BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF044I01

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            314   8e-102   Nicotiana tomentosiformis
ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            311   1e-100   Nicotiana sylvestris
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            306   1e-98    Solanum lycopersicum
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       304   8e-98    Solanum tuberosum [potatoes]
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                301   2e-96    Erythranthe guttata [common monkey flower]
ref|XP_002528403.1|  serine carboxypeptidase, putative                  300   4e-96    Ricinus communis
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            299   9e-96    Sesamum indicum [beniseed]
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            296   1e-94    Vitis vinifera
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            296   1e-94    Prunus mume [ume]
ref|XP_006453576.1|  hypothetical protein CICLE_v10008112mg             292   1e-94    
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             296   1e-94    Prunus persica
ref|XP_010531651.1|  PREDICTED: serine carboxypeptidase-like 29         285   8e-94    Tarenaya hassleriana [spider flower]
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            294   1e-93    Pyrus x bretschneideri [bai li]
emb|CDP02851.1|  unnamed protein product                                293   3e-93    Coffea canephora [robusta coffee]
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         293   3e-93    Jatropha curcas
emb|CBI36578.3|  unnamed protein product                                292   5e-93    Vitis vinifera
gb|KDO62275.1|  hypothetical protein CISIN_1g0418332mg                  286   8e-93    Citrus sinensis [apfelsine]
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             291   8e-93    Citrus clementina [clementine]
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            292   9e-93    Vitis vinifera
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            291   1e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         291   1e-92    Tarenaya hassleriana [spider flower]
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             290   2e-92    
ref|XP_011018072.1|  PREDICTED: serine carboxypeptidase-like 29 i...    288   2e-92    Populus euphratica
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             291   2e-92    Citrus clementina [clementine]
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         290   2e-92    
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       290   3e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            290   4e-92    
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    288   7e-92    Phoenix dactylifera
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            289   7e-92    Fragaria vesca subsp. vesca
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    288   2e-91    Citrus sinensis [apfelsine]
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    288   3e-91    Populus euphratica
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    287   3e-91    Phoenix dactylifera
gb|KJB76660.1|  hypothetical protein B456_012G098600                    285   6e-91    Gossypium raimondii
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       286   1e-90    Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    286   1e-90    Arabis alpina [alpine rockcress]
ref|XP_006387151.1|  hypothetical protein POPTR_1689s00200g             280   2e-90    
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            285   2e-90    Eucalyptus grandis [rose gum]
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       285   2e-90    Eucalyptus grandis [rose gum]
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          285   3e-90    Amborella trichopoda
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    284   4e-90    
gb|KJB76659.1|  hypothetical protein B456_012G098600                    284   9e-90    Gossypium raimondii
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    283   1e-89    Cucumis sativus [cucumbers]
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            283   1e-89    Cucumis melo [Oriental melon]
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       285   2e-89    Cucumis sativus [cucumbers]
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    282   4e-89    Theobroma cacao [chocolate]
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            280   2e-88    Elaeis guineensis
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             280   2e-88    Capsella rubella
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         280   2e-88    Gossypium arboreum [tree cotton]
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            279   6e-88    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             278   1e-87    
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         278   2e-87    Brassica rapa
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         278   2e-87    Brassica rapa
emb|CDY28217.1|  BnaA01g06320D                                          277   3e-87    Brassica napus [oilseed rape]
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         277   3e-87    Camelina sativa [gold-of-pleasure]
emb|CDY23258.1|  BnaA08g12880D                                          277   3e-87    Brassica napus [oilseed rape]
gb|EPS71160.1|  hypothetical protein M569_03591                         276   3e-87    Genlisea aurea
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            276   4e-87    Brachypodium distachyon [annual false brome]
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         276   6e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    276   7e-87    
emb|CDX68696.1|  BnaC01g07570D                                          277   8e-87    
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         275   2e-86    
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         275   2e-86    Camelina sativa [gold-of-pleasure]
ref|NP_567854.1|  serine carboxypeptidase-like 29                       275   3e-86    Arabidopsis thaliana [mouse-ear cress]
emb|CDY55623.1|  BnaC03g77560D                                          274   4e-86    Brassica napus [oilseed rape]
emb|CDY28216.1|  BnaA01g06330D                                          274   4e-86    Brassica napus [oilseed rape]
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         272   2e-85    Brassica rapa
emb|CDY13387.1|  BnaA03g51050D                                          272   2e-85    Brassica napus [oilseed rape]
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             271   6e-85    Eutrema salsugineum [saltwater cress]
emb|CDX68695.1|  BnaC01g07580D                                          271   1e-84    
gb|KHN02055.1|  Serine carboxypeptidase II-2                            270   1e-84    Glycine soja [wild soybean]
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       270   2e-84    Glycine max [soybeans]
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       268   9e-84    Setaria italica
emb|CDX72270.1|  BnaC07g42920D                                          273   1e-83    
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       268   1e-83    Oryza brachyantha
dbj|BAJ99024.1|  predicted protein                                      267   2e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02147.1|  predicted protein                                      267   2e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    263   2e-82    
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       265   2e-82    Cicer arietinum [garbanzo]
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          264   4e-82    Zea mays [maize]
emb|CAN75200.1|  hypothetical protein VITISV_014887                     265   6e-82    Vitis vinifera
ref|NP_001057009.1|  Os06g0186400                                       262   3e-81    
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    261   3e-81    Hordeum vulgare [barley]
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             261   5e-81    Phaseolus vulgaris [French bean]
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                258   1e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDY32091.1|  BnaC04g44750D                                          258   3e-80    Brassica napus [oilseed rape]
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         257   7e-80    Brassica rapa
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       258   9e-80    Medicago truncatula
emb|CDY40438.1|  BnaA04g20790D                                          256   1e-79    Brassica napus [oilseed rape]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    256   4e-79    Glycine max [soybeans]
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    255   4e-79    Solanum tuberosum [potatoes]
emb|CDO99730.1|  unnamed protein product                                255   5e-79    Coffea canephora [robusta coffee]
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    254   2e-78    Arabis alpina [alpine rockcress]
ref|NP_181121.1|  serine carboxypeptidase-like 26                       254   2e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       254   2e-78    Medicago truncatula
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         253   3e-78    Sesamum indicum [beniseed]
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             253   5e-78    Eutrema salsugineum [saltwater cress]
gb|AES66787.2|  serine carboxypeptidase-like protein                    253   5e-78    Medicago truncatula
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         253   5e-78    Solanum lycopersicum
emb|CDP11023.1|  unnamed protein product                                253   5e-78    Coffea canephora [robusta coffee]
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             252   6e-78    Capsella rubella
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         252   8e-78    Nicotiana sylvestris
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          252   8e-78    Arabidopsis lyrata subsp. petraea
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         252   8e-78    Jatropha curcas
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         252   9e-78    Camelina sativa [gold-of-pleasure]
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             252   9e-78    
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             252   1e-77    Phaseolus vulgaris [French bean]
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         252   1e-77    Populus trichocarpa [western balsam poplar]
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    252   1e-77    Glycine max [soybeans]
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         251   2e-77    Camelina sativa [gold-of-pleasure]
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         251   2e-77    Nicotiana tomentosiformis
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         252   3e-77    Glycine soja [wild soybean]
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         251   3e-77    Populus euphratica
gb|KJB78940.1|  hypothetical protein B456_013G026200                    248   3e-77    Gossypium raimondii
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         251   3e-77    Fragaria vesca subsp. vesca
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               251   3e-77    Medicago truncatula
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         250   4e-77    Pyrus x bretschneideri [bai li]
ref|XP_003596536.1|  Serine carboxypeptidase                            253   4e-77    
gb|EYU39591.1|  hypothetical protein MIMGU_mgv1a009171mg                247   4e-77    Erythranthe guttata [common monkey flower]
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         250   5e-77    Camelina sativa [gold-of-pleasure]
gb|KJB76564.1|  hypothetical protein B456_012G094900                    246   5e-77    Gossypium raimondii
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         250   5e-77    Nelumbo nucifera [Indian lotus]
gb|KJB76565.1|  hypothetical protein B456_012G094900                    246   8e-77    Gossypium raimondii
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         249   1e-76    Gossypium arboreum [tree cotton]
gb|KJB78942.1|  hypothetical protein B456_013G026200                    248   1e-76    Gossypium raimondii
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         249   1e-76    Populus trichocarpa [western balsam poplar]
gb|KJB78939.1|  hypothetical protein B456_013G026200                    248   1e-76    Gossypium raimondii
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         248   3e-76    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007009788.1|  Serine carboxypeptidase-like 27 isoform 2          247   3e-76    
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         248   3e-76    Nelumbo nucifera [Indian lotus]
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         248   3e-76    Glycine soja [wild soybean]
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    248   4e-76    Cucumis sativus [cucumbers]
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    248   4e-76    Glycine max [soybeans]
gb|KJB78938.1|  hypothetical protein B456_013G026200                    248   4e-76    Gossypium raimondii
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         248   5e-76    Malus domestica [apple tree]
gb|AFK34623.1|  unknown                                                 238   5e-76    Lotus japonicus
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         247   6e-76    Pyrus x bretschneideri [bai li]
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    247   7e-76    Fragaria vesca subsp. vesca
ref|XP_002534550.1|  serine carboxypeptidase, putative                  245   7e-76    
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         247   8e-76    
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    247   1e-75    Fragaria vesca subsp. vesca
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         246   2e-75    Cucumis melo [Oriental melon]
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         246   2e-75    Prunus mume [ume]
gb|KJB76563.1|  hypothetical protein B456_012G094900                    246   2e-75    Gossypium raimondii
gb|AFK37459.1|  unknown                                                 246   2e-75    Lotus japonicus
ref|XP_009141517.1|  PREDICTED: serine carboxypeptidase-like 28         246   3e-75    Brassica rapa
gb|KJB76567.1|  hypothetical protein B456_012G094900                    246   4e-75    Gossypium raimondii
gb|KJB76566.1|  hypothetical protein B456_012G094900                    246   4e-75    Gossypium raimondii
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         245   6e-75    Vitis vinifera
emb|CDY40439.1|  BnaA04g20780D                                          245   7e-75    Brassica napus [oilseed rape]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         244   8e-75    Tarenaya hassleriana [spider flower]
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          246   1e-74    
ref|XP_010067291.1|  PREDICTED: serine carboxypeptidase-like 28         244   1e-74    Eucalyptus grandis [rose gum]
ref|XP_011040962.1|  PREDICTED: serine carboxypeptidase-like 27         244   1e-74    Populus euphratica
gb|EPS66906.1|  hypothetical protein M569_07869                         242   2e-74    Genlisea aurea
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             244   2e-74    Populus trichocarpa [western balsam poplar]
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               243   3e-74    Medicago truncatula
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    243   3e-74    Arabis alpina [alpine rockcress]
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               243   3e-74    
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             243   3e-74    Eutrema salsugineum [saltwater cress]
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              243   4e-74    Fragaria vesca subsp. vesca
gb|KJB76571.1|  hypothetical protein B456_012G095000                    243   5e-74    Gossypium raimondii
gb|AES62200.2|  serine carboxypeptidase-like protein                    243   5e-74    Medicago truncatula
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   242   5e-74    Citrus sinensis [apfelsine]
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             242   5e-74    Citrus clementina [clementine]
emb|CAN74854.1|  hypothetical protein VITISV_028701                     242   6e-74    Vitis vinifera
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         242   7e-74    Gossypium arboreum [tree cotton]
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     242   1e-73    Eucalyptus grandis [rose gum]
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         241   1e-73    Camelina sativa [gold-of-pleasure]
ref|XP_007009790.1|  Serine carboxypeptidase-like 28                    241   1e-73    
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    241   1e-73    
gb|KJB76569.1|  hypothetical protein B456_012G094900                    241   1e-73    Gossypium raimondii
emb|CBI31484.3|  unnamed protein product                                242   1e-73    Vitis vinifera
ref|XP_004496293.1|  PREDICTED: serine carboxypeptidase-like 27-l...    240   1e-73    
ref|XP_002274699.1|  PREDICTED: serine carboxypeptidase-like 28         241   1e-73    Vitis vinifera
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    241   2e-73    Brassica rapa
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         241   2e-73    Populus euphratica
emb|CDY35977.1|  BnaA05g29730D                                          241   2e-73    Brassica napus [oilseed rape]
ref|NP_187456.1|  serine carboxypeptidase-like 27                       241   2e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         241   2e-73    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY28004.1|  BnaC05g44060D                                          241   3e-73    Brassica napus [oilseed rape]
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         242   3e-73    Eucalyptus grandis [rose gum]
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         240   4e-73    Populus euphratica
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    240   5e-73    Cicer arietinum [garbanzo]
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         239   8e-73    Camelina sativa [gold-of-pleasure]
ref|XP_010260054.1|  PREDICTED: serine carboxypeptidase-like 25 i...    238   1e-72    Nelumbo nucifera [Indian lotus]
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         239   1e-72    Camelina sativa [gold-of-pleasure]
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         239   1e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002315293.2|  hypothetical protein POPTR_0010s22700g             239   2e-72    
gb|AFK43035.1|  unknown                                                 238   2e-72    Medicago truncatula
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    238   2e-72    Nelumbo nucifera [Indian lotus]
ref|XP_006297634.1|  hypothetical protein CARUB_v10013654mg             237   2e-72    
ref|XP_010505097.1|  PREDICTED: serine carboxypeptidase-like 28         238   3e-72    Camelina sativa [gold-of-pleasure]
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         238   4e-72    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         239   4e-72    Elaeis guineensis
gb|KDO48446.1|  hypothetical protein CISIN_1g016137mg                   235   5e-72    Citrus sinensis [apfelsine]
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         237   6e-72    Nicotiana sylvestris
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         237   6e-72    Vitis vinifera
emb|CBI21207.3|  unnamed protein product                                237   7e-72    Vitis vinifera
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             237   7e-72    
dbj|BAO04184.1|  hypothetical protein                                   237   8e-72    Delphinium grandiflorum
ref|NP_181120.2|  serine carboxypeptidase-like 28                       237   8e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          237   9e-72    Amborella trichopoda
ref|XP_006436272.1|  hypothetical protein CICLE_v10031437mg             236   2e-71    Citrus clementina [clementine]
dbj|BAK05698.1|  predicted protein                                      233   2e-71    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    236   2e-71    Nelumbo nucifera [Indian lotus]
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             236   2e-71    Arabidopsis lyrata subsp. lyrata
ref|XP_006294164.1|  hypothetical protein CARUB_v10023157mg             236   2e-71    Capsella rubella
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               235   3e-71    Medicago truncatula
emb|CDO99728.1|  unnamed protein product                                236   3e-71    Coffea canephora [robusta coffee]
gb|KJB75609.1|  hypothetical protein B456_012G048700                    231   3e-71    Gossypium raimondii
ref|XP_006410746.1|  hypothetical protein EUTSA_v10016610mg             235   3e-71    Eutrema salsugineum [saltwater cress]
gb|KJB77373.1|  hypothetical protein B456_012G134700                    236   3e-71    Gossypium raimondii
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    235   6e-71    
ref|XP_002529402.1|  serine carboxypeptidase, putative                  235   6e-71    Ricinus communis
gb|KJB77375.1|  hypothetical protein B456_012G134700                    236   6e-71    Gossypium raimondii
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             234   6e-71    Phaseolus vulgaris [French bean]
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         234   1e-70    Jatropha curcas
gb|ABR16028.1|  unknown                                                 234   1e-70    Picea sitchensis
gb|KJB07560.1|  hypothetical protein B456_001G032600                    232   1e-70    Gossypium raimondii
gb|AAM15112.1|  putative serine carboxypeptidase II                     233   1e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         233   2e-70    Nelumbo nucifera [Indian lotus]
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         233   2e-70    Glycine max [soybeans]
ref|XP_006373363.1|  hypothetical protein POPTR_0017s12960g             232   2e-70    
ref|XP_010509563.1|  PREDICTED: serine carboxypeptidase-like 28         233   2e-70    Camelina sativa [gold-of-pleasure]
ref|XP_009618061.1|  PREDICTED: serine carboxypeptidase-like 34         226   2e-70    Nicotiana tomentosiformis
ref|XP_002881413.1|  hypothetical protein ARALYDRAFT_321290             233   2e-70    
emb|CDP10248.1|  unnamed protein product                                233   2e-70    Coffea canephora [robusta coffee]
ref|XP_007032751.1|  Serine carboxypeptidase-like 25 isoform 4          230   2e-70    
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         234   3e-70    Eucalyptus grandis [rose gum]
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    233   3e-70    Morus notabilis
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         233   3e-70    Nelumbo nucifera [Indian lotus]
ref|XP_010516781.1|  PREDICTED: serine carboxypeptidase-like 28         233   4e-70    Camelina sativa [gold-of-pleasure]
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    233   4e-70    Glycine max [soybeans]
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    232   5e-70    
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              232   6e-70    Sesamum indicum [beniseed]
gb|KJB07562.1|  hypothetical protein B456_001G032600                    231   6e-70    Gossypium raimondii
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         232   6e-70    Nicotiana tomentosiformis
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    232   7e-70    Glycine max [soybeans]
ref|XP_011018041.1|  PREDICTED: serine carboxypeptidase 24-like i...    230   7e-70    Populus euphratica
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         232   7e-70    Populus trichocarpa [western balsam poplar]
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         232   8e-70    Solanum tuberosum [potatoes]
ref|XP_006453595.1|  hypothetical protein CICLE_v10008182mg             228   8e-70    
gb|KHN42831.1|  Serine carboxypeptidase 24                              231   1e-69    Glycine soja [wild soybean]
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         231   1e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         232   1e-69    Prunus mume [ume]
ref|NP_001140896.1|  hypothetical protein precursor                     224   1e-69    
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         231   2e-69    Solanum lycopersicum
gb|KFK36473.1|  hypothetical protein AALP_AA4G129300                    230   2e-69    Arabis alpina [alpine rockcress]
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         231   2e-69    Glycine soja [wild soybean]
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              231   2e-69    Brachypodium distachyon [annual false brome]
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         231   2e-69    Nicotiana sylvestris
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         231   2e-69    Populus euphratica
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                231   2e-69    Erythranthe guttata [common monkey flower]
gb|KJB07564.1|  hypothetical protein B456_001G032600                    231   2e-69    Gossypium raimondii
gb|KJB07559.1|  hypothetical protein B456_001G032600                    231   2e-69    Gossypium raimondii
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          231   2e-69    Sorghum bicolor [broomcorn]
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    231   3e-69    Morus notabilis
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 230   3e-69    
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              231   3e-69    Pyrus x bretschneideri [bai li]
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    230   3e-69    Solanum tuberosum [potatoes]
ref|XP_010938508.1|  PREDICTED: serine carboxypeptidase II-3-like...    229   3e-69    
ref|XP_010315500.1|  PREDICTED: serine carboxypeptidase II-3-like       231   3e-69    
ref|XP_007146042.1|  hypothetical protein PHAVU_006G007800g             231   3e-69    Phaseolus vulgaris [French bean]
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         230   3e-69    Fragaria vesca subsp. vesca
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         230   3e-69    Populus euphratica
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    230   3e-69    Populus euphratica
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          230   4e-69    Amborella trichopoda
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   229   4e-69    Populus trichocarpa [western balsam poplar]
emb|CDY43258.1|  BnaC05g48510D                                          230   4e-69    Brassica napus [oilseed rape]
gb|KJB75608.1|  hypothetical protein B456_012G048700                    230   4e-69    Gossypium raimondii
emb|CDP02317.1|  unnamed protein product                                230   5e-69    Coffea canephora [robusta coffee]
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    230   5e-69    
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         230   5e-69    Pyrus x bretschneideri [bai li]
ref|NP_001152245.1|  lysosomal protective protein precursor             230   5e-69    
gb|KEH21654.1|  serine carboxypeptidase-like protein                    229   5e-69    Medicago truncatula
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         229   6e-69    Brassica rapa
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          229   6e-69    
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                229   7e-69    Gossypium arboreum [tree cotton]
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             229   8e-69    
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             228   8e-69    
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    229   8e-69    
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    229   9e-69    
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    229   9e-69    
dbj|BAJ85578.1|  predicted protein                                      229   9e-69    
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         229   1e-68    
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         229   1e-68    
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          229   1e-68    
ref|NP_001141117.1|  uncharacterized protein LOC100273202 precursor     225   1e-68    
dbj|BAJ92218.1|  predicted protein                                      230   1e-68    
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         229   1e-68    
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         229   1e-68    
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    228   1e-68    
gb|ACL53740.1|  unknown                                                 225   2e-68    
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    228   2e-68    
ref|NP_001151874.1|  LOC100285510 precursor                             228   2e-68    
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         229   2e-68    
ref|XP_009794620.1|  PREDICTED: putative serine carboxypeptidase-...    229   2e-68    
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              228   2e-68    
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         228   2e-68    
ref|XP_010938742.1|  PREDICTED: serine carboxypeptidase II-3-like       229   2e-68    
ref|XP_010938507.1|  PREDICTED: serine carboxypeptidase II-3-like...    229   2e-68    
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         228   2e-68    
gb|KHN35601.1|  Serine carboxypeptidase II-3                            229   2e-68    
ref|XP_008800209.1|  PREDICTED: serine carboxypeptidase II-3-like       229   3e-68    
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             228   3e-68    
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         228   3e-68    
ref|XP_010655923.1|  PREDICTED: serine carboxypeptidase-like 34         229   3e-68    
emb|CBI29056.3|  unnamed protein product                                228   3e-68    
ref|XP_006578498.1|  PREDICTED: serine carboxypeptidase II-3-like       229   3e-68    
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          229   3e-68    
ref|XP_008654562.1|  PREDICTED: uncharacterized protein LOC100273...    224   4e-68    
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          227   4e-68    
ref|XP_008365144.1|  PREDICTED: serine carboxypeptidase II-3-like       225   4e-68    
ref|XP_008783277.1|  PREDICTED: serine carboxypeptidase II-3-like       228   4e-68    
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         228   4e-68    
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             227   4e-68    
ref|XP_009351733.1|  PREDICTED: serine carboxypeptidase-like 34         227   5e-68    
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         227   5e-68    
gb|KDO72764.1|  hypothetical protein CISIN_1g011426mg                   224   6e-68    
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    227   6e-68    
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             227   6e-68    
ref|XP_010108549.1|  Serine carboxypeptidase 24                         227   7e-68    
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         227   8e-68    
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    226   8e-68    
gb|KJB76570.1|  hypothetical protein B456_012G095000                    226   8e-68    
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    227   9e-68    
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         227   9e-68    
ref|XP_011022036.1|  PREDICTED: serine carboxypeptidase-like 34         227   9e-68    
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         227   9e-68    
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              226   9e-68    
ref|XP_008813040.1|  PREDICTED: serine carboxypeptidase II-3-like       227   1e-67    
gb|EPS67442.1|  hypothetical protein M569_07330                         224   1e-67    
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    227   1e-67    
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    224   1e-67    
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    227   1e-67    
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         226   1e-67    
ref|XP_008361910.1|  PREDICTED: serine carboxypeptidase-like 34         226   2e-67    
gb|KFK27639.1|  hypothetical protein AALP_AA8G409500                    226   2e-67    
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           226   2e-67    
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    226   2e-67    
ref|XP_009399958.1|  PREDICTED: serine carboxypeptidase II-3-like       226   2e-67    
gb|EAY76388.1|  hypothetical protein OsI_04319                          225   2e-67    
ref|NP_001044713.1|  Os01g0833500                                       225   2e-67    
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    225   3e-67    
gb|EEC69980.1|  hypothetical protein OsI_00486                          225   3e-67    
gb|KJB79850.1|  hypothetical protein B456_013G069700                    226   3e-67    
gb|KCW51319.1|  hypothetical protein EUGRSUZ_J00874                     223   3e-67    
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         225   3e-67    
ref|XP_010916829.1|  PREDICTED: serine carboxypeptidase II-3-like       224   3e-67    
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    224   4e-67    
ref|XP_006345489.1|  PREDICTED: serine carboxypeptidase-like 40-like    224   4e-67    
gb|AAQ63884.1|  putative serine carboxypeptidase                        226   4e-67    
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          225   4e-67    
gb|KEH32355.1|  serine carboxypeptidase-like protein                    225   4e-67    
ref|XP_003592239.1|  Serine carboxypeptidase-like protein               225   4e-67    
ref|NP_194790.1|  serine carboxypeptidase 24                            224   4e-67    
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    225   4e-67    
ref|XP_006830191.1|  hypothetical protein AMTR_s00173p00045470          225   5e-67    
gb|KJB07563.1|  hypothetical protein B456_001G032600                    225   5e-67    
gb|KHN05312.1|  Serine carboxypeptidase II-3                            225   5e-67    
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         225   5e-67    
gb|ACA61622.1|  hypothetical protein AP7_B10.2                          216   6e-67    
ref|XP_006593897.1|  PREDICTED: serine carboxypeptidase II-3-like       225   6e-67    
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          224   6e-67    
ref|XP_006595329.1|  PREDICTED: serine carboxypeptidase II-3-like       224   7e-67    
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          224   7e-67    
ref|XP_002520355.1|  serine carboxypeptidase, putative                  226   7e-67    
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         224   7e-67    
ref|XP_002282331.1|  PREDICTED: serine carboxypeptidase II-3-like       224   8e-67    
gb|KHN05141.1|  Serine carboxypeptidase II-3                            224   8e-67    
ref|XP_008654561.1|  PREDICTED: uncharacterized protein LOC100273...    224   9e-67    
ref|NP_001042076.1|  Os01g0158200                                       224   9e-67    
gb|EYU39590.1|  hypothetical protein MIMGU_mgv1a0101821mg               215   9e-67    
ref|NP_001047514.1|  Os02g0634700                                       224   9e-67    
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    224   9e-67    
gb|EEC73659.1|  hypothetical protein OsI_08191                          224   9e-67    
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         224   1e-66    
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         224   1e-66    
ref|XP_003592243.1|  Serine carboxypeptidase II-3                       224   1e-66    
ref|XP_008783276.1|  PREDICTED: serine carboxypeptidase II-3-like       224   1e-66    
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             224   1e-66    
ref|NP_001078615.1|  serine carboxypeptidase-like 34                    223   1e-66    
gb|KCW51318.1|  hypothetical protein EUGRSUZ_J00874                     223   1e-66    
ref|XP_006412683.1|  hypothetical protein EUTSA_v10025119mg             221   1e-66    
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             224   1e-66    
ref|NP_001150705.1|  LOC100284338 precursor                             224   1e-66    
dbj|BAB08188.1|  unnamed protein product                                224   1e-66    
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         223   1e-66    
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             223   1e-66    
gb|AES71591.2|  serine carboxypeptidase-like protein                    224   1e-66    
ref|XP_004502015.1|  PREDICTED: serine carboxypeptidase-like 40-like    224   1e-66    
ref|XP_009601275.1|  PREDICTED: serine carboxypeptidase-like 40         224   1e-66    
ref|XP_002463311.1|  hypothetical protein SORBIDRAFT_02g041610          224   2e-66    
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         223   2e-66    
ref|NP_186860.1|  serine carboxypeptidase-like 25                       223   2e-66    
dbj|BAK02399.1|  predicted protein                                      223   2e-66    
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    223   2e-66    
gb|ACF79757.1|  unknown                                                 223   2e-66    
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               223   2e-66    
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    223   2e-66    
gb|KDP38391.1|  hypothetical protein JCGZ_04316                         223   2e-66    
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    223   2e-66    
ref|XP_006354981.1|  PREDICTED: serine carboxypeptidase-like 34-like    223   2e-66    
dbj|BAJ94105.1|  predicted protein                                      224   2e-66    
gb|ACJ85847.1|  unknown                                                 218   2e-66    
ref|XP_009619884.1|  PREDICTED: serine carboxypeptidase 24-like         224   2e-66    
ref|XP_010906017.1|  PREDICTED: serine carboxypeptidase II-3-like       223   3e-66    
sp|P52711.1|CBP23_HORVU  RecName: Full=Serine carboxypeptidase II...    224   3e-66    
gb|AAM65698.1|  putative serine carboxypeptidase II                     223   3e-66    
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         223   3e-66    
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         223   3e-66    
gb|ABR16997.1|  unknown                                                 224   3e-66    
gb|ABR16596.1|  unknown                                                 224   3e-66    
gb|KDO75846.1|  hypothetical protein CISIN_1g0117382mg                  218   3e-66    
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         222   3e-66    
ref|XP_009777002.1|  PREDICTED: serine carboxypeptidase-like 40         223   4e-66    
ref|XP_006434836.1|  hypothetical protein CICLE_v10000968mg             223   4e-66    
ref|XP_009391583.1|  PREDICTED: serine carboxypeptidase II-3            223   4e-66    
ref|XP_006287580.1|  hypothetical protein CARUB_v10000790mg             223   4e-66    
ref|NP_851062.2|  serine carboxypeptidase-like 34                       223   4e-66    
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          222   4e-66    
ref|XP_003592238.1|  Serine carboxypeptidase II-3                       223   4e-66    
ref|XP_006473369.1|  PREDICTED: serine carboxypeptidase II-3-like       223   4e-66    
ref|XP_002876371.1|  predicted protein                                  223   5e-66    
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    222   5e-66    
ref|XP_003592237.1|  Serine carboxypeptidase II-3                       223   5e-66    
ref|XP_002872043.1|  SCPL34                                             223   5e-66    
ref|XP_002876119.1|  predicted protein                                  223   5e-66    
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         222   5e-66    
ref|XP_010041326.1|  PREDICTED: serine carboxypeptidase II-3-like       222   5e-66    
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    222   6e-66    
gb|KCW66184.1|  hypothetical protein EUGRSUZ_F00022                     222   6e-66    
gb|EPS67928.1|  hypothetical protein M569_06845                         221   6e-66    
ref|XP_009370170.1|  PREDICTED: serine carboxypeptidase II-3-like...    222   7e-66    
ref|XP_002316057.2|  serine carboxypeptidase S10 family protein         222   7e-66    
ref|XP_006346531.1|  PREDICTED: serine carboxypeptidase II-3-like       221   8e-66    
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             221   8e-66    
ref|XP_004231499.1|  PREDICTED: serine carboxypeptidase-like 34         221   9e-66    
ref|XP_011090479.1|  PREDICTED: serine carboxypeptidase II-3-like       221   9e-66    
ref|XP_009801012.1|  PREDICTED: serine carboxypeptidase II-3-like       222   9e-66    
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         221   1e-65    
ref|XP_009130122.1|  PREDICTED: serine carboxypeptidase-like 34         222   1e-65    
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    222   1e-65    
emb|CDY46950.1|  BnaA02g32960D                                          222   1e-65    
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             221   1e-65    
ref|XP_009370169.1|  PREDICTED: serine carboxypeptidase II-3-like...    221   1e-65    
ref|XP_010421120.1|  PREDICTED: serine carboxypeptidase-like 34         221   1e-65    
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    221   2e-65    
ref|XP_010493441.1|  PREDICTED: serine carboxypeptidase-like 34         221   2e-65    
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             221   2e-65    
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34-like    221   2e-65    
ref|XP_009400122.1|  PREDICTED: serine carboxypeptidase II-3-like       221   2e-65    
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         220   2e-65    
ref|XP_007035881.1|  Serine carboxypeptidase-like 33                    220   2e-65    
ref|XP_004508115.1|  PREDICTED: serine carboxypeptidase-like 33-like    221   2e-65    
gb|KEH32356.1|  serine carboxypeptidase-like protein                    221   2e-65    
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    221   2e-65    
ref|XP_010907374.1|  PREDICTED: serine carboxypeptidase-like 34         218   3e-65    
ref|XP_009397583.1|  PREDICTED: serine carboxypeptidase-like 34 i...    220   3e-65    
gb|EMT05424.1|  Serine carboxypeptidase II-3                            221   3e-65    
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    220   3e-65    
ref|XP_009397584.1|  PREDICTED: serine carboxypeptidase-like 34 i...    220   3e-65    
ref|XP_006662015.1|  PREDICTED: serine carboxypeptidase-like 34-like    220   3e-65    
ref|XP_010315498.1|  PREDICTED: serine carboxypeptidase II-3-like       221   3e-65    
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             220   3e-65    
ref|XP_003592240.1|  Serine carboxypeptidase-like protein               220   4e-65    
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               219   4e-65    
gb|KEH30582.1|  serine carboxypeptidase-like protein                    219   4e-65    
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    219   4e-65    
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             220   4e-65    
ref|XP_007224802.1|  hypothetical protein PRUPE_ppa023729mg             220   5e-65    
gb|ACN29008.1|  unknown                                                 221   5e-65    
dbj|BAJ99174.1|  predicted protein                                      219   5e-65    
ref|XP_003542323.2|  PREDICTED: serine carboxypeptidase-like 40-l...    220   5e-65    
ref|XP_008461353.1|  PREDICTED: serine carboxypeptidase-like 40         220   5e-65    
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                219   6e-65    
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                219   6e-65    
ref|XP_007220730.1|  hypothetical protein PRUPE_ppa023387mg             213   6e-65    
ref|XP_010454603.1|  PREDICTED: serine carboxypeptidase-like 34         220   6e-65    
ref|XP_006657371.1|  PREDICTED: serine carboxypeptidase-like 34-like    219   6e-65    
ref|XP_010231680.1|  PREDICTED: serine carboxypeptidase-like 33         219   6e-65    
ref|XP_003592242.1|  Serine carboxypeptidase-like protein               219   7e-65    
ref|XP_006346529.1|  PREDICTED: serine carboxypeptidase II-3-like       219   7e-65    
ref|XP_006434837.1|  hypothetical protein CICLE_v10003343mg             217   7e-65    
ref|XP_006394589.1|  hypothetical protein EUTSA_v10004057mg             219   7e-65    
ref|XP_002440854.1|  hypothetical protein SORBIDRAFT_09g008660          219   7e-65    
ref|XP_008652806.1|  PREDICTED: serine carboxypeptidase II-3-like       219   8e-65    
gb|AES71590.2|  serine carboxypeptidase-like protein                    219   9e-65    
ref|XP_006392051.1|  hypothetical protein EUTSA_v10023439mg             219   9e-65    
ref|NP_001147904.1|  serine carboxypeptidase 1 precursor                220   9e-65    
dbj|BAD19261.1|  putative serine carboxypeptidase II precursor          216   9e-65    
ref|XP_004135951.1|  PREDICTED: serine carboxypeptidase-like 40-like    219   1e-64    
ref|XP_006346530.1|  PREDICTED: serine carboxypeptidase II-3-like       219   1e-64    
ref|XP_006392050.1|  hypothetical protein EUTSA_v10023439mg             218   1e-64    
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    218   1e-64    
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         218   1e-64    
ref|XP_006853073.1|  hypothetical protein AMTR_s00038p00085900          219   1e-64    
ref|XP_003566409.1|  PREDICTED: serine carboxypeptidase II-1            218   1e-64    
ref|XP_006394590.1|  hypothetical protein EUTSA_v10004057mg             219   1e-64    
emb|CDM82001.1|  unnamed protein product                                218   1e-64    



