LP++      P +E +LTDG S+NFNG+F           
Sbjct  24   SIIFTTLGRSTYAFDIFA--LPTT-----HPQTEFQLTDGNSVNFNGNFPASLPPSLLSR  76

Query  333  LDEGDT---------FVFVSERSGSPRIYLQE------NRSASAGKPPQLLSP-------  446
            L + D+          ++V+ER+G+  ++          R A    PPQ  S        
Sbjct  77   LPDDDSVNSGKLPFHLIYVTERNGTHHVFYDAVFHGVGERRAILEFPPQTESTRVQVPLV  136

Query  447  ----SG--TLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAV  608
                SG      D+P +    L+Y+S HE       SW+A+YSTHLG     RLTP G  
Sbjct  137  GFEQSGGRVSMKDKPSLTGEFLIYVSTHEDSGVPRTSWAAVYSTHLGSGLTRRLTPKGVA  196

Query  609  DFSPSVSQS  635
            DFSP+VS S
Sbjct  197  DFSPAVSPS  205



>ref|XP_002993240.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
 gb|EFJ05661.1| hypothetical protein SELMODRAFT_136782 [Selaginella moellendorffii]
Length=717

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 66/215 (31%), Positives = 95/215 (44%), Gaps = 63/215 (29%)
 Frame = +3

Query  180  HGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDR-RPASEHRLTDGVSINFNGHFLD-----  338
             GT+ F++VGR+ Y FD+F +   P   E     P  E R TDGVS+N+NG  +D     
Sbjct  27   EGTVAFASVGRARYAFDVFLLDFRPWELENASLGPHLEFRATDGVSVNYNGALVDDSQRR  86

Query  339  ------------EGDT----FVFVSERSGSPRI----YLQENRS--------------AS  416
                        +GD      ++VSER G+  +    + Q  R                S
Sbjct  87   VIFEALDFRGEQQGDASQGILIYVSERDGAAEVRFNLFYQGQRDRGERSLGNIESGSQES  146

Query  417  AGKPPQLLSPSG----------------------TLFHDRPVVRDGRLLYISAHEPPKEV  530
             G     L   G                      T  +DRP V DGR++++S  +  ++ 
Sbjct  147  HGNRRDALEIHGDRGNSQNFIDLGKLWSSSEVEPTALYDRPSVADGRVIFVSTRKRREQS  206

Query  531  FKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
             +SW+A+YS  +  K+ITRLTP G  D+SPSVS S
Sbjct  207  RQSWAAVYSMDIVTKKITRLTPEGVTDYSPSVSPS  241



>ref|XP_006416277.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
 gb|ESQ34630.1| hypothetical protein EUTSA_v10009943mg [Eutrema salsugineum]
Length=713

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 71/203 (35%), Positives = 98/203 (48%), Gaps = 54/203 (27%)
 Frame = +3

Query  171  MDPHG--TIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHFL-  335
             +P+G  TIVF+T+GRSHY FDIF++    P S  +      E ++TDG S+NFNG+F  
Sbjct  24   QNPNGGDTIVFTTLGRSHYEFDIFALSTTHPPSISR------ELQITDGESVNFNGYFPS  77

Query  336  ----------DEGDT---------FVFVSERSGSPRIY------------LQENRSASAG  422
                      DE  T          ++V+ER+G+  IY             +  R +   
Sbjct  78   PSPTLISLLPDETLTQLEDSSPLHLIYVTERNGTSSIYYDLVYGGGGDSDFKRKRRSVLE  137

Query  423  KPPQLLSP---------SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHL  566
             P ++  P         SGT    F D+P +    L+Y+S HE   E   SW+A+YST L
Sbjct  138  SPSRIQVPLLSIANHHRSGTKVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAVYSTEL  197

Query  567  GLKEITRLTPYGAVDFSPSVSQS  635
                  RLTP G  DFSP+VS S
Sbjct  198  RTGLTRRLTPSGIADFSPAVSPS  220



>ref|NP_564147.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
 gb|AAD41421.1|AC007727_10 ESTs gb|N96028, gb|F14286, gb|T20680, gb|F14443, gb|AA657300 
and gb|N65244 come from this gene [Arabidopsis thaliana]
 gb|AAK76710.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13226.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30138.1| DPP6 N-terminal domain-like protein [Arabidopsis thaliana]
Length=706

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 93/191 (49%), Gaps = 45/191 (24%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  332
            TI+F+T+GRSHY FDIF++    S  Q    + E R+TDG S+NFNG+F           
Sbjct  33   TIIFTTLGRSHYEFDIFAL----STTQPPSVSGELRITDGESVNFNGYFPSPSPALLSLL  88

Query  333  -----LDEGDT----FVFVSERSGSPRIY----------LQENRSASAGKPPQLLSP---  446
                 +   D+     ++V+ER+G+  +Y           +  R +    P ++  P   
Sbjct  89   PDETLIQMEDSSPLHLIYVTERNGTSSLYYDLVYGGNSDFKTKRRSVLEAPSRVQVPLLS  148

Query  447  -----SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  602
                 SG     F D+P +    ++Y+S HE   E   SW+A+YST L      RLTP G
Sbjct  149  RFDHLSGMTVNSFKDKPSLSGEFIVYVSTHESSGEPRASWTAVYSTELKTGLTRRLTPSG  208

Query  603  AVDFSPSVSQS  635
              DFSP+VS S
Sbjct  209  VADFSPAVSPS  219



>gb|KDO80522.1| hypothetical protein CISIN_1g004971mg [Citrus sinensis]
Length=721

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 92/201 (46%), Gaps = 56/201 (28%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDR-RPASEHRLTDGVSINFNGHF----------  332
            +I+F+T+GRS Y FDI+++ +      DR   A+E ++TDG S+NFNGHF          
Sbjct  31   SIIFTTLGRSDYAFDIYTLPI-----SDRPTTANEIKITDGESVNFNGHFPSPSSPFLSF  85

Query  333  -------------LDEGD----TFVFVSERSGSPRIYLQ----------------ENRSA  413
                          D  D      ++V+ER+G+  IY                  E   A
Sbjct  86   LLRNQTLIQSPGPQDSRDPPPLQLIYVTERNGTSNIYYDAVYYDTRRNTRSRTALEQHGA  145

Query  414  SAGKPPQ-----LLSPSGTL--FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGL  572
                  Q     L   +G +    D+P++    L+Y+S HE P     SW+A+YST L  
Sbjct  146  EVSTRVQVPLLDLNEVNGGVISMKDKPILSGEYLIYVSTHENPGTPRTSWAAVYSTELKT  205