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   314 bits (805),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 151/197 (77%), Positives = 169/197 (86%), Gaps = 2/197 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  227
            MS L WG L+F L   T +  G    +S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVNSNVVQKQLDKVTKLPGQGFNVNFENYAGYVTVN  60

Query  228  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            +ES RALFYWFFEAV+DPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNP
Sbjct  61   EESERALFYWFFEAVDDPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNP  120

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            YSWNLAANLLF+DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+YKGR+F
Sbjct  121  YSWNLAANLLFLDSPVGVGYSYSNTSSDHLNNGDARTAADSLAFLLKWLERFPEYKGRDF  180

Query  588  YITGESYAGHYVPQLSQ  638
            YITGESYAGHYVPQLSQ
Sbjct  181  YITGESYAGHYVPQLSQ  197



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/197 (76%), Positives = 168/197 (85%), Gaps = 2/197 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKG--SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  227
            MS L WG L+F L   T +  G     S+V Q++LD V  LPG GFNV+F +Y+GYVTVN
Sbjct  1    MSNLKWGFLVFALFFITEVHLGSCFVDSNVVQKQLDKVSKLPGQGFNVNFENYAGYVTVN  60

Query  228  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            +ES RALFYWFFEAV++PSSKPLVLWLNGGPGCSSIA+GLAEE+GPFH+EKDGKTLYWNP
Sbjct  61   EESERALFYWFFEAVDEPSSKPLVLWLNGGPGCSSIAYGLAEELGPFHIEKDGKTLYWNP  120

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            YSWNLAANLLF+DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+YKGR+F
Sbjct  121  YSWNLAANLLFLDSPVGVGYSYSNTSSDHLNNGDARTAADSLAFLLKWLERFPEYKGRDF  180

Query  588  YITGESYAGHYVPQLSQ  638
            YITGESYAGHYVPQLSQ
Sbjct  181  YITGESYAGHYVPQLSQ  197



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 163/186 (88%), Gaps = 0/186 (0%)
 Frame = +3

Query  81   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            +FV+L   SI G    +   Q++LD V  LPG GFNV+FAHYSGYVTVN++S RALFYWF
Sbjct  7    VFVVLGLFSISGSFSVNPNAQKQLDRVSKLPGQGFNVNFAHYSGYVTVNEDSERALFYWF  66

Query  261  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  440
            FEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLAAN+LF
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIEKDGKTLYWNPYSWNLAANVLF  126

Query  441  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  620
            +DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+YKGR+FYI+GESYAGHY
Sbjct  127  LDSPVGVGYSYSNTSSDHLNNGDARTAADSLVFLLKWLERFPEYKGRDFYISGESYAGHY  186

Query  621  VPQLSQ  638
            VPQLSQ
Sbjct  187  VPQLSQ  192



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 161/186 (87%), Gaps = 0/186 (0%)
 Frame = +3

Query  81   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            +FV+L    I G    +   Q+ LD V  LPG GFNV+FAHYSGYVTVN+ES RALFYWF
Sbjct  7    VFVVLGLFFISGSFSVTPNAQKLLDRVSKLPGQGFNVNFAHYSGYVTVNEESERALFYWF  66

Query  261  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  440
            FEAV+DPSSKPLVLWLNGGPGCSSIAFGLAEE+GPFH+EKDGKTLYWNPYSWNLAAN+LF
Sbjct  67   FEAVDDPSSKPLVLWLNGGPGCSSIAFGLAEELGPFHIEKDGKTLYWNPYSWNLAANVLF  126