Query  573  KEITRLTPYGAVDFSPSVSQS  635
                RLTPYG  DFSP+VS S
Sbjct  206  GLTRRLTPYGVADFSPAVSPS  226



>ref|XP_010672499.1| PREDICTED: uncharacterized protein LOC104889058 [Beta vulgaris 
subsp. vulgaris]
Length=700

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 93/189 (49%), Gaps = 42/189 (22%)
 Frame = +3

Query  189  IVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEH----RLTDGVSINFNGHF--------  332
            IVF+T+GRS Y FDI++  LP    +     S H    ++TDG+S+NFNGHF        
Sbjct  34   IVFTTLGRSRYNFDIYT--LPIFTTKSSASISNHHQELKVTDGISVNFNGHFPINSTSIF  91

Query  333  --LDEGDT---------FVFVSERSGSPRIYLQ---ENRSASAGKPPQLLSPSGTL----  458
              L++ ++          ++V+ER+GS  IY     ++ S +  +    L   G +    
Sbjct  92   SLLNQPNSPPSPTTNIQLIYVTERNGSFNIYFDSVYDSLSRAGSRSALELRVPGRVQVPL  151

Query  459  ----------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAV  608
                        DRP +    ++Y+S H+       SW+A+YSTH+      RLTP+G  
Sbjct  152  LGVNENERVSMKDRPSLVGEHVVYVSTHQNSGVARTSWAAVYSTHILTGSTRRLTPFGVA  211

Query  609  DFSPSVSQS  635
            DFSP+VS S
Sbjct  212  DFSPAVSPS  220



>emb|CAN73514.1| hypothetical protein VITISV_037210 [Vitis vinifera]
Length=715

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 88/187 (47%), Gaps = 49/187 (26%)
 Frame = +3

Query  204  VGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHF---------------  332
            +GRS Y FD+FS+    PS+       A E R+TDG S+NFNGHF               
Sbjct  47   LGRSDYAFDVFSLPTLGPSTI------ADELRITDGQSVNFNGHFPSSPIISLLANQTLL  100

Query  333  -------LDEGDTFVFVSERSGSPRIYLQ----------ENRSA--SAGKPPQLLSPSGT  455
                    DE    ++V+ER+GS  IYL             RSA  +A +    L  + T
Sbjct  101  ESSSVKRPDESLQTIYVTERNGSSNIYLDIIYYDTPTNSRRRSALETAVRVEVPLLGTNT  160

Query  456  L-------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  614
                      DRP +    L+Y+S HE      KSW+A+YSTHL      RLTPYG  D+
Sbjct  161  EQSDGRISMKDRPSLVGEXLVYVSTHEDSGVPRKSWAAVYSTHLPTGSTRRLTPYGVADY  220

Query  615  SPSVSQS  635
            SP+VS S
Sbjct  221  SPAVSPS  227



>ref|XP_002285876.2| PREDICTED: uncharacterized protein LOC100267814 [Vitis vinifera]
Length=715

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 68/187 (36%), Positives = 88/187 (47%), Gaps = 49/187 (26%)
 Frame = +3

Query  204  VGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHF---------------  332
            +GRS Y FD+FS+    PS+       A E R+TDG S+NFNGHF               
Sbjct  47   LGRSDYAFDVFSLPTLGPSTI------ADELRITDGQSVNFNGHFPSSPIISLLANQTLV  100

Query  333  -------LDEGDTFVFVSERSGSPRIYLQ----------ENRSA--SAGKPPQLLSPSGT  455
                    DE    ++V+ER+GS  IYL             RSA  +A +    L  + T
Sbjct  101  ESSSVKRPDESLQTIYVTERNGSSNIYLDIIYYDTPTNSRRRSALETAVRVEVPLLGTNT  160

Query  456  L-------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  614
                      DRP +    L+Y+S HE      KSW+A+YSTHL      RLTPYG  D+
Sbjct  161  EQSDGRISMKDRPSLVGEDLVYVSTHEDSGVPRKSWAAVYSTHLPTGSTRRLTPYGVADY  220

Query  615  SPSVSQS  635
            SP+VS S
Sbjct  221  SPAVSPS  227



>emb|CDY04662.1| BnaC05g17000D [Brassica napus]
Length=706

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 98/199 (49%), Gaps = 51/199 (26%)
 Frame = +3

Query  174  DPHG--TIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPASEHRLTDGVSINFNGHF---  332
            +P+G  TIVF+T+GRS Y FDIF++    P S       + E R+TDG S+NFNG+F   
Sbjct  27   NPNGGDTIVFTTLGRSRYEFDIFALSTTHPPSI------SGEIRITDGESVNFNGYFPSP  80

Query  333  -------------LDEGDT----FVFVSERSGSPRIYLQ-----------ENRS---ASA  419
                         +  GD+     ++V+ER+G+  IY             + RS   A +
Sbjct  81   SPALISLLPDATLIQPGDSSPLHLIYVTERNGTSSIYYDLLHGGDPDSKSKRRSMLEAQS  140

Query  420  GKPPQLLSPSGTL-------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKE  578
                QLL+ +          F D+P +    L+Y+S HE   E   SW+A+YST L    
Sbjct  141  RVQIQLLTNADNRSGNTVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAVYSTELRTGL  200

Query  579  ITRLTPYGAVDFSPSVSQS  635
              RLTP G  DFSP++S S
Sbjct  201  TRRLTPSGIADFSPALSPS  219



>emb|CDP10971.1| unnamed protein product [Coffea canephora]
Length=731

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 91/201 (45%), Gaps = 57/201 (28%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS--EHRLTDGVSINFNGHFLDEGDT---  350
            +IVF+T+GR+ Y FDI+S+ L  +      PAS  E +LTDGVS+NFNG+F         
Sbjct  38   SIVFTTLGRASYCFDIYSLPLWVA------PASSNELQLTDGVSVNFNGYFPSPSSVSVL  91

Query  351  --------------------FVFVSERSGSPRIYLQE----------NRSASAGKPPQLL  440
                                 V+V+ER+GS  ++L            +R+     P +  
Sbjct  92   FGAPDRTPADVSPPPPPPLHLVYVTERNGSSHVFLDSLYYRGREHAGSRAILEEDPSEST  151

Query  441  SPSGTLFH----------------DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGL  572
                T F                 D+P +    L+Y+S HE       SW+A+YSTHL  
Sbjct  152  RSELTRFQFPLVGLEQSDGRVSMKDKPTLVGEYLIYVSTHENTGVPRTSWAAVYSTHLKT  211