Query  441  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  620
            +DSP GVGYSYSNTSSD L +GD RTA DSL FLLKW ERFP+YKGREFYI+GESYAGHY
Sbjct  127  LDSPVGVGYSYSNTSSDHLNNGDTRTAADSLVFLLKWLERFPEYKGREFYISGESYAGHY  186

Query  621  VPQLSQ  638
            VPQLSQ
Sbjct  187  VPQLSQ  192



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   301 bits (770),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/203 (71%), Positives = 170/203 (84%), Gaps = 8/203 (4%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATS---IDGGKG-----SSSVDQQKLDAVLDLPGLGFNVSFAHYS  209
            MS  +W   L +++L +    I  G G     +SS +QQ+LD V  LPG  FNVSFAHYS
Sbjct  1    MSTFNWVFNLVLVILISELHLISCGAGLSSSKNSSYEQQQLDRVSKLPGQSFNVSFAHYS  60

Query  210  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  389
            GY TVN+ESGRALFYWFFEA  DPSSKP+VLWLNGGPGCSS+AFGLAEE+GPFH+EKDGK
Sbjct  61   GYATVNKESGRALFYWFFEAEVDPSSKPIVLWLNGGPGCSSVAFGLAEEIGPFHIEKDGK  120

Query  390  TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQ  569
            ++Y NPYSWN AAN+LF+DSPAGVG+SYSNTSSD+ T+GDKRTA ++LEFLL+WF+RFPQ
Sbjct  121  SIYLNPYSWNKAANILFLDSPAGVGFSYSNTSSDLFTNGDKRTAAENLEFLLQWFKRFPQ  180

Query  570  YKGREFYITGESYAGHYVPQLSQ  638
            YKG +FYITGESYAGHYVPQLSQ
Sbjct  181  YKGNDFYITGESYAGHYVPQLSQ  203



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   300 bits (768),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 163/201 (81%), Gaps = 5/201 (2%)
 Frame = +3

Query  51   EMSALSWGCLLFVLL-----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGY  215
            EM  L     +F+L      +  S+     +  V QQ LD VL+LPG  FN+SFAHYSGY
Sbjct  7    EMGLLQLFITIFLLFSVNLYVGASVFESTLTDPVAQQGLDRVLELPGQTFNISFAHYSGY  66

Query  216  VTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  395
            VTVNQESGR LFYWF EAVEDP SKPL+LWLNGGPGCSSIA+G AEE+GPFH+++DGKTL
Sbjct  67   VTVNQESGRNLFYWFMEAVEDPDSKPLILWLNGGPGCSSIAYGEAEEIGPFHIQRDGKTL  126

Query  396  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYK  575
            Y NPYSWN  ANLLFVDSP GVG+SYSNTSSD+L +GDKRTA DSL FLLKWFERFPQ+K
Sbjct  127  YLNPYSWNQVANLLFVDSPVGVGFSYSNTSSDLLNNGDKRTAADSLAFLLKWFERFPQFK  186

Query  576  GREFYITGESYAGHYVPQLSQ  638
            GR+FYITGESYAGHYVPQLSQ
Sbjct  187  GRDFYITGESYAGHYVPQLSQ  207



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   299 bits (765),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 166/200 (83%), Gaps = 5/200 (3%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSID--GGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYV  218
            M+ L+W   L +++    +     + S S D   QQ LD VL LPG  FNVSFAHY+GYV
Sbjct  1    MTTLNWVFNLSLIICVAKLHFISCRASFSPDPPNQQLLDRVLKLPGQNFNVSFAHYAGYV  60

Query  219  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  398
            TVN+ESGRALFYWFFEA EDPSSKPLVLWLNGGPGCSSIA+GLAEE+GPFHVEKDGKTLY
Sbjct  61   TVNKESGRALFYWFFEADEDPSSKPLVLWLNGGPGCSSIAYGLAEEIGPFHVEKDGKTLY  120

Query  399  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  578
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD L +GDKRTA D+LEFLL+WFERFPQY+G
Sbjct  121  LNPYSWNKVANILFLDSPVGVGFSYSNTSSDSLNNGDKRTATDNLEFLLQWFERFPQYRG  180

Query  579  REFYITGESYAGHYVPQLSQ  638
             +FYITGESYAGHYVPQLSQ
Sbjct  181  SDFYITGESYAGHYVPQLSQ  200



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/196 (72%), Positives = 163/196 (83%), Gaps = 1/196 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  230
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  231  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
             SGRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  61   NSGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  120

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            SWN  AN+LF+DSP GVG+SYSNTSSD+ T+GD RTA+DSL FLLKWFERFPQYKGR+FY
Sbjct  121  SWNQVANILFLDSPVGVGFSYSNTSSDVSTNGDIRTAKDSLAFLLKWFERFPQYKGRDFY  180

Query  591  ITGESYAGHYVPQLSQ  638
            ITGESYAGHYVPQLSQ
Sbjct  181  ITGESYAGHYVPQLSQ  196



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 165/200 (83%), Gaps = 5/200 (3%)
 Frame = +3

Query  54   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  218
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  219  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  398
            TVN++SGRALFYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  399  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  578
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD+L++GDKRTAEDSL FLLKWFERFPQYKG
Sbjct  121  LNPYSWNQVANILFLDSPVGVGFSYSNTSSDLLSNGDKRTAEDSLAFLLKWFERFPQYKG  180

Query  579  REFYITGESYAGHYVPQLSQ  638
            REFYITGESY GHYVPQLSQ
Sbjct  181  REFYITGESYGGHYVPQLSQ  200



>ref|XP_006453576.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66816.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=352

 Score =   292 bits (747),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 158/188 (84%), Gaps = 6/188 (3%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ERF Q+KGR+FYI+GESY G
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYISGESYGG  191

Query  615  HYVPQLSQ  638
            HYVPQLS+
Sbjct  192  HYVPQLSK  199



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 165/200 (83%), Gaps = 5/200 (3%)
 Frame = +3

Query  54   MSALSWGCLL--FVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYV  218
            M   SW  +L  F++LL     S+     + ++ QQKLD VL+LPG  FN+SFAHY+GY 
Sbjct  1    MVKPSWAFVLTYFIILLNLHLGSVFATIPTDALAQQKLDKVLELPGQTFNLSFAHYAGYA  60

Query  219  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  398
            TVN++SGRALFYW  EA EDP SKP+VLWLNGGPGCSSIA+G AEEVGPFH++ DGKTLY
Sbjct  61   TVNEDSGRALFYWLVEAAEDPGSKPIVLWLNGGPGCSSIAYGEAEEVGPFHIKADGKTLY  120

Query  399  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  578
             NPYSWN  AN+LF+DSP GVG+SYSNTSSD+L++GDKRTAEDSL FLLKWFERFPQYKG
Sbjct  121  LNPYSWNQVANILFLDSPVGVGFSYSNTSSDLLSNGDKRTAEDSLAFLLKWFERFPQYKG  180

Query  579  REFYITGESYAGHYVPQLSQ  638
            REFYITGESY GHYVPQLSQ
Sbjct  181  REFYITGESYGGHYVPQLSQ  200



>ref|XP_010531651.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=204

 Score =   285 bits (728),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
             L+F  LLA +  G    SS  +Q+ D V  LPG GFNVSFAHYSGYVTV+++SGRALFY
Sbjct  12   ALIFFTLLANAHLGNCALSS--RQEQDRVSKLPGQGFNVSFAHYSGYVTVHEKSGRALFY  69

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            WFFEAVEDP SKPL+LWLNGGPGCSSI +GLAEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  70   WFFEAVEDPDSKPLLLWLNGGPGCSSIGYGLAEEIGPFHIKPDGKTLYLNPYSWNQVANV  129

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+D P GVG+SYSNTSSD+LT+GDKRTA+DSL+FLLKW +RFP+YK R+FYI GESY G
Sbjct  130  LFLDMPVGVGFSYSNTSSDLLTNGDKRTAQDSLKFLLKWLDRFPKYKERDFYIAGESYGG  189

Query  615  HYVPQLSQ  638
            HY+PQLSQ
Sbjct  190  HYIPQLSQ  197



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 159/189 (84%), Gaps = 1/189 (1%)
 Frame = +3

Query  75   CLLFVLLLAT-SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  251
            CL+ +L L   S+     ++   QQKLD V +LPG  FN+SFAH+SGYV VN+E+GRALF
Sbjct  12   CLIILLNLHLGSVFSAPPANPFAQQKLDRVAELPGQSFNLSFAHFSGYVPVNEETGRALF  71

Query  252  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
            YWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY NPYSWN  AN
Sbjct  72   YWFVEAAEDPHSKPIVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLYLNPYSWNQVAN  131

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            +LF DSP GVG+SYSNTSSD+L++GDKRTA DSL FLLKWFERFPQYKGR+FYITGESY 
Sbjct  132  VLFFDSPVGVGFSYSNTSSDLLSNGDKRTANDSLTFLLKWFERFPQYKGRDFYITGESYG  191

Query  612  GHYVPQLSQ  638
            GHYVPQLSQ
Sbjct  192  GHYVPQLSQ  200



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 165/201 (82%), Gaps = 8/201 (4%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSS---SVD---QQKLDAVLDLPGLGFNVSFAHYSGY  215
            M+ L+W  +L +L+    ID    SS   S D   QQ+LD VL LPG  FNVSFAHY+G+
Sbjct  1    MATLNW--VLVILISTLLIDLTNCSSCGFSADPYAQQQLDRVLHLPGQNFNVSFAHYAGF  58

Query  216  VTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  395
            VTVN+E+GR LFYWFFEA EDP+SKPLVLWLNGGPGCSSIA+G+AEE+GPFHVEKDGK L
Sbjct  59   VTVNEEAGRTLFYWFFEAAEDPASKPLVLWLNGGPGCSSIAYGVAEEIGPFHVEKDGKHL  118

Query  396  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYK  575
            Y NPYSWN AAN+LF+DSP GVGYSYSNT SD L +GD RTA DS  FLLKWF+RFPQYK
Sbjct  119  YLNPYSWNQAANMLFLDSPVGVGYSYSNTPSDHLNNGDLRTAADSHAFLLKWFDRFPQYK  178

Query  576  GREFYITGESYAGHYVPQLSQ  638
            GR+FYI+GESYAGHYVPQLSQ
Sbjct  179  GRDFYISGESYAGHYVPQLSQ  199



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   293 bits (749),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/166 (82%), Positives = 149/166 (90%), Gaps = 0/166 (0%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            QQ+LD V +LPG  FNVSFAHYSGYVTVN+ESGRALFYWF EAVEDP+SKPLVLWLNGGP
Sbjct  40   QQELDRVWELPGQNFNVSFAHYSGYVTVNEESGRALFYWFIEAVEDPASKPLVLWLNGGP  99

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSSI FG AEE+GPFH+  DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTSSD++ 
Sbjct  100  GCSSIGFGEAEEIGPFHIHADGKTLYLNPYSWNQVANILFIDSPVGVGFSYSNTSSDLVN  159

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +GDKRTA DSL FLLKW ERFPQYKGR+FYITGESYAGHYVPQLSQ
Sbjct  160  NGDKRTAADSLIFLLKWVERFPQYKGRDFYITGESYAGHYVPQLSQ  205



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   292 bits (747),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 166/196 (85%), Gaps = 3/196 (2%)
 Frame = +3

Query  60   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  230
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  2    ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  61

Query  231  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
             +GRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  62   YTGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  121

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            SWN AAN+LF+D P GVG+SYSN+S DI ++GD RTA+DSL+FLL+WFERFPQYKGR+FY
Sbjct  122  SWNQAANILFLDFPVGVGFSYSNSSFDISSNGDLRTAKDSLKFLLEWFERFPQYKGRDFY  181

Query  591  ITGESYAGHYVPQLSQ  638
            ITGESYAGHYVPQLSQ
Sbjct  182  ITGESYAGHYVPQLSQ  197



>gb|KDO62275.1| hypothetical protein CISIN_1g0418332mg, partial [Citrus sinensis]
Length=320

 Score =   286 bits (732),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFYWF EAVEDP SKPLVLWLNG
Sbjct  67   VAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLWLNG  126

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTSSDI
Sbjct  127  GPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGFSYSNTSSDI  186

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             T+GDKRTAEDSL+FLLKW ERF Q+KGR+FYI+GESY GHYVPQLS+
Sbjct  187  TTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYISGESYGGHYVPQLSK  234



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   291 bits (746),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 158/188 (84%), Gaps = 6/188 (3%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ERF Q+KGR+FYI+GESY G
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYISGESYGG  191

Query  615  HYVPQLSQ  638
            HYVPQLS+
Sbjct  192  HYVPQLSK  199



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   292 bits (748),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 166/196 (85%), Gaps = 3/196 (2%)
 Frame = +3

Query  60   ALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  230
            ALS   +  V +L T I+  + +SS D   QQ+LD VL LPG  FN+SFAHY+GYVTVN+
Sbjct  42   ALSPKWVFVVQILLTLINLNRATSSSDPLVQQELDKVLQLPGQTFNISFAHYAGYVTVNE  101

Query  231  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
             +GRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  102  YTGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  161

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            SWN AAN+LF+D P GVG+SYSN+S DI ++GD RTA+DSL+FLL+WFERFPQYKGR+FY
Sbjct  162  SWNQAANILFLDFPVGVGFSYSNSSFDISSNGDLRTAKDSLKFLLEWFERFPQYKGRDFY  221

Query  591  ITGESYAGHYVPQLSQ  638
            ITGESYAGHYVPQLSQ
Sbjct  222  ITGESYAGHYVPQLSQ  237



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            QQ+LD VL+LPG  FNVSFAHY+GYVTVN+ SGRALFYWFFEAVEDPSSKPLVLWLNGGP
Sbjct  48   QQQLDRVLELPGQTFNVSFAHYAGYVTVNEASGRALFYWFFEAVEDPSSKPLVLWLNGGP  107

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSSIA+G AEE+GPFH++ DGKTLY N YSWN  AN+LF++SP GVG+SYSN S D+L 
Sbjct  108  GCSSIAYGEAEEIGPFHIKADGKTLYLNQYSWNQVANVLFLESPVGVGFSYSNNSLDVLN  167

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +GDKRTAEDSL FLLKWFERFPQYKGR+FYITGESYAGHYVPQL+Q
Sbjct  168  NGDKRTAEDSLMFLLKWFERFPQYKGRDFYITGESYAGHYVPQLAQ  213



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 159/188 (85%), Gaps = 3/188 (2%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
             L+F+ LLA   +   G   + +Q+ D V  LPG  FNV+F HYSG+VTVN++ GRALFY
Sbjct  17   ALIFLTLLA---NAHLGICVLSRQQQDKVSKLPGQDFNVNFEHYSGFVTVNEKLGRALFY  73

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            WFFEAVEDP SKPLVLWLNGGPGCSSIAFGLAEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  74   WFFEAVEDPDSKPLVLWLNGGPGCSSIAFGLAEEIGPFHIKPDGKTLYLNPYSWNQVANV  133

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL+FLLKW ERFP+YKGREFYI GESY G
Sbjct  134  LFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLKFLLKWLERFPKYKGREFYIAGESYGG  193

Query  615  HYVPQLSQ  638
            HYVPQLSQ
Sbjct  194  HYVPQLSQ  201



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLWLNG  97

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGYSYSNTSSDL  157

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            L +GDK+TA DSL FLL WFERFPQYKGR+FYITGESYAGHYVPQLSQ
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYITGESYAGHYVPQLSQ  205



>ref|XP_011018072.1| PREDICTED: serine carboxypeptidase-like 29 isoform X2 [Populus 
euphratica]
Length=410

 Score =   288 bits (738),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+L LNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLRLNG  97

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSPAGVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPAGVGYSYSNTSSDL  157

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            L +GDK+TA DSL FLL WFERFPQYKGR+FYITGESYAGHYVPQLSQ
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYITGESYAGHYVPQLSQ  205



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 158/188 (84%), Gaps = 6/188 (3%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C++F L  A S D       V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFY
Sbjct  18   CIIFYLGSAFSTD------PVAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFY  71

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            WF EAVEDP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+
Sbjct  72   WFVEAVEDPDSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANI  131

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+DSP GVG+SYSNTSSDI T+GDKRTAEDSL+FLLKW ERF Q+KGR+FYI+GESY G
Sbjct  132  LFLDSPVGVGFSYSNTSSDITTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYISGESYGG  191

Query  615  HYVPQLSQ  638
            HYVPQLS+
Sbjct  192  HYVPQLSK  199



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   290 bits (742),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLWLNG  97

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGYSYSNTSSDL  157

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            L +GDK+TA DSL FLL WFERFPQYKGR+FYITGESYAGHYVPQLSQ
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYITGESYAGHYVPQLSQ  205



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   290 bits (741),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 133/172 (77%), Positives = 154/172 (90%), Gaps = 0/172 (0%)
 Frame = +3

Query  123  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVL  302
            G+S+ ++Q+ D VL LPG  FNVSFAHYSGYVTV+ + GRALFYWFFEAVEDP+SKPLVL
Sbjct  28   GASAFERQEKDRVLRLPGQSFNVSFAHYSGYVTVDDDPGRALFYWFFEAVEDPASKPLVL  87

Query  303  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  482
            WLNGGPGCSSIA+GLAEE+GPFH+  DGK+LY NPY+WN  AN+LF+DSP GVG+SYSN 
Sbjct  88   WLNGGPGCSSIAYGLAEELGPFHINADGKSLYLNPYTWNQVANILFLDSPVGVGFSYSNN  147

Query  483  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            S D+LT+GDKRTA+DSL FL KWF+RFPQYKGREFYITGESYAGHYVPQL+Q
Sbjct  148  SQDVLTNGDKRTAKDSLTFLKKWFKRFPQYKGREFYITGESYAGHYVPQLAQ  199



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   290 bits (741),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 161/200 (81%), Gaps = 5/200 (3%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSS-----VDQQKLDAVLDLPGLGFNVSFAHYSGYV  218
            M+   W   L VL++  ++  G   S+     + QQ LD V  LPG  FN+SFAH+SGYV
Sbjct  1    MAKPRWDSALKVLIILLNLHLGSVFSAPPADPIAQQNLDRVAXLPGQSFNLSFAHFSGYV  60

Query  219  TVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  398
             VN++SGRALFYWF EA EDP SKP+VLWLNGGPGCSSIA+G+AEE+GPFH+E DGKTLY
Sbjct  61   PVNEDSGRALFYWFVEAAEDPHSKPVVLWLNGGPGCSSIAYGMAEEIGPFHIEADGKTLY  120

Query  399  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  578
             NPYSWN  AN+LF DSP GVG+SYSNTSSD+L++GDKRTA DSL FLL+WFERFPQYKG
Sbjct  121  LNPYSWNQVANVLFFDSPVGVGFSYSNTSSDLLSNGDKRTANDSLTFLLQWFERFPQYKG  180

Query  579  REFYITGESYAGHYVPQLSQ  638
            R+FYITGESY GHYVPQLSQ
Sbjct  181  RDFYITGESYGGHYVPQLSQ  200



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   288 bits (737),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 160/186 (86%), Gaps = 3/186 (2%)
 Frame = +3