Query  573  KEITRLTPYGAVDFSPSVSQS  635
                RLTPYG  DFSP+VS S
Sbjct  212  GSTRRLTPYGVADFSPAVSPS  232



>ref|XP_009149686.1| PREDICTED: uncharacterized protein LOC103873010 [Brassica rapa]
Length=705

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 65/194 (34%), Positives = 91/194 (47%), Gaps = 51/194 (26%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF--------  332
            TIVF+T+GRS Y FD+F++          RP S   E R+TDG S+NFNG+F        
Sbjct  33   TIVFTTLGRSRYEFDVFALST-------TRPPSISGEIRITDGESVNFNGYFPSPSPALI  85

Query  333  --------LDEGDT----FVFVSERSGSPRIY---LQENRSASAGKPPQLLSPSGTL---  458
                    +  GD+     ++V+ER+G+  IY   L      S  K   +L  +  +   
Sbjct  86   SLLPDATLIQPGDSSPLHLIYVTERNGTSSIYYDLLHGGDPDSKSKRRSMLEATSRVQIP  145

Query  459  ---------------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLT  593
                           F D+P +    L+Y+S HE   E   SW+A+YST L      RLT
Sbjct  146  LLSNADHRSGNTVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAVYSTELRTGLTRRLT  205

Query  594  PYGAVDFSPSVSQS  635
            P G  DFSP++S S
Sbjct  206  PSGIADFSPALSPS  219



>ref|XP_010095431.1| hypothetical protein L484_013388 [Morus notabilis]
 gb|EXB60123.1| hypothetical protein L484_013388 [Morus notabilis]
Length=732

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 89/196 (45%), Gaps = 52/196 (27%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRP--ASEHRLTDGVSINFNGHFLDEGDT---  350
            +IVF+T+GR  Y FDIF+  LP+    DR P  ++E ++TDG S+NFNGHF     T   
Sbjct  32   SIVFTTLGRLDYAFDIFT--LPT----DRPPTISNEIQITDGESVNFNGHFPSPSSTSSL  85

Query  351  ----------------------FVFVSERSGSPRIYLQ-----ENRSASAGKPPQLLSPS  449
                                   ++V+ER G   +Y          S S G+   L  P 
Sbjct  86   LSLLPNQTLIQTLLPTDPPPLQLIYVTERDGVSSLYYDVVFPDSPTSRSIGRRSALEFPD  145

Query  450  GTLF--------------HDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITR  587
               F               DRP +    L+YIS HE   +   SW+A+YST L      R
Sbjct  146  RVQFPLLGEDLIQNKISMKDRPNLAGDYLVYISTHENTGKPRTSWAAVYSTELKSGTTRR  205

Query  588  LTPYGAVDFSPSVSQS  635
            LTPYG  DFSPSVS S
Sbjct  206  LTPYGVADFSPSVSPS  221



>ref|XP_010477409.1| PREDICTED: uncharacterized protein LOC104756505 [Camelina sativa]
Length=711

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 94/194 (48%), Gaps = 48/194 (25%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL----------  335
            TI+F+T+GRS Y FDIF++    S  Q    + E R+TDG S+NFNG+F           
Sbjct  35   TIIFTTLGRSRYEFDIFAL----STAQPPSVSGEFRITDGESVNFNGYFPSPSPALISLL  90

Query  336  -DEGDT---------FVFVSERSGSPRIYL-------------QENRS----ASAGKPPQ  434
             DE             ++V+ER+G+  +Y              +  RS    AS  + P 
Sbjct  91   PDETQIQLEDSSPLHLIYVTERNGTSSLYYDLIYEGSVESDSKRRRRSVLEAASRVQVPL  150

Query  435  LLSP----SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLT  593
            LLS     SG     F D+P +    L+Y+S HE   E   SW+A+YST L      RLT
Sbjct  151  LLSGFDQRSGMTVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAIYSTELRTGLTRRLT  210

Query  594  PYGAVDFSPSVSQS  635
            P G  DFSP+V+ S
Sbjct  211  PSGVADFSPAVTPS  224



>ref|XP_009593179.1| PREDICTED: uncharacterized protein LOC104089880 [Nicotiana tomentosiformis]
Length=706

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 93/187 (50%), Gaps = 36/187 (19%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF------  332
            ++ H +I+F+T+GRS Y FDIF++    S  Q +    E +LTDG S+NFNG+F      
Sbjct  34   LNAHTSIIFTTLGRSSYAFDIFALPTTHSPIQSK----ELQLTDGNSVNFNGYFPATLPP  89

Query  333  -----------LDEGDTF--VFVSERSGS------------PRIYLQENRSASAGKPPQL  437
                        +E   F  ++V+ER+G+            PR  + E  + +     Q+
Sbjct  90   SLVSCLPNHSLNNETPPFHLIYVTERNGTHHIFYDVVFHGTPRRAILEFPTRTEWTRVQV  149

Query  438  -LSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  614
             L  +     D+P +    L+Y+S HE P     SW+A+YST L      RLTP G  DF
Sbjct  150  PLVGAHVSLKDKPSLVGESLIYVSTHEDPGVPRTSWAAVYSTQLNSGSTRRLTPKGVADF  209

Query  615  SPSVSQS  635
            SP+VS S
Sbjct  210  SPAVSPS  216



>ref|XP_009796392.1| PREDICTED: uncharacterized protein LOC104242978 [Nicotiana sylvestris]
Length=706

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 93/187 (50%), Gaps = 37/187 (20%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-----  335
            ++ + +I+F+T+GRS Y FDIF++ + S  E +     E +LTDG S+NFNG+FL     
Sbjct  31   LNANTSIIFTTLGRSSYAFDIFALPIYSPTESN-----ELQLTDGNSVNFNGYFLATLPP  85

Query  336  ------------DEGDTF--VFVSERSGSPRIYLQE-----NRSASAGKPPQL-------  437
                        +E   F  ++V+ER+G+  I+        +R A    P +        
Sbjct  86   SLVSRLPDHSLNNETPPFHLIYVTERNGTHHIFYDAVFHGTSRRAILDFPARTESTRVQV  145

Query  438  -LSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDF  614
             L  +     D+P +    L+Y+S HE       SW+A+YST L      RLTP G  DF
Sbjct  146  PLVGAHVSLKDKPSLVGESLIYVSTHEDSGVPRTSWAAVYSTQLSSGSTRRLTPKGVADF  205

Query  615  SPSVSQS  635
            SP+VS S
Sbjct  206  SPAVSPS  212



>ref|XP_010539663.1| PREDICTED: uncharacterized protein LOC104813673 [Tarenaya hassleriana]
Length=672