Query  81   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  261  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  440
            FEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSWN AAN+LF
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSWNQAANILF  133

Query  441  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  620
            +DSP GVG+SYSN S D+L++GD+RTA+DSL FL KWFERFPQYKG++FY+TGESYAGHY
Sbjct  134  LDSPVGVGFSYSNNSQDVLSNGDERTAKDSLVFLKKWFERFPQYKGQDFYLTGESYAGHY  193

Query  621  VPQLSQ  638
            VPQL+Q
Sbjct  194  VPQLAQ  199



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   289 bits (739),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 136/190 (72%), Positives = 160/190 (84%), Gaps = 5/190 (3%)
 Frame = +3

Query  84   FVLLLATSIDGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  248
            FVL+   ++  G   ++V      QQ+LD V  LPG  FNVSFAHY+GYV VN+++GRAL
Sbjct  8    FVLIFLLNLHLGSVFATVPTDPLVQQQLDRVHGLPGQTFNVSFAHYAGYVNVNEDAGRAL  67

Query  249  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            FYWF EA EDP+SKPLVLWLNGGPGCSSIA+G+AEEVGPFH++ DGKTLY NPYSWN  A
Sbjct  68   FYWFVEAAEDPTSKPLVLWLNGGPGCSSIAYGMAEEVGPFHIQADGKTLYLNPYSWNQVA  127

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            N+LF+DSP GVG+SYSNTSSD++++GDKRTA DSL FLLKW ER+PQYKGR+FYITGESY
Sbjct  128  NILFLDSPVGVGFSYSNTSSDLMSNGDKRTASDSLAFLLKWLERYPQYKGRDFYITGESY  187

Query  609  AGHYVPQLSQ  638
            AGHYVPQLSQ
Sbjct  188  AGHYVPQLSQ  197



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   288 bits (736),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            V QQKLD V  LPG  FNV+FAHYSGYVTVN+ESGRALFYWF EAVEDP SKPLVLWLNG
Sbjct  32   VAQQKLDRVGKLPGQNFNVNFAHYSGYVTVNEESGRALFYWFVEAVEDPDSKPLVLWLNG  91

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSSIA+G AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSP GVG+SYSNTSSDI
Sbjct  92   GPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPVGVGFSYSNTSSDI  151

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             T+GDKRTAEDSL+FLLKW ERF Q+KGR+FYI+GESY GHYVPQLS+
Sbjct  152  TTNGDKRTAEDSLKFLLKWLERFSQFKGRDFYISGESYGGHYVPQLSK  199



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   288 bits (736),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 150/168 (89%), Gaps = 0/168 (0%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            V QQ LD VL LPG  F+V+FAHYSGYVTVN++ GRALFYWF EAVEDP SKPL+L LNG
Sbjct  38   VAQQHLDRVLKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWFVEAVEDPQSKPLLLRLNG  97

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN  AN+LF+DSPAGVGYSYSNTSSD+
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQVANILFLDSPAGVGYSYSNTSSDL  157

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            L +GDK+TA DSL FLL WFERFPQYKGR+FYITGESYAGHYVPQLSQ
Sbjct  158  LNNGDKKTAADSLAFLLNWFERFPQYKGRDFYITGESYAGHYVPQLSQ  205



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 160/186 (86%), Gaps = 3/186 (2%)
 Frame = +3

Query  81   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            L   + +  +DGG   S  + Q+ D VL LPG  FNVSFAHY+GYVTVN++SGRALFYWF
Sbjct  17   LLFFVFSADVDGG---SPFECQERDRVLHLPGQSFNVSFAHYAGYVTVNEDSGRALFYWF  73

Query  261  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  440
            FEAVEDP+SKPLVLWLNGGPGCSSIA+GLAEE+GPFHV  +GK+LY NPYSWN AAN+LF
Sbjct  74   FEAVEDPASKPLVLWLNGGPGCSSIAYGLAEELGPFHVNANGKSLYLNPYSWNQAANILF  133

Query  441  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  620
            +DSP GVG+SYSN S D+L++GD+RTA+DSL FL KWFERFPQYKG++FY+TGESYAGHY
Sbjct  134  LDSPVGVGFSYSNNSQDVLSNGDERTAKDSLVFLKKWFERFPQYKGQDFYLTGESYAGHY  193

Query  621  VPQLSQ  638
            VPQL+Q
Sbjct  194  VPQLAQ  199



>gb|KJB76660.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=407

 Score =   285 bits (728),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = +3

Query  84   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  263
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  264  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  443
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN  AN+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVANILFL  138

Query  444  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  623
            +SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ERFPQYK R+FYI GESYAGHYV
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLERFPQYKERDFYIAGESYAGHYV  198

Query  624  PQLSQ  638
            PQLSQ
Sbjct  199  PQLSQ  203



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 159/189 (84%), Gaps = 4/189 (2%)
 Frame = +3

Query  72   GCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  251
            G   F+L+LA+S++    +S  +QQ  + VL LPG  F+VSFAHYSGYVTVN+E+GRA F
Sbjct  17   GPFFFLLVLASSLE----ASVFEQQARERVLRLPGQSFDVSFAHYSGYVTVNEEAGRAFF  72

Query  252  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
            YWFFEA E+P+SKPLVLWLNGGPGCSSI  GLAEEVGPFHV  DGK+LY NPYSWN  AN
Sbjct  73   YWFFEATEEPASKPLVLWLNGGPGCSSIGLGLAEEVGPFHVNADGKSLYPNPYSWNQVAN  132

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            +LF+DSP G G++YSN S D+LT+GDKRTA+D+L FL +WF+RFPQYKGR+FYITGESYA
Sbjct  133  ILFLDSPVGAGFAYSNNSQDVLTNGDKRTAKDNLTFLKRWFKRFPQYKGRDFYITGESYA  192

Query  612  GHYVPQLSQ  638
            GHYVPQL+Q
Sbjct  193  GHYVPQLAQ  201



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 160/195 (82%), Gaps = 1/195 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  233
            M+     CL  + +LA +       + + Q++ D V  LPG  FNVSFAHYSGYVT N++
Sbjct  1    MAKTRGSCLFAITILAIA-HFCNCEAVLSQKEQDKVSTLPGQDFNVSFAHYSGYVTTNEK  59

Query  234  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  413
             GRALFYWFFEAVED +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAVEDANSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYS  119

Query  414  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  593
            WN AAN+LF+D+P GVGYSYSNTSSD+L++GDKRTA+DSL+FLLKW ERFP+YKGREFYI
Sbjct  120  WNQAANILFLDAPVGVGYSYSNTSSDLLSNGDKRTAQDSLKFLLKWVERFPEYKGREFYI  179

Query  594  TGESYAGHYVPQLSQ  638
             GESYAGHY+PQLS+
Sbjct  180  VGESYAGHYIPQLSE  194



>ref|XP_006387151.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
 gb|ERP46065.1| hypothetical protein POPTR_1689s00200g [Populus trichocarpa]
Length=324

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/174 (76%), Positives = 148/174 (85%), Gaps = 6/174 (3%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            V QQ LD V  LPG  F+V+FAHYSGYVTVN++ GRALFYW  EAVEDP SKPL+LWLNG
Sbjct  38   VAQQHLDRVQKLPGQNFDVNFAHYSGYVTVNEKYGRALFYWLVEAVEDPQSKPLLLWLNG  97

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN------LAANLLFVDSPAGVGYSYS  476
            GPGCSSIA+G+AEE+GPFH++ DGKTLY NPYSWN        AN+LF+DSP GVGYSYS
Sbjct  98   GPGCSSIAYGMAEEIGPFHIKPDGKTLYLNPYSWNQYFNQFAVANILFLDSPVGVGYSYS  157

Query  477  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            NTSSD+L +GDK+TA DSL FLL WFERFPQYKGR+FYITGESYAGHYVPQLSQ
Sbjct  158  NTSSDLLNNGDKKTAADSLAFLLNWFERFPQYKGRDFYITGESYAGHYVPQLSQ  211



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LFYWF EA EDP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSSIA+G+AEE+GPFH+  D  +LY NPYSWNL ANLLF+DSP GVG+SYSNTSSD+L 
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSWNLVANLLFIDSPVGVGFSYSNTSSDLLN  154

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +GDKRTAEDSL FLLKWFERFPQ+KGREFYITGESY GHYVPQLS+
Sbjct  155  NGDKRTAEDSLAFLLKWFERFPQFKGREFYITGESYGGHYVPQLSK  200



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   285 bits (729),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            QQ+LD VL+LPG  FN+SF HYSGY TVN+ESGR+LFYWF EA EDP SKPLVLWLNGGP
Sbjct  36   QQELDRVLELPGQSFNISFPHYSGYATVNEESGRSLFYWFTEAAEDPDSKPLVLWLNGGP  95

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSSIA+G+AEE+GPFH+  D  +LY NPYSWNL ANLLF+DSP GVG+SYSNTSSD+L 
Sbjct  96   GCSSIAYGMAEEIGPFHIRPD-MSLYLNPYSWNLVANLLFIDSPVGVGFSYSNTSSDLLN  154

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +GDKRTAEDSL FLLKWFERFPQ+KGREFYITGESY GHYVPQLS+
Sbjct  155  NGDKRTAEDSLAFLLKWFERFPQFKGREFYITGESYGGHYVPQLSK  200



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   285 bits (729),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 160/196 (82%), Gaps = 12/196 (6%)
 Frame = +3

Query  75   CLLFVLLLATSI--------DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  230
            CLLF++ L   +        D  +G+S V+    D VL LPG  F+VSFAHYSGYVTVN+
Sbjct  7    CLLFLIHLHIFLQVKGTIVEDEDRGASQVN----DRVLKLPGQAFDVSFAHYSGYVTVNK  62

Query  231  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
            E+GRALFYWFFEAV+DPSSKPLV+WLNGGPGCSSIA+G AEE+GPFH+  DGKTLY NP 
Sbjct  63   EAGRALFYWFFEAVDDPSSKPLVVWLNGGPGCSSIAYGEAEEIGPFHIRPDGKTLYLNPD  122

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            SWN  ANLLFVDSP GVG+SYSNTS DI+++GDKRTAEDSL FL  W +RFPQYKGR+FY
Sbjct  123  SWNQVANLLFVDSPVGVGFSYSNTSEDIISNGDKRTAEDSLAFLHNWLKRFPQYKGRDFY  182

Query  591  ITGESYAGHYVPQLSQ  638
            +TGESYAGHYVPQL+Q
Sbjct  183  LTGESYAGHYVPQLAQ  198



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   284 bits (727),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSSIA+G AEE+GPFH+  DGK++Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAYGEAEEIGPFHINADGKSVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +GDKRTAEDSL FLLKWFERFPQ+KGR+FYITGESY GHYVPQLSQ
Sbjct  152  NGDKRTAEDSLAFLLKWFERFPQFKGRDFYITGESYGGHYVPQLSQ  197



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = +3

Query  84   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  263
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNEHSGRALFYWFF  78

Query  264  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  443
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN  AN+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVANILFL  138

Query  444  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  623
            +SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ERFPQYK R+FYI GESYAGHYV
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLERFPQYKERDFYIAGESYAGHYV  198

Query  624  PQLSQ  638
            PQLSQ
Sbjct  199  PQLSQ  203



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSSIA+G AEE+GPFH+  DGK +Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAYGEAEEIGPFHINADGKPVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +GDKRTAEDSL FLLKWFERFPQ+KGR+FYITGESY GHYVPQLSQ
Sbjct  152  NGDKRTAEDSLAFLLKWFERFPQFKGRDFYITGESYGGHYVPQLSQ  197



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   283 bits (723),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNGGP
Sbjct  32   QQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNGGP  91

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSSIAFG AEE+GPFH+  DGK++Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD++ 
Sbjct  92   GCSSIAFGEAEEIGPFHINADGKSVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDLMN  151

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +GDKRTAEDSL FLLKWFERFPQ+KG +FYITGESY GHYVPQLSQ
Sbjct  152  NGDKRTAEDSLAFLLKWFERFPQFKGSDFYITGESYGGHYVPQLSQ  197



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            + QQ+LD + +LPG  F V F HYSGY+TVN+ESGRALFYWFFEA ED +SKPLVLWLNG
Sbjct  104  LRQQELDRIAELPGQNFEVKFGHYSGYITVNEESGRALFYWFFEATEDSASKPLVLWLNG  163

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSSIA+G AEE+GPFH+  DGK +Y NPYSWN  AN+LF+DSPAGVG+SYSNTSSD+
Sbjct  164  GPGCSSIAYGEAEEIGPFHINADGKPVYLNPYSWNEVANVLFLDSPAGVGFSYSNTSSDL  223

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            + +GDKRTAEDSL FLLKWFERFPQ+KGR+FYITGESY GHYVPQLSQ
Sbjct  224  MNNGDKRTAEDSLAFLLKWFERFPQFKGRDFYITGESYGGHYVPQLSQ  271



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   282 bits (721),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 153/182 (84%), Gaps = 5/182 (3%)
 Frame = +3

Query  93   LLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAV  272
            ++ATS++      SV QQKLD V  LPG  FNVSFAHY+GYVTVN+ SGRALFYWFFEA 
Sbjct  27   VIATSLE-----DSVAQQKLDKVPKLPGQNFNVSFAHYAGYVTVNEGSGRALFYWFFEAA  81

Query  273  EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSP  452
            EDP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  ANLLF++SP
Sbjct  82   EDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTLYLNPYSWNKVANLLFLESP  141

Query  453  AGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQL  632
             GVG+SYSNTS D+L +GDKRTA+DSL FLLKW ERFPQYK R+FYI GESY GHYVPQL
Sbjct  142  IGVGFSYSNTSFDLLNNGDKRTAKDSLAFLLKWLERFPQYKERDFYIAGESYGGHYVPQL  201

Query  633  SQ  638
            SQ
Sbjct  202  SQ  203



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = +3

Query  120  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLV  299
             G S   +Q+ D V  LPG  FNVSFAHY+GYVTVN++SGRALFYWFFEAVEDP SKPLV
Sbjct  25   NGGSPFVRQEGDRVQRLPGQSFNVSFAHYAGYVTVNEDSGRALFYWFFEAVEDPVSKPLV  84

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+GLAEEVGPFHV  DG++LY NPYSWN  AN+LF+DSP GVG+SYSN
Sbjct  85   LWLNGGPGCSSIAYGLAEEVGPFHVNADGQSLYLNPYSWNQVANILFLDSPVGVGFSYSN  144

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             S D+L++GD+RTA+DSL FL KWFERFPQYKG++FY+TGESYAGHYVPQL+Q
Sbjct  145  NSQDVLSNGDERTAKDSLIFLKKWFERFPQYKGQDFYLTGESYAGHYVPQLAQ  197



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 156/187 (83%), Gaps = 2/187 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            L+ + LLAT+    +   S  +Q  D V  LPG  FNVSFAHYSG++T N++ GRALFYW
Sbjct  13   LIAIALLATTAHLCEAGLSRKEQ--DKVSKLPGQNFNVSFAHYSGFITTNEKLGRALFYW  70

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
            FFEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+L
Sbjct  71   FFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANIL  130

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ERFP+YKGR+FYI GESYAGH
Sbjct  131  FLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDFYIVGESYAGH  190

Query  618  YVPQLSQ  638
            Y+PQLS+
Sbjct  191  YIPQLSE  197



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   280 bits (717),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 150/185 (81%), Gaps = 0/185 (0%)
 Frame = +3

Query  84   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  263
            F L L + +       S+ QQKLD V +LPG  F V FAHY+GYVTVN+ SGRALFYWFF
Sbjct  19   FYLSLGSCLIAASLEDSIAQQKLDKVHNLPGQSFTVDFAHYAGYVTVNKHSGRALFYWFF  78

Query  264  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  443
            EA +DP SKPL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKT+Y NPYSWN   N+LF+
Sbjct  79   EAAKDPDSKPLLLWLNGGPGCSSVAYGEAEEIGPFHIRPDGKTVYLNPYSWNQVVNILFL  138

Query  444  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  623
            +SP GVG+SYSNTSSD+L +GDKRTA+DSL FLLKW ERFPQYK R+FYI GESY GHYV
Sbjct  139  ESPVGVGFSYSNTSSDLLNNGDKRTAKDSLTFLLKWLERFPQYKERDFYIAGESYGGHYV  198

Query  624  PQLSQ  638
            PQLSQ
Sbjct  199  PQLSQ  203



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   279 bits (713),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 153/183 (84%), Gaps = 0/183 (0%)
 Frame = +3

Query  90   LLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA  269
            L L T       S  + QQK+D V  LPG  F+V+F HYSGY+TVN+E GRALFYWF EA
Sbjct  22   LQLGTCSSSSSSSDPITQQKIDRVNYLPGQNFDVAFTHYSGYITVNEEFGRALFYWFIEA  81

Query  270  VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDS  449
            VEDPSSKPL+LWLNGGPGCSSIAFG AEE+GPFH++KDGKTLY NP SWN  AN++F+D+
Sbjct  82   VEDPSSKPLLLWLNGGPGCSSIAFGEAEELGPFHIQKDGKTLYLNPNSWNKVANVIFLDA  141

Query  450  PAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQ  629
            P GVG+SYSNT+SD+LT+GD RTA+DSL+FL+ WFERFP+YKGRE YI+GESY GHYVPQ
Sbjct  142  PVGVGFSYSNTTSDLLTNGDNRTAQDSLKFLVGWFERFPEYKGRELYISGESYGGHYVPQ  201

Query  630  LSQ  638
            LSQ
Sbjct  202  LSQ  204



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 156/197 (79%), Gaps = 2/197 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  227
            M+     C L   L+A +         + + Q++ D V  LPG  FNVSFAHYSG+VT N
Sbjct  1    MAKTRGSCCLVNALIAIAFLATAHLCEAGLSQKEQDKVSKLPGQNFNVSFAHYSGFVTTN  60

Query  228  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  61   EKLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQ  120

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTAEDSL+FLLKW ERFP+YKGR+F
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKTNGDKRTAEDSLKFLLKWVERFPEYKGRDF  180

Query  588  YITGESYAGHYVPQLSQ  638
            YI GESYAGHY+PQLS+
Sbjct  181  YIVGESYAGHYIPQLSE  197



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   278 bits (711),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 156/193 (81%), Gaps = 2/193 (1%)
 Frame = +3

Query  60   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  239
            A +  C ++ +++   +   +   S   Q  D V +LPG  FNV+FAHYSG+VT N++ G
Sbjct  16   AKTRSCFVYAIIVIAHLCNCEAVLSEKDQ--DKVWNLPGQNFNVNFAHYSGFVTTNEKMG  73

Query  240  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  419
            RALFYW FEA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +SWN
Sbjct  74   RALFYWLFEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHSWN  133

Query  420  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  599
             AAN+LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL FLLKW ER+P+YKGREFYI G
Sbjct  134  QAANILFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLTFLLKWVERYPEYKGREFYIVG  193

Query  600  ESYAGHYVPQLSQ  638
            ESYAGHY+PQLSQ
Sbjct  194  ESYAGHYIPQLSQ  206



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = +3

Query  54   MSALSWGCL---LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  224
            M+   W C    LF + +          S + +++ + V  LPG  FNV+FAHYSG+VT 
Sbjct  1    MAKTRWSCFVNALFAIAVLAIAHFSNCESVLSEKEQNKVSKLPGQNFNVNFAHYSGFVTT  60