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 91/181 (50%), Gaps = 34/181 (19%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL----------  335
            +IVF+T+GR  Y FDIF+  LP+        + E R+TDGV +NFNGHF           
Sbjct  12   SIVFTTLGRPSYEFDIFT--LPTRHRSPPSDSGELRITDGVPVNFNGHFAYPSAALISLL  69

Query  336  ---------DEGDT-FVFVSERSGSPRIYLQ----ENRSASAGKPPQLLSPSGTL-----  458
                     D+     ++++ER+G+  +Y      +++  S  + P ++S +  L     
Sbjct  70   PNNSGIQPHDQSYMHLIYITERNGTSSVYYDAVSGDHQVTSRLQVP-VISGANRLSGMAV  128

Query  459  --FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQ  632
                D+P +    L+Y+S HE   +   SW+A+YST L      RLTP G  DFSP+VS 
Sbjct  129  NSMKDKPSLAGDYLVYVSTHEVQSKPMTSWAAVYSTELRTGSTRRLTPPGIADFSPAVSP  188

Query  633  S  635
            S
Sbjct  189  S  189



>ref|XP_006472827.1| PREDICTED: uncharacterized protein LOC102617553 [Citrus sinensis]
Length=721

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 93/201 (46%), Gaps = 56/201 (28%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDR-RPASEHRLTDGVSINFNGHFL---------  335
            +I+F+T+GRS Y FDI++  LP S   DR   A+E ++TDG S+NFNGHF          
Sbjct  31   SIIFTTLGRSDYAFDIYT--LPIS---DRPTTANEIKITDGESVNFNGHFPSPSSSFLSF  85

Query  336  --------------DEGD----TFVFVSERSGSPRIYLQ----------------ENRSA  413
                          D  D      ++V+ER+G+  IY                  E   A
Sbjct  86   LLRNQTLIQSPGPQDSRDPPPLQLIYVTERNGTSNIYYDAVYYDTRRNTRSRTALEQHGA  145

Query  414  SAGKPPQ-----LLSPSGTL--FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGL  572
                  Q     L   +G +    D+P++    L+Y+S HE P     SW+A+YST L  
Sbjct  146  EVSTRVQVPLLDLNEVNGGVISMKDKPILSGEYLIYVSTHENPGTPRTSWAAVYSTELKT  205

Query  573  KEITRLTPYGAVDFSPSVSQS  635
                RLTPYG  DFSP+VS S
Sbjct  206  GLTRRLTPYGVADFSPAVSPS  226



>ref|XP_002890452.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66711.1| hypothetical protein ARALYDRAFT_472406 [Arabidopsis lyrata subsp. 
lyrata]
Length=706

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/191 (34%), Positives = 92/191 (48%), Gaps = 45/191 (24%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF-----------  332
            TI+F+T+GRS Y FDIF++    S       ++E R+TDG S+NFNG+F           
Sbjct  33   TIIFTTLGRSRYEFDIFTL----STTHPPSDSNELRITDGESVNFNGYFPSPTPALISLL  88

Query  333  -----LDEGDT----FVFVSERSGSPRIYL----------QENRSASAGKPPQLLSP---  446
                 +   D+     ++V+ER+G+  IY           +  R +    P ++  P   
Sbjct  89   PDETLIQMEDSSPLHLIYVTERNGTSSIYYDLIYGGDSDSKMKRRSVLEAPSRVQVPLLS  148

Query  447  -----SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  602
                 SG     F D+P +    L+Y+S HE   E   SW+A+YST L      RLTP G
Sbjct  149  GFDHQSGMTVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAVYSTELKTGLTRRLTPSG  208

Query  603  AVDFSPSVSQS  635
              DFSP+VS S
Sbjct  209  VADFSPAVSPS  219



>ref|XP_006304666.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
 gb|EOA37564.1| hypothetical protein CARUB_v10011878mg [Capsella rubella]
Length=708

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/191 (35%), Positives = 93/191 (49%), Gaps = 45/191 (24%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF----------L  335
            TI+F+T+GRS Y FDIF++    S  Q    + E R+TDG S+NFNG+F          L
Sbjct  35   TIIFTTLGRSRYEFDIFTL----STAQPPSVSGELRITDGASVNFNGYFPSPSPALISLL  90

Query  336  DEGDTF----------VFVSERSGSPRIYLQE---------NRSASAGKPPQ-----LLS  443
             +   F          ++V+ER+G+  +Y            N+  S  + P      LLS
Sbjct  91   PDETLFQLEDSSPLHLIYVTERNGTSSVYYDLIYGVDSDSINKRRSMLEAPSRVQVPLLS  150

Query  444  ----PSGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  602
                PSG     F D+P +    L+Y+S HE   +   SW+A+YST L      RLTP  
Sbjct  151  GFDQPSGMTVNSFKDKPSLSGDFLVYVSTHENSGKPRTSWTAVYSTELRTGLTRRLTPRD  210

Query  603  AVDFSPSVSQS  635
              DFSP+VS S
Sbjct  211  IADFSPAVSPS  221



>emb|CDX84088.1| BnaC08g07650D [Brassica napus]
Length=668

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 83/167 (50%), Gaps = 34/167 (20%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF------LD  338
            TIVF+T+GRS Y FD+F++          RP S   E R+TDG S+NFNG+F      L 
Sbjct  33   TIVFTTLGRSRYEFDVFALST-------TRPPSISGEIRITDGESVNFNGYFPIYYDLLH  85

Query  339  EGD--------TFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRL  494
             GD        + +  + R   P +   E+RS +              F D+P +    L
Sbjct  86   GGDPDSKSKRRSMLEATSRVQIPLLSNAEHRSGNTVNS----------FKDKPSLSGEFL  135

Query  495  LYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            +Y+S HE   E   SW+A+YST L      RLTP G  DFSP++S S
Sbjct  136  VYVSTHENSGEPRTSWTAVYSTELRTGLTRRLTPSGIADFSPALSPS  182



>ref|XP_006434259.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
 gb|ESR47499.1| hypothetical protein CICLE_v10000425mg [Citrus clementina]
Length=721

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 68/201 (34%), Positives = 92/201 (46%), Gaps = 56/201 (28%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDR-RPASEHRLTDGVSINFNGHFL---------  335
            +I+F+T+GRS Y FDI++  LP S   DR   A+E ++TDG S+NFNGHF          
Sbjct  31   SIIFTTLGRSDYAFDIYT--LPIS---DRPTTANEIKITDGESVNFNGHFPSPSSSFLSF  85