Query  225  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  404
            N++ GRALFYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N
Sbjct  61   NEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLN  120

Query  405  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGRE  584
             YSWN AAN+LF+D+P GVG+SYSNTSSD+LT+GDKRTA+DSL FLLKW ER+P+YKGRE
Sbjct  121  QYSWNQAANILFLDAPVGVGFSYSNTSSDLLTNGDKRTAQDSLTFLLKWVERYPEYKGRE  180

Query  585  FYITGESYAGHYVPQLSQ  638
            FYI GESYAGHY+PQLSQ
Sbjct  181  FYIVGESYAGHYIPQLSQ  198



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   277 bits (708),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 156/195 (80%), Gaps = 2/195 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  233
            M+     C ++ +L    +   +  + + Q++ D V  LPG  FNV+FAHYSG+VT N++
Sbjct  1    MAKTRRSCFVYAILAIAHLCNCE--AILSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEK  58

Query  234  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  413
             GRALFYW FEA EDP+ KPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N +S
Sbjct  59   MGRALFYWLFEAAEDPAYKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHS  118

Query  414  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  593
            WN AAN+LF+D+P GVGYSYSNTSSD+LT+GDKRTA+DSL FLLKW ER+P+YKGREFYI
Sbjct  119  WNQAANILFLDAPVGVGYSYSNTSSDLLTNGDKRTAQDSLTFLLKWVERYPEYKGREFYI  178

Query  594  TGESYAGHYVPQLSQ  638
             GESYAGHY+PQLSQ
Sbjct  179  VGESYAGHYIPQLSQ  193



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/197 (68%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = +3

Query  48   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  227
            ++ S+     L+ +  LAT+     G S   Q++ D V  LPG  FNVSFAHYSG+VT N
Sbjct  5    IKSSSCLVNALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQDFNVSFAHYSGFVTTN  61

Query  228  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  62   EKLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKADGKTLYLNQ  121

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ERFP+YKGR+F
Sbjct  122  YSWNQAANILFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDF  181

Query  588  YITGESYAGHYVPQLSQ  638
            YI GESYAGHY+PQLS+
Sbjct  182  YIVGESYAGHYIPQLSE  198



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C + V+ L          + + Q++ D V  LPG  FNV FAHYSG+VT N++ GRALFY
Sbjct  9    CFVVVVALLAITHLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALFY  68

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  69   WFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  128

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+D+P GVGYSYSNTSSD+ ++GDKRTA+DSL+FLLKW ER+P+YKGREFYI GESYAG
Sbjct  129  LFLDAPVGVGYSYSNTSSDLRSNGDKRTAQDSLKFLLKWVERYPEYKGREFYIVGESYAG  188

Query  615  HYVPQLSQ  638
            HYVPQLSQ
Sbjct  189  HYVPQLSQ  196



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 149/167 (89%), Gaps = 0/167 (0%)
 Frame = +3

Query  138  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  317
            +QQ+LD V  LPG  F+V+FA Y+GYVTVN+ESGRA FYWFFEA EDPSSKPL+LWLNGG
Sbjct  6    NQQELDRVSKLPGQNFDVNFASYAGYVTVNEESGRAYFYWFFEADEDPSSKPLLLWLNGG  65

Query  318  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  497
            PGCSSIA+GLAEEVGPFH+EKDGKTLY N +SWN  AN+LFVDSP GVG+SYSNTSSD+L
Sbjct  66   PGCSSIAYGLAEEVGPFHIEKDGKTLYLNQFSWNKVANVLFVDSPVGVGFSYSNTSSDLL  125

Query  498  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             +GDKRTA ++LEFLL WF RFPQYK R+F+I+GESYAGHYVPQLS+
Sbjct  126  NNGDKRTASENLEFLLGWFNRFPQYKERDFFISGESYAGHYVPQLSE  172



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   276 bits (707),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 160/198 (81%), Gaps = 3/198 (2%)
 Frame = +3

Query  54   MSALSWGCLLFVL-LLATS-IDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTV  224
            MS  S   +L VL LLA S     +GSSS   +Q+ D V  +PG GFN SFAHY+GYVTV
Sbjct  1    MSGASRCAVLAVLFLLAVSGAAAAEGSSSWRGEQERDRVPRVPGQGFNASFAHYAGYVTV  60

Query  225  NQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  404
            ++E G ALFYWFFEA  +P+SKPLVLWLNGGPGCSSIAFGL EEVGPFH+  DGK ++ N
Sbjct  61   SEERGAALFYWFFEAAHEPASKPLVLWLNGGPGCSSIAFGLGEEVGPFHINADGKGVHMN  120

Query  405  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGRE  584
            PYSWN  AN+LF+DSP GVGYSYSNTS DIL++GD++TA+DSL FL KW ERFPQYKGRE
Sbjct  121  PYSWNRVANILFLDSPVGVGYSYSNTSGDILSNGDEKTAKDSLVFLTKWLERFPQYKGRE  180

Query  585  FYITGESYAGHYVPQLSQ  638
            FY+TGESYAGHYVPQL+Q
Sbjct  181  FYLTGESYAGHYVPQLAQ  198



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   276 bits (707),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            + Q++ D V  LPG  FNVSFAHYSG+VT N++ GRALFYW FEAVED  SKPLVLWLNG
Sbjct  30   LSQKEQDKVSKLPGQDFNVSFAHYSGFVTTNEKLGRALFYWLFEAVEDAKSKPLVLWLNG  89

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVGYSYSNTSSD+
Sbjct  90   GPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANILFLDAPVGVGYSYSNTSSDL  149

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             T+GDKRTA+DSL+FLLKW ERFP+YKGR+FYI GESYAGHY+PQLS+
Sbjct  150  QTNGDKRTAQDSLKFLLKWVERFPEYKGRDFYIVGESYAGHYIPQLSE  197



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 148/185 (80%), Gaps = 19/185 (10%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG-  317
            QQ+LD V  LPG  F VSF HYSGYV VN+ESGRALFYWFFEA EDP+SKP+VLWLNGG 
Sbjct  38   QQRLDRVEKLPGQNFIVSFEHYSGYVRVNEESGRALFYWFFEAAEDPASKPIVLWLNGGL  97

Query  318  ------------------PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  443
                              PGCSSIA+G AEE+GPFH++ D KTLY NPYSWN  AN+LF+
Sbjct  98   PALLVFHLLCLVTMKSLGPGCSSIAYGEAEEIGPFHIKPDAKTLYLNPYSWNQVANILFI  157

Query  444  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  623
            DSP GVG+SYSN SSD+L++GDKRTA+D+LEFLLKWFERFPQYKGREFYI GESYAGHYV
Sbjct  158  DSPVGVGFSYSNASSDLLSNGDKRTAKDNLEFLLKWFERFPQYKGREFYIAGESYAGHYV  217

Query  624  PQLSQ  638
            PQLSQ
Sbjct  218  PQLSQ  222



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   277 bits (708),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            + Q++ D V  LPG  FNV+FAHYSG+VT N++ GRALFYW FEA EDP+SKPLVLWLNG
Sbjct  63   LSQKEQDKVSQLPGQNFNVNFAHYSGFVTTNEKMGRALFYWLFEAAEDPASKPLVLWLNG  122

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSS+ FG AEE+GPFH++ DGKTLY N +SWN AAN+LF+D+P GVGYSYSNTSSD 
Sbjct  123  GPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQHSWNQAANILFLDAPVGVGYSYSNTSSDF  182

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            LT+GDKRTA+DSL FLLKW ER+P+YKGREFYI GESYAGHY+PQLSQ
Sbjct  183  LTNGDKRTAQDSLTFLLKWVERYPEYKGREFYIVGESYAGHYIPQLSQ  230



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 155/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C + V LLA +      ++ + Q++ D V  LPG  FNV F HYSG+VT N++ GRALFY
Sbjct  9    CFVVVALLAIT-HLCICAALLSQKEQDKVSKLPGQNFNVDFTHYSGFVTTNEKLGRALFY  67

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  68   WFFEATDDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  127

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+D+P GVGYSYSNTSSD+ ++GDKRTA+DSL+FLLKW ER+P+YKGREFYI GESYAG
Sbjct  128  LFLDAPVGVGYSYSNTSSDLRSNGDKRTAQDSLKFLLKWVERYPEYKGREFYIVGESYAG  187

Query  615  HYVPQLSQ  638
            HYVPQLSQ
Sbjct  188  HYVPQLSQ  195



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   275 bits (704),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = +3

Query  48   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  227
            ++ S+     L+ +  LAT+     G S   Q++ D V  LPG  F+VSFAHYSG+VT N
Sbjct  23   IKSSSCLVNALIAIAFLATAHLCEAGLS---QKEQDKVSKLPGQNFDVSFAHYSGFVTTN  79

Query  228  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N 
Sbjct  80   EKLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQ  139

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ T+GDKRTA+DSL+FLLKW ERFP+YKGR+F
Sbjct  140  YSWNQAANILFLDAPVGVGYSYSNTSSDLQTNGDKRTAQDSLKFLLKWVERFPEYKGRDF  199

Query  588  YITGESYAGHYVPQLSQ  638
            YI GESYAGHY+PQLS+
Sbjct  200  YIVGESYAGHYIPQLSE  216



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   275 bits (702),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 155/197 (79%), Gaps = 2/197 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  227
            M+     C L   L+A +         + + Q++ D V  LPG  FNVSFAHYSG+V  N
Sbjct  1    MAKTRGSCCLVNALIAIAFLATAHLCEAGLSQKEQDKVSKLPGQNFNVSFAHYSGFVATN  60

Query  228  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N 
Sbjct  61   EQLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQ  120

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ ++GDKRTAEDSL+FLLKW ERFP+YKGR+F
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVERFPEYKGRDF  180

Query  588  YITGESYAGHYVPQLSQ  638
            YI GESYAGHY+PQLS+
Sbjct  181  YIVGESYAGHYIPQLSE  197



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 155/188 (82%), Gaps = 1/188 (1%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C + V LLA +       + + Q++ D V  LPG  FNV FAHYSG+VT N++ GRALFY
Sbjct  9    CFVVVALLAIT-HLCICEALLSQKEQDKVTKLPGQNFNVDFAHYSGFVTTNEKLGRALFY  67

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            WFFEA +D +SKPLVLWLNGGPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+
Sbjct  68   WFFEAADDAASKPLVLWLNGGPGCSSVAFGEAEEIGPFHIKSDGKTLYLNQYSWNQAANI  127

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+D+P GVGYSYSNTS+D+ ++GDKRTA+DSL+FLLKW ER+P+YKGR+FYI GESYAG
Sbjct  128  LFLDAPVGVGYSYSNTSTDLRSNGDKRTAQDSLKFLLKWVERYPEYKGRDFYIVGESYAG  187

Query  615  HYVPQLSQ  638
            HY+PQLSQ
Sbjct  188  HYIPQLSQ  195



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   274 bits (701),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  129  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  308
            S + +++ D V  LPG  FNV+FAHYSG+VT N++ GRALFYW  EA EDP+SKPLVLWL
Sbjct  29   SVLSEKEQDKVSKLPGQNFNVNFAHYSGFVTTNEKLGRALFYWLIEAAEDPASKPLVLWL  88

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+ FG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVG+SYSNTSS
Sbjct  89   NGGPGCSSVGFGEAEEIGPFHIKPDGKTLYLNQYSWNQAANILFLDAPVGVGFSYSNTSS  148

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+LT+GDKRTA+DSL FLLKW ER+P+YKGREFYI GESYAGHY+PQLSQ
Sbjct  149  DLLTNGDKRTAQDSLTFLLKWVERYPEYKGREFYIVGESYAGHYIPQLSQ  198



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 154/195 (79%), Gaps = 1/195 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  233
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  234  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  413
             GRALFYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  414  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  593
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E +P+YKGREFYI
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLKFLLKWVELYPEYKGREFYI  179

Query  594  TGESYAGHYVPQLSQ  638
             GESYAGHY+PQLSQ
Sbjct  180  AGESYAGHYIPQLSQ  194



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   272 bits (696),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 154/195 (79%), Gaps = 1/195 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  233
            M+   W C    LL+       +  + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWFCFAIALLVIARFCNCE-EAVLSQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  234  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  413
             GRALFYWFFEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWFFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  414  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  593
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E +P+YKGREFYI
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLKFLLKWVELYPEYKGREFYI  179

Query  594  TGESYAGHYVPQLSQ  638
             GESYAGHY+PQLSQ
Sbjct  180  AGESYAGHYIPQLSQ  194



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   271 bits (694),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
            + Q+  D V  LPG  FNV FAHYSG+VT N++ GRALFYW FEA ED  SKPLVLWLNG
Sbjct  31   LSQKAQDKVSILPGQNFNVDFAHYSGFVTTNEKLGRALFYWLFEATEDAESKPLVLWLNG  90

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSS+AFG AEE+GPFH++ DGKTLY N YSWN AAN+LF+D+P GVGYSYSNTSSD+
Sbjct  91   GPGCSSVAFGEAEEIGPFHIKADGKTLYLNQYSWNQAANILFLDAPVGVGYSYSNTSSDL  150

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             ++GDKRTA+DSL+FLLKW ER+P+YKGREFYI GESYAGHY+PQLS+
Sbjct  151  RSNGDKRTAQDSLKFLLKWVERYPEYKGREFYIVGESYAGHYIPQLSE  198



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 157/199 (79%), Gaps = 5/199 (3%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDG----GKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  221
            M+     C ++VL  A ++ G        + + +++ D V  LPG  FNV+FA YSG+VT
Sbjct  1    MAKTRGSCFVYVLF-AIAVLGIAHFCNCEAVLSEKEQDKVSKLPGQNFNVNFAQYSGFVT  59

Query  222  VNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  401
             N++ GRALFYW  EA EDP+SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY 
Sbjct  60   TNEKLGRALFYWLIEAAEDPASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKPDGKTLYL  119

Query  402  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGR  581
            N YSWN AAN+LF+D+P GVG+SYSNTSSD++T+GDKRTA+DSL FLLKW ER+P+YKGR
Sbjct  120  NQYSWNQAANILFLDAPVGVGFSYSNTSSDLVTNGDKRTAQDSLTFLLKWVERYPEYKGR  179

Query  582  EFYITGESYAGHYVPQLSQ  638
            EFYI GESYAGHY+PQLSQ
Sbjct  180  EFYIVGESYAGHYIPQLSQ  198



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 154/197 (78%), Gaps = 2/197 (1%)
 Frame = +3

Query  48   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  227
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  1    MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  58

Query  228  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            +++GR LFYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NP
Sbjct  59   EKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNP  118

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            YSWN  AN+LF+D+P GVG+SYSN  SD+L +GD+RTAED+L FLL WFERFPQYK   F
Sbjct  119  YSWNRVANILFLDTPVGVGFSYSNNKSDMLINGDERTAEDNLVFLLNWFERFPQYKRSNF  178

Query  588  YITGESYAGHYVPQLSQ  638
            +I+GESYAGHYVPQLSQ
Sbjct  179  FISGESYAGHYVPQLSQ  195



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 154/197 (78%), Gaps = 2/197 (1%)
 Frame = +3

Query  48   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  227
            +E     W  +L ++ L    D    +S   +Q+ D V  LPG GFN+SFAHY+GY+TVN
Sbjct  15   MEWRMALWSQILCIVTLLLCSDCA--ASFAKEQQKDRVGRLPGQGFNISFAHYAGYITVN  72

Query  228  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            +++GR LFYWF EA+EDP SKPLVLWLNGGPGCSSIAFG +EEVGPFH+  D KTL++NP
Sbjct  73   EKAGRTLFYWFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEVGPFHINSDSKTLHFNP  132

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            YSWN  AN+LF+D+P GVG+SYSN  SD+L +GD+RTAED+L FLL WFERFPQYK   F
Sbjct  133  YSWNRVANILFLDTPVGVGFSYSNNKSDMLINGDERTAEDNLVFLLNWFERFPQYKRSNF  192

Query  588  YITGESYAGHYVPQLSQ  638
            +I+GESYAGHYVPQLSQ
Sbjct  193  FISGESYAGHYVPQLSQ  209



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   268 bits (685),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 141/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  138  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  317
            ++Q  D V  +PG  F+ S+AHY+GYVTV++  G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFDTSYAHYAGYVTVSEPRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  318  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  497
            PGCSSIA+GL EEVGPFHV  DGK ++ NPYSWN  ANLLFVDSP GVGYSYSNTS DIL
Sbjct  92   PGCSSIAYGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFVDSPVGVGYSYSNTSDDIL  151

Query  498  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             +GD RTA+DSL FLLKW ERFPQYKGREFY+TGESYAGHYVPQL+Q
Sbjct  152  RNGDARTAKDSLAFLLKWLERFPQYKGREFYLTGESYAGHYVPQLAQ  198



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 155/195 (79%), Gaps = 1/195 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  233
            M+   W CL  + LLA +       + + Q++ D V  LPG  F+V FAHYSG+VT N++
Sbjct  1    MAKTRWSCLA-IALLAIARFCNCEEAVLCQKEQDRVSRLPGQDFDVDFAHYSGFVTTNEK  59

Query  234  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  413
             GRALFYW FEA ED +SKPLVLWLNGGPGCSS+ FG AEE+GPFH++ DGKTLY N YS
Sbjct  60   LGRALFYWLFEAAEDAASKPLVLWLNGGPGCSSVGFGEAEEIGPFHIKSDGKTLYLNQYS  119

Query  414  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  593
            WN  AN+LF+D+P GVGYSYSNTSSD+LT+GD+RTA+DSL+FLLKW E +P++KGREFYI
Sbjct  120  WNQVANILFLDAPVGVGYSYSNTSSDLLTNGDQRTAKDSLQFLLKWVELYPEFKGREFYI  179

Query  594  TGESYAGHYVPQLSQ  638
             GESYAGHY+PQLSQ
Sbjct  180  VGESYAGHYIPQLSQ  194



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  111  DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSK  290
            DG   ++   +Q+ D V  +PG  F+V FA Y+GYVTV++E G ALFYWFFEA EDP+SK
Sbjct  33   DGEAAATWRAEQEWDRVARVPGQDFDVGFAQYAGYVTVSEERGAALFYWFFEAAEDPASK  92

Query  291  PLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYS  470
            PLVLWLNGGPGCSSIA+G+AEEVGPFHV  DG+ ++ NPYSWN  AN+LF+DSP GVGYS
Sbjct  93   PLVLWLNGGPGCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWNQVANILFLDSPVGVGYS  152

Query  471  YSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            YSN S DIL +GD RTA DSL FL KW ERFPQYKGREFY+TGESYAGHYVPQL+Q
Sbjct  153  YSNVSDDILNNGDARTANDSLTFLTKWIERFPQYKGREFYVTGESYAGHYVPQLAQ  208



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSSIAFG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL+
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILS  147

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +GD+RTA+DSL FL KW ERFPQYK REFY+TGESYAGHYVPQL+Q
Sbjct  148  NGDERTAKDSLVFLTKWLERFPQYKEREFYLTGESYAGHYVPQLAQ  193



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            +Q+ D V  +PG  FN SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGP
Sbjct  28   EQERDRVPRVPGQAFNASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGP  87

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSSIAFG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL+
Sbjct  88   GCSSIAFGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILS  147

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +GD+RTA+DSL FL KW ERFPQYK REFY+TGESYAGHYVPQL+Q
Sbjct  148  NGDERTAKDSLVFLTKWLERFPQYKEREFYLTGESYAGHYVPQLAQ  193



>gb|AFW85537.1| hypothetical protein ZEAMMB73_208131 [Zea mays]
Length=432

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  138  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  317
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  318  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  497
            PGCSSIAFGL EEVGPFHV  DGK ++ NPYSWN  ANLLF+DSP GVGYSYSNTS D L
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFLDSPVGVGYSYSNTSDDAL  151

Query  498  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             +GD RTA DSL FLLKW ERFPQYK REFY+TGESYAGHYVPQL+Q
Sbjct  152  KNGDARTATDSLAFLLKWLERFPQYKEREFYLTGESYAGHYVPQLAQ  198



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 156/204 (76%), Gaps = 8/204 (4%)
 Frame = +3

Query  51   EMSALSWGCLLF--VLLLAT----SIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYS  209
            EM+   W  +    +L+LAT    SI     +    QQ  D +   LPG  FN++F HYS
Sbjct  10   EMARFEWSQIWVTDILILATLFLCSISFAIATDPFVQQGKDRIGRALPGQNFNINFEHYS  69

Query  210  GYVTVNQESGRALFYWFFEAV-EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDG  386
            GY+TVN+++GR LFYWF EA  +DP+SKPL+LW NGGPGCSSIAFG AEE+GPFH+  DG
Sbjct  70   GYITVNEDTGRNLFYWFIEAEHQDPTSKPLLLWFNGGPGCSSIAFGEAEEIGPFHINPDG  129

Query  387  KTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFP  566
             TLY NPYSWN  AN+LFVDSP GVG+SYSNTSS++L +GDKRTAEDSL FLLKWFERFP
Sbjct  130  NTLYLNPYSWNQVANILFVDSPVGVGFSYSNTSSELLNNGDKRTAEDSLIFLLKWFERFP  189

Query  567  QYKGREFYITGESYAGHYVPQLSQ  638
            QYK  +F+I+GESYAGHYVPQLSQ
Sbjct  190  QYKKTDFFISGESYAGHYVPQLSQ  213



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   264 bits (674),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 138/167 (83%), Gaps = 0/167 (0%)
 Frame = +3

Query  138  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  317
            ++Q  D V  +PG  FN SFA Y+GYVTV+++ G ALFYWFFEA +DP SKPLVLWLNGG
Sbjct  32   EEQARDRVPRVPGQAFNTSFAQYAGYVTVSEQRGAALFYWFFEAEKDPGSKPLVLWLNGG  91

Query  318  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  497
            PGCSSIAFGL EEVGPFHV  DGK ++ NPYSWN  ANLLF+DSP GVGYSYSNTS D L
Sbjct  92   PGCSSIAFGLGEEVGPFHVNADGKGVHVNPYSWNKVANLLFLDSPVGVGYSYSNTSDDAL  151

Query  498  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             +GD RTA DSL FLLKW ERFPQYK REFY+TGESYAGHYVPQL+Q
Sbjct  152  KNGDARTATDSLAFLLKWLERFPQYKEREFYLTGESYAGHYVPQLAQ  198



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 162/251 (65%), Gaps = 56/251 (22%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSS-VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  230
            M +L W  +L +L     ++    SS  + QQ+LD V  LPG  FN+SFAHYSGYVTVN+
Sbjct  1    MLSLKWVFVLQILFTLIYLNTPASSSDPLVQQRLDKVQHLPGQAFNISFAHYSGYVTVNE  60

Query  231  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
             SGRALFYWF EA EDPSSKPLVLWLNGGPGCSSIA+G +EE+GPFH+++DGKTLY NPY
Sbjct  61   NSGRALFYWFIEAAEDPSSKPLVLWLNGGPGCSSIAYGQSEEIGPFHIKEDGKTLYLNPY  120

Query  411  SWN----------------------------LAANLLFVDSPAGVGYSYSNTSSDILTHG  506
            SWN                              AN+LF+DSP GVG+SYSNTSSD+ T+G
Sbjct  121  SWNQDIDLQVKVYMFRRNNDVRFSIAERISITIANILFLDSPVGVGFSYSNTSSDVSTNG  180

Query  507  DKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA-------------------------  611
            D RTA+DSL FLLKW ERFPQYKGR+FYITGESYA                         
Sbjct  181  DIRTAKDSLAFLLKWLERFPQYKGRDFYITGESYAGGGLGPFKFVAILVEAISNKTRGSR  240

Query  612  --GHYVPQLSQ  638
              GHYVPQLSQ
Sbjct  241  CLGHYVPQLSQ  251



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   262 bits (669),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 139/166 (84%), Gaps = 0/166 (0%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            +Q+ D V  +PG  F+V FA Y+GYV V++E G +LFYWFFEA +DP+SKPLVLWLNGGP
Sbjct  43   EQERDRVARVPGQDFDVGFAQYAGYVAVSEERGASLFYWFFEAADDPASKPLVLWLNGGP  102

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSSIA+G+AEEVGPFHV  DG+ ++ NPYSWN  AN+LF+DSP GVGYSYSN S DIL 
Sbjct  103  GCSSIAYGVAEEVGPFHVNADGQGVHLNPYSWNQVANILFLDSPVGVGYSYSNASDDILN  162

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +GD RTA DSL FL KW ERFPQYKGREFY+TGESYAGHYVPQL+Q
Sbjct  163  NGDARTANDSLTFLTKWIERFPQYKGREFYVTGESYAGHYVPQLAQ  208



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = +3

Query  159  VLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIA  338
            V  +PG  F+ SFAHY+GYVTV+++ G ALFYWFFEA  DP+SKPL+LWLNGGPGCSSIA
Sbjct  1    VPRVPGQAFDASFAHYAGYVTVSEDRGAALFYWFFEAAHDPASKPLLLWLNGGPGCSSIA  60

Query  339  FGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRT  518
            FG+ EEVGPFHV  DGK ++ NPYSWN  AN+LF+DSP GVGYSYSNTS+DIL++GD+RT
Sbjct  61   FGVGEEVGPFHVNADGKGVHMNPYSWNQVANILFLDSPVGVGYSYSNTSADILSNGDERT  120

Query  519  AEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            A+DSL FL KW ERFPQYK REFY+TGESYAGHYVPQL+Q
Sbjct  121  AKDSLVFLTKWLERFPQYKEREFYLTGESYAGHYVPQLAQ  160



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   261 bits (667),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 145/188 (77%), Gaps = 0/188 (0%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C   +LL +           + QQ  D V  LPG  FNVSFAHY+GY+TV + +GR LFY
Sbjct  10   CFATLLLCSAFATSFSTDPPLLQQHKDRVGRLPGQNFNVSFAHYAGYITVEENAGRTLFY  69

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            WF EA+EDP SKPLVLWLNGGPGCSSIAFG +EE+GPFH+  DGKTL+ NPYSWN  AN+
Sbjct  70   WFIEALEDPHSKPLVLWLNGGPGCSSIAFGQSEEIGPFHINPDGKTLHPNPYSWNRVANI  129

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+D+P GVG+SYSN  S++L +GD RTA+D+L FLLKWFERFPQY+  +F I+GESYAG
Sbjct  130  LFLDTPVGVGFSYSNNGSELLNNGDNRTAKDNLVFLLKWFERFPQYRSNDFLISGESYAG  189

Query  615  HYVPQLSQ  638
            HYVPQLSQ
Sbjct  190  HYVPQLSQ  197



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 148/190 (78%), Gaps = 2/190 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSI--DGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  227
            M+     C L   L+A +         + + Q++ D V  LPG  FNVSFAHYSG+V  N
Sbjct  1    MAKTRGSCCLVNALIAIAFLATAHLCEAGLSQKEQDKVSKLPGQNFNVSFAHYSGFVATN  60

Query  228  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            ++ GRALFYW FEAVED  SKPLVLWLNGGPGCSS+A+G AEE+GPFH++ DGKTLY N 
Sbjct  61   EQLGRALFYWLFEAVEDAKSKPLVLWLNGGPGCSSVAYGEAEEIGPFHIKADGKTLYLNQ  120

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            YSWN AAN+LF+D+P GVGYSYSNTSSD+ ++GDKRTAEDSL+FLLKW ERFP+YKGR+F
Sbjct  121  YSWNQAANILFLDAPVGVGYSYSNTSSDLKSNGDKRTAEDSLKFLLKWVERFPEYKGRDF  180

Query  588  YITGESYAGH  617
            YI GESYAG+
Sbjct  181  YIVGESYAGN  190



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   258 bits (659),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  305
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDAQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  306  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  485
            LNGGPGCSS+AFG AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAFGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  486  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SD+ T GD+RTAED+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  138  SDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  188



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   257 bits (657),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  305
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDAQEKDRISRLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSQHPESKPLVLW  77

Query  306  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  485
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  486  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SD+ T GD+RTAED+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  138  SDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  188



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   258 bits (658),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 151/200 (76%), Gaps = 5/200 (3%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAV-LDLPGLGFNVSFAHYSGYVT  221
            M+   W  +  + L    +     + + D   QQ+ D +   LPG  FN+SF HYSGY+T
Sbjct  1    MANSEWSQIFAITLATIFLCNNNFTFATDPFVQQEQDRIDRPLPGQNFNISFEHYSGYIT  60

Query  222  VNQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  398
            VN+++GR LFYWF +A   DP+S PL+LWLNGGPGCSSIAFG AEE+GPFH+  D KTLY
Sbjct  61   VNEDAGRNLFYWFIQADHVDPTSMPLLLWLNGGPGCSSIAFGEAEEIGPFHINSDSKTLY  120

Query  399  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  578
             NPYSWN  AN+L++DSP GVG+SYS  SSDILT+GDKRTAED+L FLLKWFERFPQYK 
Sbjct  121  LNPYSWNQVANILYIDSPVGVGFSYSKNSSDILTNGDKRTAEDNLIFLLKWFERFPQYKN  180

Query  579  REFYITGESYAGHYVPQLSQ  638
             +F+I+GESYAGHYVPQLSQ
Sbjct  181  TDFFISGESYAGHYVPQLSQ  200



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   256 bits (655),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  305
            SS  D Q+ D +  LPG   +VSF+HYSGYVTVN+ +GRALFYW  E+ + P SKPLVLW
Sbjct  18   SSCRDSQENDRISHLPGEPNDVSFSHYSGYVTVNESAGRALFYWLTESSDHPESKPLVLW  77

Query  306  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  485
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYSNT+
Sbjct  78   LNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYAWNKLANLLFLESPAGVGFSYSNTT  137

Query  486  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SD+ T GD+RTAED+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  138  SDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  188



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 148/190 (78%), Gaps = 2/190 (1%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALFY
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  255  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            W  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY+WN  A
Sbjct  63   WLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPYAWNNLA  122

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            N+LF+DSPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESY
Sbjct  123  NILFLDSPAGVGFSYSNTTSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYIAGESY  182

Query  609  AGHYVPQLSQ  638
            AGHYVPQLSQ
Sbjct  183  AGHYVPQLSQ  192



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   255 bits (652),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 148/189 (78%), Gaps = 2/189 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            L +V+ L+    G   S S  +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALFYW
Sbjct  5    LCYVIFLSFLFVGSCYSFSNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  258  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
              E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPSNRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNPYSWNNLAN  124

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            LLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFERFPQYK REFYI GESYA
Sbjct  125  LLFLESPAGVGFSYTNTSSDLYDAGDQRTAEDTYQFLIKWFERFPQYKHREFYIAGESYA  184

Query  612  GHYVPQLSQ  638
            GHYVPQLSQ
Sbjct  185  GHYVPQLSQ  193



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   255 bits (652),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 150/190 (79%), Gaps = 3/190 (2%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQ-QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            L FV++L   +  G   S ++Q Q+ D +  LPG   NV F  YSGYVTVN+++GRALFY
Sbjct  8    LFFVVVLPLFLLFGTCYSRINQDQERDRIKSLPGQPANVDFDQYSGYVTVNKKAGRALFY  67

Query  255  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            WF E  A   P S+PL+LWLNGGPGCSS+A+G  EE+GPF V+ DGKTL++NPYSWN  A
Sbjct  68   WFIESPASRAPESRPLLLWLNGGPGCSSVAYGATEEIGPFRVKPDGKTLFFNPYSWNKLA  127

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            NLLFV+SPAGVG+SYSNTSSD+ T GD+RTAED+  FL++WFERFPQYK REFYI GESY
Sbjct  128  NLLFVESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVQWFERFPQYKHREFYIAGESY  187

Query  609  AGHYVPQLSQ  638
            AGHYVPQLSQ
Sbjct  188  AGHYVPQLSQ  197



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 144/173 (83%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  299
            SSS+  Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLV
Sbjct  18   SSSIYDQENDRITHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLV  77

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSN
Sbjct  78   LWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSN  137

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GDKRTAED+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  138  TTSDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  190



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 143/174 (82%), Gaps = 2/174 (1%)
 Frame = +3

Query  123  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  296
             S S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   E+P SKPL
Sbjct  18   ASCSRHEQEKDRIFHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSENPESKPL  77

Query  297  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  476
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  78   VLWLNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYS  137

Query  477  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            NT+SD+ T GD+RTAED+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  138  NTTSDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  191



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 152/201 (76%), Gaps = 6/201 (3%)
 Frame = +3

Query  54   MSALSWGCLLFVLL--LATSIDGGKGSSSVDQQKLDAV-LDLPGLGFNVSFAHYSGYVTV  224
            M+   W  +LF+++  LA        +    QQ  D +   LPG  FN+SF HYSGY+TV
Sbjct  1    MANSKWSQILFIVIITLANLFQCNIATDPFVQQGQDNIGRALPGQNFNISFEHYSGYITV  60

Query  225  NQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  401
            N++ GR LFYWF +A   DP+SKPL+LW NGGPGCSSIA+G AEE+GPFH+  DGK L++
Sbjct  61   NEDVGRNLFYWFIQADHVDPTSKPLLLWFNGGPGCSSIAYGEAEEIGPFHINSDGKNLHF  120

Query  402  NPYSWNLAANLLFVDSPAGVGYSYS--NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYK  575
            NPYSWN  AN+L++DSP GVG+SYS  N+S DIL +GDKRTAED+L FLLKWFERFPQYK
Sbjct  121  NPYSWNQVANILYIDSPVGVGFSYSTKNSSDDILNNGDKRTAEDNLIFLLKWFERFPQYK  180

Query  576  GREFYITGESYAGHYVPQLSQ  638
              +F+I+GESYAGHYVPQLSQ
Sbjct  181  KTDFFISGESYAGHYVPQLSQ  201



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 148/190 (78%), Gaps = 3/190 (2%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C + +L L + +  G   S++DQ++ D +  LPG   NV F  YSGY+TVNQ+SGRALFY
Sbjct  10   CAICILWLNSFVGIGYSLSNLDQER-DRITYLPGQPQNVGFNQYSGYITVNQQSGRALFY  68

Query  255  WFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            W  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  A
Sbjct  69   WLTEAPAYRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYLNPYSWNKLA  128

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            NLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESY
Sbjct  129  NLLFLESPAGVGFSYSNTSSDLYTVGDQRTAEDAYAFLVGWFERFPQYKYRDFYIAGESY  188

Query  609  AGHYVPQLSQ  638
            AGHYVPQLSQ
Sbjct  189  AGHYVPQLSQ  198



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 142/174 (82%), Gaps = 2/174 (1%)
 Frame = +3

Query  123  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  296
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   + P SKPL
Sbjct  17   ASCCRDEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQHPESKPL  76

Query  297  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  476
            VLWLNGGPGCSSIAFG AEE+GPF +  DGKTLY NPY+WN  ANLLF++SPAGVG+SYS
Sbjct  77   VLWLNGGPGCSSIAFGAAEEIGPFRINPDGKTLYHNPYAWNQLANLLFLESPAGVGFSYS  136

Query  477  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            NT+SD+ T GD+RTAED+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  137  NTTSDLYTAGDQRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  190



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  141  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  314
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LFYWF EA   DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSSIA+G AEE+GPFH+  DG TL+ NPYSWN  AN+L +DSP GVG+SYSN SSDI
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNPYSWNQVANILLIDSPVGVGFSYSNASSDI  153

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            L +GDKRT EDSL FLLKWFERFP+YK  +F+I+GESYAGHYVPQLSQ
Sbjct  154  LNNGDKRTTEDSLIFLLKWFERFPRYKETDFFISGESYAGHYVPQLSQ  201



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 147/189 (78%), Gaps = 2/189 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            L +V+ L+    G   S    +Q+ D +  LPG   NV F+ YSGYVTVNQ++GRALFYW
Sbjct  5    LCYVMFLSFLFVGSCYSFYNVEQENDRITYLPGQPENVQFSQYSGYVTVNQQAGRALFYW  64

Query  258  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
              E+    +P  +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPSTRNPEKRPLVLWLNGGPGCSSVAYGAAEEIGPFHINADGKTLYLNPYSWNNLAN  124

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            LLF++SPAGVG+SY+NT+SD+   GD+RTAED+ +F++KWFERFPQYK REFYI GESYA
Sbjct  125  LLFLESPAGVGFSYTNTTSDLYDAGDQRTAEDTYQFVIKWFERFPQYKHREFYIAGESYA  184

Query  612  GHYVPQLSQ  638
            GHYVPQLSQ
Sbjct  185  GHYVPQLSQ  193



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  305
            +  + +QKLD VL LPG  FN+SFAHYSGY+TVN  +G+A FYWF E+ EDPSSKPL LW
Sbjct  47   ADKIIEQKLDQVLKLPGQNFNLSFAHYSGYITVNASAGKAFFYWFVESAEDPSSKPLALW  106

Query  306  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  485
            LNGGP CSSIAFG AEE+GPF    DGK++Y NPY+WN  AN++FV+SPAG G+SYSNTS
Sbjct  107  LNGGPACSSIAFGEAEEIGPFRPTADGKSVYLNPYAWNQVANIIFVESPAGTGFSYSNTS  166

Query  486  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLS  635
            SD+   GD+ T +D+L F+L W ERFPQYKGR+FY+ GESY GH+VPQLS
Sbjct  167  SDLYNTGDRSTGKDNLAFILGWLERFPQYKGRDFYLLGESYGGHFVPQLS  216



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 142/169 (84%), Gaps = 2/169 (1%)
 Frame = +3

Query  138  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWLN  311
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLWLN
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLWLN  81

Query  312  GGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSD  491
            GGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+SD
Sbjct  82   GGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNKLANLLFLESPAGVGFSYSNTTSD  141

Query  492  ILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            + T GDKRTAED+  FLLKWFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  142  LYTAGDKRTAEDAYVFLLKWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  190



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 2/189 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            L FV+ L+    G    S   +Q  D +  LPG   NV F  YSGYVTVN+++GRALFYW
Sbjct  5    LPFVICLSLLFLGSCYCSINVEQLRDKITYLPGQPANVEFNQYSGYVTVNEQAGRALFYW  64