Query  336  --------------DEGD----TFVFVSERSGSPRIYLQ----------------ENRSA  413
                          D  D      ++V+ER+G+  IY                  E   A
Sbjct  86   LLRNQTLIQSPGPQDSRDPPPLQLIYVTERNGTSNIYYDAVYYDTRRNTRSRTALEQHGA  145

Query  414  SAGKPPQ-----LLSPSGTL--FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGL  572
                  Q     L   +G +    D+P +    L+Y+S HE P     SW+A+YST L  
Sbjct  146  EVSTRVQVPLLDLNEVNGGVISMKDKPSLSGEYLIYVSTHENPGTPRTSWAAVYSTELKT  205

Query  573  KEITRLTPYGAVDFSPSVSQS  635
                RLTPYG  DFSP+VS S
Sbjct  206  GLTRRLTPYGVADFSPAVSPS  226



>ref|XP_010521282.1| PREDICTED: uncharacterized protein LOC104800217 isoform X2 [Tarenaya 
hassleriana]
Length=725

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 93/195 (48%), Gaps = 50/195 (26%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF-------  332
             +++F+T+ RSHY FDIF+  LP+     RRP S   E R+TDG S+NFNG+F       
Sbjct  43   ASLIFATLDRSHYEFDIFT--LPTR----RRPPSASMEIRITDGESVNFNGYFPSPSPAL  96

Query  333  --------LDEGDT------FVFVSERSGSPRIYLQENRSASAGKPPQ--LLSPSGTL--  458
                    L + +T       ++++ER+G+  IY        +G   +  LL  S  +  
Sbjct  97   LSLLPDETLIQQETVTPPLHLIYITERNGTSSIYYDVVYGQDSGSMTKRSLLESSARVQV  156

Query  459  ----------------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRL  590
                              D+P +    L+Y+S HE P     SW+A+YST +      RL
Sbjct  157  PLLSGADGRSGMTVNSMRDKPSLIGDYLVYVSTHEDPGVPRASWAAVYSTQVQTGLTRRL  216

Query  591  TPYGAVDFSPSVSQS  635
            TP G  DFSP+VS S
Sbjct  217  TPRGIADFSPAVSPS  231



>ref|XP_010498624.1| PREDICTED: uncharacterized protein LOC104776288 [Camelina sativa]
Length=710

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 91/192 (47%), Gaps = 46/192 (24%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL----------  335
            TI+F+T+GRS Y FDIF++    S  +    + E R+TDG S+NFNG+F           
Sbjct  36   TIIFTTLGRSRYEFDIFAL----STAKPPSVSDELRITDGESVNFNGYFPSPSPALISLL  91

Query  336  -DEGDT---------FVFVSERSGSPRIYL-----------QENRSASAGKPPQLLSP--  446
             DE             ++V+ER+G+  +Y            +  R +    P ++  P  
Sbjct  92   PDETQIQLEDSSPLHLIYVTERNGTSSLYYDLIYGGVDSDSKRRRRSVLEAPSRVQVPLL  151

Query  447  ------SGTL---FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPY  599
                  SG     F D+P +    L+Y+S HE   E   SW+A+YST L      RLTP 
Sbjct  152  SGFDQRSGMTVNSFKDKPSLSGEFLVYVSTHENSGEPRTSWTAVYSTELRTGLTRRLTPS  211

Query  600  GAVDFSPSVSQS  635
            G  DFSP+VS S
Sbjct  212  GVADFSPAVSPS  223



>ref|XP_010521281.1| PREDICTED: uncharacterized protein LOC104800217 isoform X1 [Tarenaya 
hassleriana]
Length=724

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 64/195 (33%), Positives = 93/195 (48%), Gaps = 50/195 (26%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF-------  332
             +++F+T+ RSHY FDIF+  LP+     RRP S   E R+TDG S+NFNG+F       
Sbjct  43   ASLIFATLDRSHYEFDIFT--LPTR----RRPPSASMEIRITDGESVNFNGYFPSPSPAL  96

Query  333  --------LDEGDT------FVFVSERSGSPRIYLQENRSASAGKPPQ--LLSPSGTL--  458
                    L + +T       ++++ER+G+  IY        +G   +  LL  S  +  
Sbjct  97   LSLLPDETLIQQETVTPPLHLIYITERNGTSSIYYDVVYGQDSGSMTKRSLLESSARVQV  156

Query  459  ----------------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRL  590
                              D+P +    L+Y+S HE P     SW+A+YST +      RL
Sbjct  157  PLLSGADGRSGMTVNSMRDKPSLIGDYLVYVSTHEDPGVPRASWAAVYSTQVQTGLTRRL  216

Query  591  TPYGAVDFSPSVSQS  635
            TP G  DFSP+VS S
Sbjct  217  TPRGIADFSPAVSPS  231



>ref|XP_002515210.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47194.1| conserved hypothetical protein [Ricinus communis]
Length=618

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 50/63 (79%), Gaps = 2/63 (3%)
 Frame = +3

Query  453  TLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLK--EITRLTPYGAVDFSPSV  626
            +LFHDRP+++D RL +ISAH+ P +++KSW+ALY+  L  +   +TRLTPYG +D+SP+V
Sbjct  34   SLFHDRPIIKDNRLYFISAHQEPDKLYKSWNALYAIDLNQEGNSVTRLTPYGVIDYSPAV  93

Query  627  SQS  635
            S S
Sbjct  94   SLS  96



>ref|XP_008338671.1| PREDICTED: uncharacterized protein LOC103401727 [Malus domestica]
Length=689

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 89/182 (49%), Gaps = 39/182 (21%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  350
            +IVF+T+GR  Y FDIF++ +   PSS        +E ++TDG S+NFNGHF ++     
Sbjct  28   SIVFTTLGRLDYNFDIFTLPIRGPPSS-------TTETQITDGKSVNFNGHFPNKTRIQS  80

Query  351  ---------FVFVSERSGSPRIYLQ----ENRSASAGKP-----------PQLLSPSGT-  455
                      ++V+ER+G   I+       + +AS+G+            P L    G  
Sbjct  81   PTRSDPYLQLIYVTERNGFSNIFYDAVYLNSXTASSGRRSTLEVSXRVQVPLLSLEQGQN  140

Query  456  --LFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  629
                 DRP +    L+Y+S HE       S  A+YSTHL      RLTP G  DFSPSVS
Sbjct  141  RLSMKDRPTLTGDYLVYVSTHEDSGVPRTSSVAVYSTHLDSSVTRRLTPRGDADFSPSVS  200

Query  630  QS  635
             S
Sbjct  201  PS  202



>emb|CDY08186.1| BnaA06g15400D [Brassica napus]
Length=667

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 81/166 (49%), Gaps = 33/166 (20%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPAS---EHRLTDGVSINFNGHF--------  332
            TIVF+T+GRS Y FD+F++          RP S   E R+TDG S+NFNG+F        
Sbjct  33   TIVFTTLGRSRYEFDVFALSTT-------RPPSISGEIRITDGESVNFNGYFPFLSSPSH  85

Query  333  -----LDEGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPSGTLFHDRPVVRDGRLL  497
                   +  + +  + R   P +   E+RS +              F D+P +    L+
Sbjct  86   LRHREKRKRRSMLEATSRVQIPLLSNAEHRSGNTVNS----------FKDKPSLSGEFLV  135

Query  498  YISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            Y+S HE   E   SW+A+YST L      RLTP G  DFSP++S S
Sbjct  136  YVSTHENSGEPRTSWTAVYSTELRTGLTRRLTPSGIADFSPALSPS  181



>gb|ABR17080.1| unknown [Picea sitchensis]
Length=714

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 86/202 (43%), Gaps = 53/202 (26%)
 Frame = +3

Query  180  HGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFLDE-----  341
             GT+ F++VGR+HY FDI+++ L P  F  +     E  +TDG S+N NG +L       
Sbjct  37   QGTLAFASVGRAHYAFDIYTLPLQPLRFSTN---LEETLVTDGESVNHNGQYLQGPGIQT  93

Query  342  --------------GDTFVFVSERSGSPRIYL---------------QENRSASA---GK  425
                           +   FVSER G P +YL               +EN    A   GK
Sbjct  94   LMHRLNINTTSTPVENVMAFVSERDGFPELYLNIYLKDNLPLLAEKAEENSRREALEDGK  153

Query  426  PPQLLSPSGTL------------FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLG  569
                ++  G                DRP +    ++Y+S     K   KSW+A+YST + 
Sbjct  154  RCLTINFGGVFEEKGKKDMPDLSMKDRPSMAGNSMVYVSTRGQTKASRKSWAAVYSTSIK  213

Query  570  LKEITRLTPYGAVDFSPSVSQS  635
                 RLTP G  D SP+VS S
Sbjct  214  TGRTRRLTPDGIADLSPAVSPS  235



>ref|XP_002448903.1| hypothetical protein SORBIDRAFT_05g001167 [Sorghum bicolor]
 gb|EES07891.1| hypothetical protein SORBIDRAFT_05g001167 [Sorghum bicolor]
Length=98

 Score = 72.0 bits (175),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 9/84 (11%)
 Frame = +3

Query  171  MDPHGTIVFSTVGRSHYGFDIFSVQL--PSSFEQDRRPA------SEHRLTDGVSINFNG  326
            M+P GTIVF++VG +++GFD+FS+ +  P+S E             E   T+GVS+NFN 
Sbjct  1    MEPTGTIVFASVGVTNFGFDVFSIVVLTPASAEAKAEAGVSAQELDEQHHTNGVSVNFNA  60

Query  327  HFLDE-GDTFVFVSERSGSPRIYL  395
             F D+ GD  VFVSER+G+  ++L
Sbjct  61   QFADDAGDAVVFVSERTGAASLFL  84



>ref|XP_009343980.1| PREDICTED: uncharacterized protein LOC103935890 [Pyrus x bretschneideri]
Length=689

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 90/182 (49%), Gaps = 39/182 (21%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQL---PSSFEQDRRPASEHRLTDGVSINFNGHFLDEGDT--  350
            +IVF+T+GR  Y FDIF++ +   PSS        +E ++TDG S+NFNG+F ++     
Sbjct  28   SIVFTTLGRLDYNFDIFTLPIRGPPSS-------TTETQITDGKSVNFNGNFPNKTRIQS  80

Query  351  ---------FVFVSERSGSPRIYLQ----ENRSASAGKP-----------PQLLSPSGT-  455
                      ++V+ER+G   I+       + +AS+G+            P L    G  
Sbjct  81   PTRSDPYLQLIYVTERNGFSNIFYDAVYLNSPTASSGRRSTLEVSDRVQIPLLSLEQGQN  140

Query  456  --LFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  629
                 DRP +    L+Y+S HE       S +A+YSTHL      RLTP G  DFSP+VS
Sbjct  141  RLSMKDRPTLTGDYLVYVSTHEDSGVPRTSSAAVYSTHLDSGVTRRLTPRGVADFSPAVS  200

Query  630  QS  635
             S
Sbjct  201  PS  202



>ref|XP_001780675.1| predicted protein [Physcomitrella patens]
 gb|EDQ54561.1| predicted protein [Physcomitrella patens]
Length=710

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/178 (31%), Positives = 83/178 (47%), Gaps = 24/178 (13%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPA-----SEHRLTDGVSINFNGHFL-  335
            D  GTI FST+GR  + FD+++V                   E R+T G S+N+N   L 
Sbjct  25   DAGGTIGFSTLGRLSFAFDVYTVVFSQMGVLRGGGGGVGDFQETRVTLGESVNYNAQLLE  84

Query  336  ----DEGDTFVFVSERSGSPRIYLQ---ENRSASAGKPPQ-----------LLSPSGTLF  461
                D  +  ++VSE  GSP++YL      R A    P +           L +PS    
Sbjct  85   GSGSDVPELLLYVSEVEGSPQLYLDVPLTGRFAIDRLPTRSSRRIELLADRLNAPSKAFL  144

Query  462  HDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
            +DRP +     +++S  E   +  + W+A+YS +     + RLTP G  D+SP+VS S
Sbjct  145  NDRPSMIGDVFIFVSTEEDVGKPVQGWNAVYSLNFITSVVKRLTPPGITDYSPAVSPS  202



>ref|XP_004290903.2| PREDICTED: uncharacterized protein LOC101292474 [Fragaria vesca 
subsp. vesca]
Length=716

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 87/188 (46%), Gaps = 35/188 (19%)
 Frame = +3

Query  165  MIMDPHG--TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL-  335
            +  + HG  +IVF+T GR  Y FDIF++ +         P +E R+TDG S+NFNGHF  
Sbjct  42   ITAEDHGPSSIVFTTNGRLDYYFDIFTLPV----AHPTHPIAETRITDGQSVNFNGHFPS  97