Query  258  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
              E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPYSWN  AN
Sbjct  65   LIESPMSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHINSDGKTLYLNPYSWNNLAN  124

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            LLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFERFPQYK REFYI GESYA
Sbjct  125  LLFLESPAGVGFSYTNTSSDLYNAGDQRTAEDTYQFLVKWFERFPQYKHREFYIAGESYA  184

Query  612  GHYVPQLSQ  638
            GHYVPQLSQ
Sbjct  185  GHYVPQLSQ  193



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   252 bits (643),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +3

Query  132  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLW  305
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLW
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLW  78

Query  306  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  485
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+
Sbjct  79   LNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKVANLLFLESPAGVGFSYSNTT  138

Query  486  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SD+ T GDKRTAED+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  139  SDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  189



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   252 bits (644),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  299
            SS+++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  E  A   P S+PLV
Sbjct  21   SSTLEDQERDKITYLPGQPTNVEFNQYSGYVTVNQQAGRALFYWLIESPASRGPESRPLV  80

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSS+A+G AEE+GPF ++ DGKTL++NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIKPDGKTLFFNPYAWNKLANLLFLESPAGVGFSYSN  140

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  141  TTSDLYTAGDQRTAEDSYAFLVNWFERFPQYKHRDFYIVGESYAGHYVPQLSQ  193



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 142/174 (82%), Gaps = 2/174 (1%)
 Frame = +3

Query  123  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPL  296
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPL
Sbjct  19   ASCCRDEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPDSKPL  78

Query  297  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  476
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  79   VLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYS  138

Query  477  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            NT+SD+ T GDKRTAED+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  139  NTTSDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  192



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 142/171 (83%), Gaps = 2/171 (1%)
 Frame = +3

Query  132  SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLW  305
            S  +Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+   ++P SKPLVLW
Sbjct  19   SRHEQEKDRISHLPGEPNDVSFSHFSGYITVNESAGRALFYWLTESPPSQNPESKPLVLW  78

Query  306  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  485
            LNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+
Sbjct  79   LNGGPGCSSVAYGAAEEIGPFRINPDGKTLYHNPYSWNKVANLLFLESPAGVGFSYSNTT  138

Query  486  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SD+ T GDKRTAED+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  139  SDLYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  189



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/188 (64%), Positives = 146/188 (78%), Gaps = 3/188 (2%)
 Frame = +3

Query  84   FVLLLATSIDGGKG-SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            F L+L  SI G    +S ++ QK D +  LPG   NV FA YSGYVTVN++S RALFYW 
Sbjct  8    FYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSERALFYWL  67

Query  261  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
             EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DG++LY NPY+WN  AN+
Sbjct  68   VEAPVSRGPRSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGRSLYLNPYAWNKLANI  127

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+DSPAGVG+SYSN ++D+ T GD+RTAED+  FL+ WFERFPQYK REFYI GESYAG
Sbjct  128  LFLDSPAGVGFSYSNKTADLYTFGDQRTAEDAYAFLVNWFERFPQYKHREFYIAGESYAG  187

Query  615  HYVPQLSQ  638
            HYVPQL+Q
Sbjct  188  HYVPQLAQ  195



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = +3

Query  129  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVL  302
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  EA     P S+PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPESRPLVL  82

Query  303  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  482
            WLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  ANLLF++SPAGVG+SYSNT
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLANLLFLESPAGVGFSYSNT  142

Query  483  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  143  SSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFYIAGESYAGHYVPQLSQ  194



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = +3

Query  81   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  8    LYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  67

Query  261  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
             EA     P S+PLVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  68   VEAPVKRGPKSRPLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  127

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+DSPAGVG+SYSN S+D+ T GD++TAED+  FL+ WFERFPQYK REFYI GESYAG
Sbjct  128  LFLDSPAGVGFSYSNKSTDLYTFGDQKTAEDAYTFLVNWFERFPQYKHREFYIAGESYAG  187

Query  615  HYVPQLSQ  638
            HYVPQL Q
Sbjct  188  HYVPQLGQ  195



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 141/169 (83%), Gaps = 2/169 (1%)
 Frame = +3

Query  138  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPLVLWLN  311
            D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPLVLWLN
Sbjct  22   DEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPESKPLVLWLN  81

Query  312  GGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSD  491
            GGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYSNT+SD
Sbjct  82   GGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYSNTTSD  141

Query  492  ILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            + T GDKRTAED+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  142  LYTAGDKRTAEDAYVFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  190



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 154/204 (75%), Gaps = 13/204 (6%)
 Frame = +3

Query  33   LTKIPLEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSG  212
            + KIP  +  LS   LLF+     SI+       V+Q + D +  LPG   NV F  YSG
Sbjct  1    MEKIPPFVICLS---LLFLSSCYCSIN-------VEQLR-DKITYLPGQPANVQFNQYSG  49

Query  213  YVTVNQESGRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDG  386
            YVTVN+++GRALFYW  E+    +P  +PL+LWLNGGPGCSS+A+G AEE+GPFH++ DG
Sbjct  50   YVTVNEQAGRALFYWLIESPVSRNPEKRPLILWLNGGPGCSSVAYGAAEEIGPFHIDSDG  109

Query  387  KTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFP  566
            KTLY NPYSWN  ANLLF++SPAGVG+SY+NTSSD+   GD+RTAED+ +FL+KWFERFP
Sbjct  110  KTLYLNPYSWNNLANLLFLESPAGVGFSYTNTSSDLYNAGDQRTAEDTYQFLVKWFERFP  169

Query  567  QYKGREFYITGESYAGHYVPQLSQ  638
            QYK REFYI GESYAGHYVPQLSQ
Sbjct  170  QYKHREFYIAGESYAGHYVPQLSQ  193



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   252 bits (643),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 147/190 (77%), Gaps = 2/190 (1%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C  F + L  SI  G   +S ++Q+ D +  LPG   NV FAHYSGYVTVN+E+GRALFY
Sbjct  3    CSQFSVFLLLSIFVGICLASTEEQERDRIAKLPGQPENVLFAHYSGYVTVNEEAGRALFY  62

Query  255  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            W  E  A  +PSS+PLVLWLNGGPGCSSI +G AEE+GPF +  DG +LY NPY+WN + 
Sbjct  63   WLVETPASIEPSSRPLVLWLNGGPGCSSIGYGAAEEIGPFRINSDGNSLYSNPYAWNNSV  122

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
             ++F+DSPAGVG+SYSNT+SD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESY
Sbjct  123  VIVFLDSPAGVGFSYSNTTSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYIAGESY  182

Query  609  AGHYVPQLSQ  638
            AGHYVPQLSQ
Sbjct  183  AGHYVPQLSQ  192



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = +3

Query  129  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVL  302
            S ++ Q+ D +  LPG   NV F  YSGYVTVNQ++GRALFYW  EA     P ++PLVL
Sbjct  23   SPLEDQQRDKITSLPGQPVNVEFNQYSGYVTVNQQAGRALFYWLVEAPTSRSPEARPLVL  82

Query  303  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  482
            WLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  ANLLF++SPAGVG+SYSNT
Sbjct  83   WLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLANLLFLESPAGVGFSYSNT  142

Query  483  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  143  SSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFYIAGESYAGHYVPQLSQ  194



>gb|KJB78940.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
 gb|KJB78941.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=375

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 144/189 (76%), Gaps = 6/189 (3%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  258  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFPQYK R+FYI GESYA
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYA  184

Query  612  GHYVPQLSQ  638
            GHYVPQL+Q
Sbjct  185  GHYVPQLAQ  193



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   251 bits (640),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 143/186 (77%), Gaps = 5/186 (3%)
 Frame = +3

Query  87   VLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE  266
            +LLL+    G   +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E
Sbjct  13   ILLLSF---GACFASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVE  69

Query  267  --AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  440
              A   P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF
Sbjct  70   SPAQRGPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLF  129

Query  441  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  620
            ++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFERFPQYK R FYI GESYAGHY
Sbjct  130  LESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRNFYIAGESYAGHY  189

Query  621  VPQLSQ  638
            VPQLSQ
Sbjct  190  VPQLSQ  195



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 150/200 (75%), Gaps = 5/200 (3%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSVD---QQKLDAV-LDLPGLGFNVSFAHYSGYVT  221
            M+   W  +  + L    +     + + D   QQ+ D +   LPG  FN+SF HYSGY+T
Sbjct  1    MANSEWSQIFAITLATIFLCNNNFTFATDPFVQQEHDRIDRPLPGQNFNISFEHYSGYIT  60

Query  222  VNQESGRALFYWFFEAVE-DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLY  398
            VN+++GR LFYWF +A   DP+SKPL+LWLNGGPGCSSIA+G AEE+GPFH+  DGK L+
Sbjct  61   VNEDAGRNLFYWFIQADHVDPTSKPLLLWLNGGPGCSSIAYGEAEEIGPFHINSDGKNLH  120

Query  399  WNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKG  578
            +NPY WN  AN L+++SP GVG+SYS  SSDIL +GDKRTAED+L FLLKWFERFPQYK 
Sbjct  121  FNPYYWNQVANFLYIESPVGVGFSYSKNSSDILNNGDKRTAEDNLIFLLKWFERFPQYKK  180

Query  579  REFYITGESYAGHYVPQLSQ  638
             +F+I+GESYAGHY+PQLSQ
Sbjct  181  TDFFISGESYAGHYIPQLSQ  200



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   250 bits (639),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/196 (63%), Positives = 153/196 (78%), Gaps = 10/196 (5%)
 Frame = +3

Query  57   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  236
            S  ++ C+L + L      GG  +S+ DQ + D +  LPG   NV FA YSGYVTVN+++
Sbjct  5    SPFAFLCILLLFL------GGCFASNQDQVR-DRITQLPGQP-NVGFAQYSGYVTVNRKA  56

Query  237  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
            GRALFYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTA+D+  FL+ WFERFPQYK R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAQDAYAFLVNWFERFPQYKHRDFY  176

Query  591  ITGESYAGHYVPQLSQ  638
            I GESYAGHYVPQLSQ
Sbjct  177  IAGESYAGHYVPQLSQ  192



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  141  QQKLDAV-LDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE-DPSSKPLVLWLNG  314
            QQ+ D +   LPG  FN++F HYSGY+TVN++ GR LFYWF EA   DP+SKPL+LW NG
Sbjct  34   QQEQDRIGTALPGQNFNINFEHYSGYITVNKDVGRTLFYWFIEADHIDPTSKPLLLWFNG  93

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSSIA+G AEE+GPFH+  DG TL+ NPYSWN  AN+L +DSP GVG+SYSN SSDI
Sbjct  94   GPGCSSIAYGEAEEIGPFHINSDGNTLHLNPYSWNQVANILLIDSPVGVGFSYSNASSDI  153

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            L +GDKRT EDSL FLLKWFERFP+YK  +F+I+GESYAGHYVPQLSQ
Sbjct  154  LNNGDKRTTEDSLIFLLKWFERFPRYKETDFFISGESYAGHYVPQLSQ  201



>gb|EYU39591.1| hypothetical protein MIMGU_mgv1a009171mg [Erythranthe guttata]
Length=350

 Score =   247 bits (630),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 145/193 (75%), Gaps = 3/193 (2%)
 Frame = +3

Query  66   SWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRA  245
            S  C + +L L   +  G    + DQ+  D +  LPG   N+ F  YSGYVTVNQ+SGRA
Sbjct  7    SISCSICLLWLNLFVGIGYSLYNADQEN-DRITYLPGQPENIGFDQYSGYVTVNQQSGRA  65

Query  246  LFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  419
            LFYW  EA  +  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N YSWN
Sbjct  66   LFYWLTEAPTNRGPDSRPLVLWLNGGPGCSSVAYGAAEEIGPFRINSDGKTLYSNSYSWN  125

Query  420  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  599
              ANLLF++SPAGVGYSYSNTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI G
Sbjct  126  KLANLLFLESPAGVGYSYSNTSSDLYTVGDQRTAEDAYAFLVNWFERFPQYKHRDFYIAG  185

Query  600  ESYAGHYVPQLSQ  638
            ESYAGHYVPQLSQ
Sbjct  186  ESYAGHYVPQLSQ  198



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = +3

Query  123  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPL  296
             S   D+Q+ D +  LPG   +VSF+H+SGY+TVN+ +GRALFYW  E+    +P SKPL
Sbjct  20   ASCCRDEQEKDRIYHLPGEPNDVSFSHFSGYITVNEPAGRALFYWLTESPPSLNPESKPL  79

Query  297  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  476
            VLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SYS
Sbjct  80   VLWLNGGPGCSSLAYGAAEEIGPFRINPDGKTLYHNPYSWNQLANLLFLESPAGVGFSYS  139

Query  477  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            NT+SD+ T GDKRTAED+  FL+ WFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  140  NTTSDLYTAGDKRTAEDAYVFLVNWFERFPQYKQREFYIAGESYAGHYVPQLSQ  193



>gb|KJB76564.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=333

 Score =   246 bits (629),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  299
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  189



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   250 bits (639),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 141/173 (82%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  299
            SS +  Q+ D ++ LPG   NV F+ YSGYVTVNQ++GRALFYW  EA  +  P S+PLV
Sbjct  23   SSPLQDQERDRIIQLPGQPNNVGFSQYSGYVTVNQQAGRALFYWLVEAPANRRPESRPLV  82

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSS+A+G AEE+GPFH+  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFHIRSDGKTLFLNPYAWNNLANLLFLESPAGVGFSYSN  142

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            TSSD+ T GD+RTAED+  FL+ W ERFPQYK R+FYI GESYAGHYVPQLS+
Sbjct  143  TSSDLYTAGDQRTAEDAYAFLVNWIERFPQYKHRDFYIAGESYAGHYVPQLSK  195



>gb|KJB76565.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=342

 Score =   246 bits (628),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  299
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  189



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 6/189 (3%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  258  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY+NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYFNPYAWNKLAN  124

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFPQYK R+FYI GESYA
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYA  184

Query  612  GHYVPQLSQ  638
            GHYVPQL+Q
Sbjct  185  GHYVPQLAQ  193



>gb|KJB78942.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=422

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 144/189 (76%), Gaps = 6/189 (3%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  258  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFPQYK R+FYI GESYA
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYA  184

Query  612  GHYVPQLSQ  638
            GHYVPQL+Q
Sbjct  185  GHYVPQLAQ  193



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 147/196 (75%), Gaps = 7/196 (4%)
 Frame = +3

Query  57   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  236
            S LS  CLL  L + + I      + ++ Q  D +  LPG   +V F  YSGYVTVNQ+S
Sbjct  4    SLLSILCLLVSLFVYSCI-----CAPLEDQGRDKITYLPGQPGSVEFNQYSGYVTVNQQS  58

Query  237  GRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
            GRALFYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY
Sbjct  59   GRALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPY  118

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            +WN  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FY
Sbjct  119  AWNKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFY  178

Query  591  ITGESYAGHYVPQLSQ  638
            I GESYAGHYVPQLSQ
Sbjct  179  IAGESYAGHYVPQLSQ  194



>gb|KJB78939.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=432

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 144/189 (76%), Gaps = 6/189 (3%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  258  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFPQYK R+FYI GESYA
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYA  184

Query  612  GHYVPQLSQ  638
            GHYVPQL+Q
Sbjct  185  GHYVPQLAQ  193



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 139/171 (81%), Gaps = 0/171 (0%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  305
            S+++  Q  D +  LPG   N +FA YSGYVTV++ +GR LFYW  E+  +P +KPLVLW
Sbjct  20   SAAIANQNNDRITWLPGQPENTNFAQYSGYVTVDKSAGRTLFYWLTESPSNPETKPLVLW  79

Query  306  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  485
            LNGGPGCSSIA+G AEE+GPFH++ DGKTL+ NPYSWN  ANLLF++SPAGVG+SYSN S
Sbjct  80   LNGGPGCSSIAYGAAEEIGPFHIQSDGKTLFLNPYSWNNEANLLFLESPAGVGFSYSNRS  139

Query  486  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SD+ T GD RTA+DS +FL++WF RFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  140  SDLYTVGDSRTAKDSYKFLVRWFNRFPQYKYREFYIAGESYAGHYVPQLSQ  190



>ref|XP_007009788.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
 gb|EOY18598.1| Serine carboxypeptidase-like 27 isoform 2 [Theobroma cacao]
Length=423

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  129  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVL  302
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALFYW  E      P ++PLVL
Sbjct  22   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVL  81

Query  303  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  482
            WLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y+WN  AN+LF++SPAGVG+SYSNT
Sbjct  82   WLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRYAWNNLANMLFLESPAGVGFSYSNT  141

Query  483  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +SD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  142  TSDLYTAGDRRTAEDAYAFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  193



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 141/173 (82%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  299
            +S +  Q+ D + +LPG   NV FA YSGYVTV+Q++GRALFYW  EA     P S+PLV
Sbjct  23   TSPLQDQERDKITELPGQPTNVGFAQYSGYVTVDQQAGRALFYWLTEAPASRRPESRPLV  82

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTL++NPY+WN  AN+LF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFRIHPDGKTLFFNPYAWNNLANILFLESPAGVGFSYSN  142

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            TSSD+ T GD+RTAED+  F++ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  143  TSSDLYTAGDQRTAEDAYTFIVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  195



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/188 (63%), Positives = 145/188 (77%), Gaps = 2/188 (1%)
 Frame = +3

Query  81   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  7    LYLVLLLSICGVVSLASPIEDQKRDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  66

Query  261  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
             EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  67   VEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  126

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+DSPAGVG+SYSN S+D+ T GD++TAED+  FL+ WFERFPQYK REFYI GESYAG
Sbjct  127  LFLDSPAGVGFSYSNKSTDLYTFGDQKTAEDAYTFLVNWFERFPQYKHREFYIAGESYAG  186

Query  615  HYVPQLSQ  638
            HYVPQL Q
Sbjct  187  HYVPQLGQ  194



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 149/189 (79%), Gaps = 3/189 (2%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
              ++ LL + +    GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALFYW
Sbjct  5    FFYLCLLLSLVAISYGSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYW  63

Query  258  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
              E      P+S+PLVLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY NPY+WN  AN
Sbjct  64   LTETPTSRVPNSRPLVLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNPYAWNKLAN  123

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            LLF++SPAGVG+SYSNT+SD+ T GD++TAED+  FL+ WFERFPQYK R+FYI GESYA
Sbjct  124  LLFLESPAGVGFSYSNTTSDLYTAGDQKTAEDAHRFLVNWFERFPQYKHRDFYIAGESYA  183

Query  612  GHYVPQLSQ  638
            GHYVPQLSQ
Sbjct  184  GHYVPQLSQ  192



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = +3

Query  81   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            L+++LL +       +S ++ QK D +  LPG   NV FA YSGYVTVN++SGR+LFYW 
Sbjct  8    LYLVLLLSICGVVSLASPIEDQKKDRITQLPGQPKNVGFAQYSGYVTVNEQSGRSLFYWL  67

Query  261  FEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
             EA     P S+ LVLWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+
Sbjct  68   VEAPVRRGPRSRSLVLWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANV  127