Query  336  ----------------DEGDTFVFVSERSGSPRIYLQE-------NRSASAGKPPQ----  434
                            D     ++V+ER+G   I+          +R  SA +       
Sbjct  98   STFFPNQTRLRSPNRPDPSLQIIYVTERNGFSNIFYDAVYFDDSPSRKRSALEVVDRVQL  157

Query  435  -LLSPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVD  611
             LL        D+P +    L+Y+S HE       S +A+Y+T L      RLTP+G  D
Sbjct  158  PLLGSDRVSMKDKPSLTGEYLVYVSTHEDSGVPRTSSAAVYATELSSGLTRRLTPHGVAD  217

Query  612  FSPSVSQS  635
            FSP+VS S
Sbjct  218  FSPAVSPS  225



>ref|XP_008219596.1| PREDICTED: uncharacterized protein LOC103319783 [Prunus mume]
Length=697

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 85/179 (47%), Gaps = 32/179 (18%)
 Frame = +3

Query  186  TIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL----------  335
            +IVF+T+GR  Y FDIF++ +          A+E R+TD  S+NFNG+F           
Sbjct  28   SIVFTTLGRLDYYFDIFTLPIQGGLPS---AATETRITDAKSVNFNGYFPNLTRIPSHTR  84

Query  336  -DEGDTFVFVSERSGSPRIYLQE----------NRSASAGKPPQLLSPSGTL--------  458
             D     ++V+ER+G   IY              R ++     ++  P  +L        
Sbjct  85   PDPSLHLIYVTERNGFFNIYYDGVYLTSPTTIGGRRSALEVSDRIQVPLLSLEQGQNRFS  144

Query  459  FHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVSQS  635
              DRP +    L+Y+S HE       S +A+YSTH+      RLTP+G  DFSP+VS S
Sbjct  145  MKDRPSLTGDYLVYVSTHEDSGVPRTSSAAVYSTHINSGVTQRLTPHGIADFSPAVSPS  203



>gb|EAY93383.1| hypothetical protein OsI_15178 [Oryza sativa Indica Group]
Length=470

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 80/160 (50%), Gaps = 23/160 (14%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL--DEGDTFV  356
            GTIVF+T+GRS Y F IFS+ L  S      PA+E  LTDGVS+N+NG+F      D+ +
Sbjct  24   GTIVFTTLGRSRYEFSIFSLPLSPS---PHNPATELYLTDGVSVNYNGNFAPTSHSDSIL  80

Query  357  FVSERSGSPRIYL-------QENRSASAGKP--PQLLSPSGTLFHDRPVVRDGRLLYISA  509
            FVS+R+GS  +YL        E   A+A  P  P   S S T +   P         +S 
Sbjct  81   FVSKRNGSLNLYLSPVPSSRHEALEAAALSPLLPGNPSRSRTGYRSHPTAPT-----LST  135

Query  510  HEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVDFSPSVS  629
              PP  +    +A     +    + R+TP G   F+P+ S
Sbjct  136  SPPPSPLRNRAAA----GVEAASVERITPRGFHAFTPAAS  171



>ref|XP_010675830.1| PREDICTED: uncharacterized protein LOC104891773 [Beta vulgaris 
subsp. vulgaris]
Length=886

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 81/196 (41%), Gaps = 49/196 (25%)
 Frame = +3

Query  153  KPPIMIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHF  332
            K P +I +  G+I F    R     DI+S + P +  QD     E  +TDG S N+NG  
Sbjct  174  KIPKVIKEKKGSIAFFATYRPPVALDIYSTKYPLTSNQD-----EILMTDGHSYNYNGQV  228

Query  333  L---------------DEGDT----------FVFVSERSGSPR-----IYLQENRSASAG  422
            +               D G             +FVSERS +       +  Q+       
Sbjct  229  IPPLALKIMLQRPLLRDHGTERDVNLGRLSGMIFVSERSHNLETLHIALLFQD-------  281

Query  423  KPPQLLSPS-------GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEI  581
            +PP++ + +       G    D   +    L+Y+S  EP  E  + W+A+Y T+L   + 
Sbjct  282  QPPKVFNFAEVYDTFKGVRMEDSGCIAGDYLIYVSTMEPSPEPHQPWTAVYKTNLKTGKT  341

Query  582  TRLTPYGAVDFSPSVS  629
             RLT  G  D SPSVS
Sbjct  342  ERLTLQGQADLSPSVS  357



>ref|XP_010675837.1| PREDICTED: uncharacterized protein LOC104891780 [Beta vulgaris 
subsp. vulgaris]
Length=722

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 77/188 (41%), Gaps = 41/188 (22%)
 Frame = +3

Query  168  IMDPHGTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFL---  335
            + D  G++ F T  R    FDI+S  + P+S E       E  +TD +S N NGHF+   
Sbjct  1    MADNRGSLSFFTTYRPTVKFDIYSCPISPTSIED------EICMTDELSYNSNGHFIAPE  54

Query  336  ----------------------DEGDTFVFVSERSGSPRIYLQENRSASAGKPPQLLSPS  449
                                        +FVSER G+    L  +       P   + P 
Sbjct  55   ALKKILKHPKIASEVDDDDVDSGRLTGLIFVSER-GNGLETLHLSLRLDDEPPVYEVFPI  113

Query  450  GTLFH--------DRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGA  605
              L+H        D   +    L+Y++  +P  E  + W+ +Y THL   E TRLTP G 
Sbjct  114  SHLYHTFNGVRMEDSGCIAGDYLIYVTTKDPASERRQPWTTVYKTHLITGETTRLTPEGL  173

Query  606  VDFSPSVS  629
             D SP+VS
Sbjct  174  ADLSPAVS  181



>ref|XP_010675836.1| PREDICTED: uncharacterized protein LOC104891779 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 78/186 (42%), Gaps = 46/186 (25%)
 Frame = +3

Query  183  GTIVFSTVGRSHYGFDIFSVQL-PSSFEQDRRPASEHRLTDGVSINFNGHFL--------  335
            G++ F T  R     DI+S  + P+S +       E  +TD +S N NGHF+        
Sbjct  6    GSLSFFTTYRPTVKLDIYSCPISPTSIDD------EICMTDELSYNSNGHFIEPEALKII  59

Query  336  -----------DEGDT-------FVFVSER-SGSPRIYLQENRSASAGKPPQLL------  440
                       DE D         +FVSER +G   ++L         +PP         
Sbjct  60   LQHPKIASESVDEEDVDSGHLTGLIFVSERENGLETLHLSLRLD---DEPPVFEVFPISH  116

Query  441  ---SPSGTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYGAVD  611
               +  G    D   +    L+Y++  +P  E  + W+A+Y THL   E TRLTP G  D
Sbjct  117  VYDTFDGVRMEDSGCIAGDYLIYVTTKDPALERRQPWTAVYKTHLITGETTRLTPEGEAD  176

Query  612  FSPSVS  629
             SP+VS
Sbjct  177  LSPAVS  182



>ref|XP_010675829.1| PREDICTED: uncharacterized protein LOC104891772 [Beta vulgaris 
subsp. vulgaris]
Length=731

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 77/189 (41%), Gaps = 49/189 (26%)
 Frame = +3

Query  174  DPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL------  335
            +  G+I F    R     DI+S       +Q +    E  +TDG++ N+NG  +      
Sbjct  7    NKRGSIAFFATYRPPVALDIYSAP-----DQPKSRHDEVLMTDGMAYNYNGQVIPPLALK  61

Query  336  --------------DEGDT-----FVFVSERSGSPR-----IYLQENRSASAGKPPQLLS  443
                          D+ D+      +FVSER+ S       +  Q+       +PP++ +
Sbjct  62   TMLKRPLMASHGTEDDVDSGRLSGLIFVSERTNSLETLHIALLFQD-------QPPKVFN  114

Query  444  PS-------GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  602
             +       G    D   +    L+Y+S  EP  E  + W+A+Y T+L      RLT  G
Sbjct  115  FAEVYDTFKGVRMEDSGCIAGNYLIYVSTMEPASEPHQPWTAVYKTNLTTAITERLTLKG  174

Query  603  AVDFSPSVS  629
              D SPSVS
Sbjct  175  QADLSPSVS  183



>ref|XP_010102639.1| hypothetical protein L484_010931 [Morus notabilis]
 gb|EXB93789.1| hypothetical protein L484_010931 [Morus notabilis]
Length=714

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 77/191 (40%), Gaps = 40/191 (21%)
 Frame = +3

Query  165  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---  335
            M     G+I F    R     DIFS  +P + ++D     E  +TDGVS N+N   +   
Sbjct  1    MADQKRGSIAFFATYRPPVPLDIFSCPIPPTSKKD-----ELHMTDGVSYNYNAQVIPPA  55

Query  336  -----------------DEGDT-----FVFVSERSGSPRIYLQENRSASAGKPPQLLSPS  449
                             D+ D+      +FVSER     +++    +       ++ S +
Sbjct  56   ALKTILKRPKVASEANEDDVDSGRLSGMIFVSERGNLETLHIALRFNDETAPKVKVFSLA  115

Query  450  ---------GTLFHDRPVVRDGRLLYISAHEPPKEVFKSWSALYSTHLGLKEITRLTPYG  602
                     G    D   +    L+YI+  +P  +  + W+A+Y T+L   E  RLTP  
Sbjct  116  DVFGAATFNGVRMEDSGCIAGDHLVYITTKDP-ADRHQPWTAVYKTNLVTGETDRLTPSE  174

Query  603  AVDFSPSVSQS  635
              D SPSVS S
Sbjct  175  HSDLSPSVSPS  185



>ref|XP_011003182.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105109992 
[Populus euphratica]
Length=270

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 5/53 (9%)
 Frame = +3

Query  492  LLYISAHEPPKEVFKSWSALYST-----HLGLKEITRLTPYGAVDFSPSVSQS  635
              +ISAHE P + FKSWS LY T     H    +  RLTP+GAV +SP++S S
Sbjct  14   FYFISAHEKPDQPFKSWSTLYXTIVDHIHYRTSKFIRLTPHGAVYYSPAISLS  66



>ref|XP_010235117.1| PREDICTED: uncharacterized protein LOC100846313 [Brachypodium 
distachyon]
Length=751

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 81/202 (40%), Gaps = 50/202 (25%)
 Frame = +3

Query  165  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---  335
            M  +  G I F    R     DIFS  +P S  +D     E  LTDGVS N++   +   
Sbjct  1    MAGESRGNIAFFATYRPPVPLDIFSSPVPPSSSRD-----EVHLTDGVSYNYDCRPIPAS  55

Query  336  -------------DEGDT-----------FVFVSERSG---SPRIYL---QENRSASAGK  425
                         D G T            VFVSER G   + RI L   ++N++     
Sbjct  56   ALKALLRRPKLAADGGATEADVDAGRVSGLVFVSERDGGLETLRIALRFDKDNKTKVFSL  115

Query  426  PPQLLSP--SGTLFHDRPVVRDG----------RLLYISAHEPPKEVFKSWSALYSTHLG  569
                 S   SGT   D      G           L+Y+S  EP K+    W+ +Y T+L 
Sbjct  116  ADVFGSGDFSGTRLEDSGCFGGGYKVGSRTVDHSLIYVSTKEPVKDRRSPWTVVYKTNLR  175

Query  570  LKEITRLTPYGAVDFSPSVSQS  635
              +  RLTP GA D SP+VS S
Sbjct  176  TGKTERLTPKGAYDLSPAVSPS  197



>ref|XP_003574472.1| PREDICTED: uncharacterized protein LOC100838501 [Brachypodium 
distachyon]
Length=752

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 62/202 (31%), Positives = 81/202 (40%), Gaps = 50/202 (25%)
 Frame = +3

Query  165  MIMDPHGTIVFSTVGRSHYGFDIFSVQLPSSFEQDRRPASEHRLTDGVSINFNGHFL---  335
            M  +  G I F    R     DIFS  +P S  +D     E  LTDGVS N++   +   
Sbjct  1    MAGESRGNIAFFATYRPPVPLDIFSSPVPPSSSRD-----EVHLTDGVSYNYDCRPIPAS  55

Query  336  -------------DEGDT-----------FVFVSERSG---SPRIYL---QENRSASAGK  425
                         D G T            VFVSER G   + RI L   ++N++     
Sbjct  56   ALKALLRRPKLAADGGATEADVDAGRVSGLVFVSERDGGLETLRIALRFDKDNKTKVFSL  115

Query  426  PPQLLSP--SGTLFHDRPVVRDG----------RLLYISAHEPPKEVFKSWSALYSTHLG  569
                 S   SGT   D      G           L+Y+S  EP K+    W+ +Y T+L 
Sbjct  116  ADVFGSGDFSGTRLEDSGCFGGGYKVGSRTVDHSLIYVSTKEPVKDRRSPWTVVYKTNLR  175

Query  570  LKEITRLTPYGAVDFSPSVSQS  635
              +  RLTP GA D SP+VS S
Sbjct  176  TGKTERLTPKGAYDLSPAVSPS  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125