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+DSPAGVG+SYSN ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI GESYAG
Sbjct  128  LFLDSPAGVGFSYSNKTTDLYTFGDQKTAEDAYTFLVNWFERFPQYKHREFYIAGESYAG  187

Query  615  HYVPQLSQ  638
            HYVPQL+Q
Sbjct  188  HYVPQLAQ  195



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 144/189 (76%), Gaps = 6/189 (3%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
             LFVLL   +      SSS   Q LD + +LPG   NV F  YSGYVTVN+E+GRALFYW
Sbjct  9    FLFVLLTCFTC----FSSSFGDQNLDKITELPGQPKNVDFNQYSGYVTVNEEAGRALFYW  64

Query  258  FFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
            F E+     P ++PL+LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPY+WN  AN
Sbjct  65   FIESPLNRRPETRPLILWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYSNPYAWNKLAN  124

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
             LF++SPAGVG+SY+NT+SD+ T GDKRTAED+  FL+ W ERFPQYK R+FYI GESYA
Sbjct  125  TLFLESPAGVGFSYTNTTSDLYTSGDKRTAEDAYVFLVNWLERFPQYKYRDFYIAGESYA  184

Query  612  GHYVPQLSQ  638
            GHYVPQL+Q
Sbjct  185  GHYVPQLAQ  193



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   248 bits (632),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 149/196 (76%), Gaps = 10/196 (5%)
 Frame = +3

Query  57   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  236
            S  ++ C+L + L       G   +S+  Q  D +  LPG   NV FA YSGYVTVN+++
Sbjct  5    SPFAFLCILLLFL-------GGCFASIQDQVRDRITQLPGQP-NVGFAQYSGYVTVNRKA  56

Query  237  GRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
            GRALFYW  E+ E+  P S+PLVLWLNGGPGCSS+A+G AEE+G FH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPENRQPESRPLVLWLNGGPGCSSVAYGAAEEIGAFHIRPDGKTLYLNPY  116

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFERFPQYKHRDFY  176

Query  591  ITGESYAGHYVPQLSQ  638
            I GESYAGHYVPQLSQ
Sbjct  177  IAGESYAGHYVPQLSQ  192



>gb|AFK34623.1| unknown [Lotus japonicus]
Length=174

 Score =   238 bits (608),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 133/166 (80%), Gaps = 3/166 (2%)
 Frame = +3

Query  78   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  248
            +L + ++AT    I+    S    QQ  D V  LPG  FN SFAHYSGY+TVN ++GRAL
Sbjct  9    ILAIAIVATLFLCINFATSSDPFVQQHHDKVGRLPGQNFNTSFAHYSGYITVNDKAGRAL  68

Query  249  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            FYWF EA +DP SKPLVLWLNGGPGCSSIA+G AEE+GPFH++ DGKTLY NPY+WN  A
Sbjct  69   FYWFMEADQDPQSKPLVLWLNGGPGCSSIAYGEAEEIGPFHIKPDGKTLYLNPYAWNQVA  128

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFP  566
            N+LFVD+PAGVG+SYSNTSSD+L HGD++TAEDSL FLLKWFERFP
Sbjct  129  NILFVDAPAGVGFSYSNTSSDLLNHGDRKTAEDSLIFLLKWFERFP  174



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   247 bits (631),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 147/196 (75%), Gaps = 10/196 (5%)
 Frame = +3

Query  57   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  236
            S  ++ C+L + L       G   +SV  Q  D +  LPG    V FA YSGYVTVN+++
Sbjct  5    SPFAFPCILLLFL-------GGCFASVQDQVRDRITQLPGQP-TVGFAQYSGYVTVNRKA  56

Query  237  GRALFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
            GRALFYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFERFPQYKHRDFY  176

Query  591  ITGESYAGHYVPQLSQ  638
            I GESYAGHYVPQLSQ
Sbjct  177  IAGESYAGHYVPQLSQ  192



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   247 bits (631),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = +3

Query  114  GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSS  287
            G   +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S
Sbjct  19   GACFASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPES  78

Query  288  KPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGY  467
            +PLVLWL GGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+
Sbjct  79   RPLVLWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGF  138

Query  468  SYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SY+NTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI G+SYAGHYVPQLSQ
Sbjct  139  SYTNTSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYIAGDSYAGHYVPQLSQ  195



>ref|XP_002534550.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF27834.1| serine carboxypeptidase, putative [Ricinus communis]
Length=385

 Score =   245 bits (625),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 146/189 (77%), Gaps = 3/189 (2%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            L F  LL ++I   +  S+ ++Q+ D ++ LPG   NV F+ YSGYVTV+  +GRALFYW
Sbjct  16   LSFATLLLSTI-SARLISNKEEQERDRIIKLPGQPPNVYFSQYSGYVTVDPLAGRALFYW  74

Query  258  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
              EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTLY NPY+WN  AN
Sbjct  75   LIEAPKMARPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLYLNPYTWNKVAN  134

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            LLF+DSPAGVG+SYSNTSSDI   GDKRT++D+ +FL+ WF+RFPQY  R FYI GESYA
Sbjct  135  LLFLDSPAGVGFSYSNTSSDIYAVGDKRTSQDAHKFLINWFKRFPQYNHRPFYIAGESYA  194

Query  612  GHYVPQLSQ  638
            GHY+P+LSQ
Sbjct  195  GHYIPELSQ  203



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   247 bits (630),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 147/196 (75%), Gaps = 10/196 (5%)
 Frame = +3

Query  57   SALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  236
            S  ++ C+L + L       G   +SV  Q  D +  LPG    V FA YSGYVTVN+++
Sbjct  5    SPFAFPCILLLFL-------GGCFASVQDQVRDRITQLPGQP-TVGFAQYSGYVTVNRKA  56

Query  237  GRALFYWFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
            GRALFYW  E  A   P S+PL+LWLNGGPGCSS+A+G AEE+GPFH+  DGKTLY NPY
Sbjct  57   GRALFYWLTESPANRRPESRPLMLWLNGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPY  116

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            +WN  ANLLF++SPAGVG+SY+NTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FY
Sbjct  117  AWNNLANLLFLESPAGVGFSYTNTSSDLYTAGDQRTAEDAYAFLVNWFERFPQYKHRDFY  176

Query  591  ITGESYAGHYVPQLSQ  638
            I GESYAGHYVPQLSQ
Sbjct  177  IAGESYAGHYVPQLSQ  192



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = +3

Query  114  GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSS  287
            G   +SS+  Q  D +  LPG   NV F  YSGYVT N+++GRALFYW  E  A   P S
Sbjct  19   GACFASSIQDQVRDRITQLPGQPANVGFRQYSGYVTANKQAGRALFYWLVESPAQRGPES  78

Query  288  KPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGY  467
            +PLVLWL GGPGCSS+A+G AEE+GPFH+  DGKTLY NPY+WN  ANLLF++SPAGVG+
Sbjct  79   RPLVLWLTGGPGCSSVAYGAAEEIGPFHIRPDGKTLYLNPYAWNNLANLLFLESPAGVGF  138

Query  468  SYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SY+NTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI G+SYAGHYVPQLSQ
Sbjct  139  SYTNTSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKHRDFYIAGDSYAGHYVPQLSQ  195



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 144/174 (83%), Gaps = 3/174 (2%)
 Frame = +3

Query  123  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPL  296
            GS + +Q++ D +  LPG   NV FA YSGYVTV++++GRALFYW  E      P+S+PL
Sbjct  22   GSYNAEQER-DRITQLPGQPKNVDFAQYSGYVTVDKQAGRALFYWLTETPTSRVPNSRPL  80

Query  297  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  476
            VLWLNGGPGCSS+A+G AEE+GPFH++ DG+TLY NPY+WN  ANLLF++SPAGVG+SYS
Sbjct  81   VLWLNGGPGCSSVAYGAAEEIGPFHIKPDGRTLYLNPYAWNKLANLLFLESPAGVGFSYS  140

Query  477  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            NT+SD+ T GD++TAED+ +FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  141  NTTSDLYTAGDQKTAEDAHKFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  194



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 151/198 (76%), Gaps = 10/198 (5%)
 Frame = +3

Query  51   EMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  230
            + S  ++ C+L +         G   +S+  Q  D + +LPG   NV FA +SGYVTVN+
Sbjct  3    DHSPFAFLCILLLFF-------GACFASIQDQVRDRITNLPGQP-NVGFAQFSGYVTVNK  54

Query  231  ESGRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWN  404
            ++GRALFYW  E+ ++  P S+PLVLWLNGGPGCSS+A+G AEE+GPF +  DGKTLY N
Sbjct  55   KAGRALFYWLIESPKNRGPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLN  114

Query  405  PYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGRE  584
            PY+WN  ANLLF++SPAGVG+SYSNT++D+ T+GD+RTAED+  FL+ WFERFPQYK R+
Sbjct  115  PYTWNNLANLLFLESPAGVGFSYSNTTTDLYTNGDQRTAEDAYAFLINWFERFPQYKHRD  174

Query  585  FYITGESYAGHYVPQLSQ  638
            FYI GESYAGHYVPQLSQ
Sbjct  175  FYIAGESYAGHYVPQLSQ  192



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  299
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  189



>gb|AFK37459.1| unknown [Lotus japonicus]
Length=463

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = +3

Query  48   LEMSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVN  227
            + M   + G LLF+  L  S      SS   +Q+LD +  LPG    V+FA +SGYVTVN
Sbjct  1    MSMVFQTKGLLLFLCALIFSFSCILASSVPKEQELDRISALPGQP-PVTFAQFSGYVTVN  59

Query  228  QESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            +E GRALFYWF EA   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +L+ N 
Sbjct  60   EEHGRALFYWFTEATTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLFLNK  119

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            Y+WN  AN+LF++SPAGVG+SY+NTSSD+ T GDKRTA+D+L FLL+W  RFPQYK REF
Sbjct  120  YAWNKEANILFLESPAGVGFSYTNTSSDLTTSGDKRTAQDALIFLLRWMARFPQYKYREF  179

Query  588  YITGESYAGHYVPQLSQ  638
            YI GESYAGHYVPQL++
Sbjct  180  YIAGESYAGHYVPQLAK  196



>ref|XP_009141517.1| PREDICTED: serine carboxypeptidase-like 28 [Brassica rapa]
Length=469

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 145/190 (76%), Gaps = 2/190 (1%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  248
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  249  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            FYW  EA +   +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+WNL A
Sbjct  76   FYWLTEAPKPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAWNLEA  135

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            NLLF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESY
Sbjct  136  NLLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESY  195

Query  609  AGHYVPQLSQ  638
            AGHY+PQL+Q
Sbjct  196  AGHYIPQLAQ  205



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  299
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  189



>gb|KJB76566.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=484

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  299
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  189



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 140/173 (81%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  299
            SS ++ Q+ D + +LPG   N+ FA YSGYVTVN+++GRALFYW  +  A     S+PLV
Sbjct  21   SSYLEDQERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLVQSPASRGAESRPLV  80

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSN
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLFINPYAWNNLANLLFLESPAGVGFSYSN  140

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  141  TTSDLYTAGDQRTAEDAYTFLINWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  193



>emb|CDY40439.1| BnaA04g20780D [Brassica napus]
Length=469

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 144/190 (76%), Gaps = 2/190 (1%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSS--SVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  248
            C+  + ++   +D    SS  + +Q+  D +L LPG   N++F+ +SGYVTVN  +GRAL
Sbjct  16   CIFLLSMIIALLDVVMSSSEDAKEQKMRDRILSLPGQPPNLNFSQFSGYVTVNSAAGRAL  75

Query  249  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  NPY+WNL A
Sbjct  76   FYWLTEAPTPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNPYAWNLDA  135

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            NLLF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESY
Sbjct  136  NLLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESY  195

Query  609  AGHYVPQLSQ  638
            AGHY+PQL+Q
Sbjct  196  AGHYIPQLAQ  205



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 142/173 (82%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  299
            +S ++ QK D + +LPG   NVSF+ YSGYVTVN++ GRALFYW  E+  +  P ++PLV
Sbjct  21   ASYLEDQKRDRIRELPGQPRNVSFSQYSGYVTVNEQRGRALFYWLTESPVNRVPKARPLV  80

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSS+A+G AEE+GPF +  DGK+LY NPY+WN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKSLYLNPYAWNKLANLLFLESPAGVGFSYTN  140

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GD+RTAED+  FL+KWFERFPQYK R+ YI GESYAGH+VPQLS+
Sbjct  141  TTSDLYTTGDERTAEDAYTFLVKWFERFPQYKHRDLYIVGESYAGHFVPQLSK  193



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 137/172 (80%), Gaps = 2/172 (1%)
 Frame = +3

Query  129  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVL  302
            SS   Q LD + +LPG   NV F  YSGYVTVN+++GRALFYW  E      P ++PLVL
Sbjct  85   SSFGDQNLDKITELPGQPKNVEFNQYSGYVTVNEQAGRALFYWLIELPVSRSPETRPLVL  144

Query  303  WLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  482
            WLNGGPGCSS+A+G AEE+GPFH+  DG+TLY N Y+WN  AN+LF++SPAGVG+SYSNT
Sbjct  145  WLNGGPGCSSLAYGAAEEIGPFHIRPDGRTLYLNRYAWNNLANMLFLESPAGVGFSYSNT  204

Query  483  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +SD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  205  TSDLYTAGDRRTAEDAYAFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  256



>ref|XP_010067291.1| PREDICTED: serine carboxypeptidase-like 28 [Eucalyptus grandis]
 gb|KCW65387.1| hypothetical protein EUGRSUZ_G02817 [Eucalyptus grandis]
Length=467

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLVLWLNG  314
            QQK D ++ LPG   NV+F+ Y+GYVTV+  +GRALFYW  E      P+SKPLVLWLNG
Sbjct  33   QQKKDKIVKLPGQPANVTFSQYAGYVTVDPSAGRALFYWLIEVPRHLRPASKPLVLWLNG  92

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSS+A+G +EEVGPF V  +GKTLY NPY+WN  ANLLF+DSPAGVG+SYSNTSSD+
Sbjct  93   GPGCSSVAYGASEEVGPFRVRPNGKTLYLNPYAWNREANLLFLDSPAGVGFSYSNTSSDV  152

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLS  635
             T GDKRTA+D+  FL+ W ERFPQYK R FYI GESYAGHY+P+LS
Sbjct  153  YTPGDKRTAQDAFTFLMNWLERFPQYKHRPFYIAGESYAGHYIPELS  199



>ref|XP_011040962.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=468

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 145/192 (76%), Gaps = 5/192 (3%)
 Frame = +3

Query  78   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  248
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLHGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  249  FYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  422
            FYW  E   +  P SKPL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY+WN 
Sbjct  72   FYWLIEVPKIVKPKSKPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPYAWNK  131

Query  423  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGE  602
             ANLLF+DSPAGVG+SYSNTSSD  T GDKRTA+D+  FL+ WFERFPQYK R FYI GE
Sbjct  132  VANLLFLDSPAGVGFSYSNTSSDTYTVGDKRTAKDAYTFLVNWFERFPQYKHRPFYIAGE  191

Query  603  SYAGHYVPQLSQ  638
            SYAGHY+P+LS+
Sbjct  192  SYAGHYIPELSR  203



>gb|EPS66906.1| hypothetical protein M569_07869, partial [Genlisea aurea]
Length=410

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 140/186 (75%), Gaps = 2/186 (1%)
 Frame = +3

Query  87   VLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE  266
             LLL  +      S SV  Q+ D +  LPG   N++F  YSGYVTVN  +GRALFYW  E
Sbjct  5    CLLLLNTFVVICCSWSVQDQESDRITYLPGQPENIAFNQYSGYVTVNHTAGRALFYWLTE  64

Query  267  AVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  440
            A  D  P S+PL+LWLNGGPGCSSIA+G AEE+GPF +  +GKTLY N YSWN   NLLF
Sbjct  65   ASVDSVPDSRPLLLWLNGGPGCSSIAYGAAEEIGPFRINSNGKTLYLNSYSWNKLVNLLF  124

Query  441  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  620
            ++SPAGVGYSYSNTSSD+ T GD+RTAEDS  FL+ WFE+FP+YK R+FYI GESYAGHY
Sbjct  125  LESPAGVGYSYSNTSSDLYTAGDRRTAEDSYAFLVSWFEKFPKYKHRDFYIAGESYAGHY  184

Query  621  VPQLSQ  638
            VPQLSQ
Sbjct  185  VPQLSQ  190



>ref|XP_002312023.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
 gb|EEE89390.1| hypothetical protein POPTR_0008s04130g [Populus trichocarpa]
Length=466

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 146/201 (73%), Gaps = 6/201 (3%)
 Frame = +3

Query  54   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  221
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFAILLLSTPAVTTHDHLEEQRRDRIMKLPGQPPNVSFSQFSGYIT  60

Query  222  VNQESGRALFYWFFEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  395
            V+   GRALFYW  EA +   P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLIEAPKTVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  396  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYK  575
            + NPY+WN  ANLLF+DSPAGVG+SYSNTSSDI T GD+RTAED+  FL+ W ERFP+YK
Sbjct  121  HLNPYAWNKVANLLFLDSPAGVGFSYSNTSSDIYTVGDERTAEDAYTFLINWLERFPRYK  180

Query  576  GREFYITGESYAGHYVPQLSQ  638
             R FYI GESYAGHY+P+LS+
Sbjct  181  HRSFYIAGESYAGHYIPELSR  201



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = +3

Query  63   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  242
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  243  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  416
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  417  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  596
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI 
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFERFPQYKHREFYIA  180

Query  597  GESYAGHYVPQLSQ  638
            GESYAGHYVPQL+Q
Sbjct  181  GESYAGHYVPQLAQ  194



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 138/175 (79%), Gaps = 2/175 (1%)
 Frame = +3

Query  120  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKP  293
              S+ V++QK D +++LPG   N+ F  YSGY+TVNQE GRALFYW  E+     P S+P
Sbjct  23   NASTYVEEQKRDRIIELPGQPSNIDFRQYSGYITVNQEHGRALFYWLVESPLTRVPKSRP  82

Query  294  LVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSY  473
            LVLWLNGGPGCSS+A+G AEE+GPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY
Sbjct  83   LVLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLYSKLYAWNKLANLLFLESPAGVGFSY  142

Query  474  SNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            +NT+SD+   GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  143  TNTTSDLYITGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSK  197



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = +3

Query  63   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  242
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  243  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  416
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  417  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  596
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI 
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFERFPQYKHREFYIA  180

Query  597  GESYAGHYVPQLSQ  638
            GESYAGHYVPQL+Q
Sbjct  181  GESYAGHYVPQLAQ  194



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 138/174 (79%), Gaps = 2/174 (1%)
 Frame = +3

Query  123  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPL  296
             SS V++QK D + +LPG   NV F  YSGY+TVN+E GRALFYW  E  A  DP S+PL
Sbjct  19   ASSYVEEQKRDRISELPGQPSNVDFRQYSGYITVNEERGRALFYWLVESPATRDPKSRPL  78

Query  297  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  476
            VLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+
Sbjct  79   VLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYT  138

Query  477  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            NT+SD+ T GD+RTAED+  FL+ W ERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  139  NTTSDLYTTGDQRTAEDAYRFLVNWLERFPQYKHRDFYIVGESYAGHFVPQLSK  192



>ref|XP_004288721.2| PREDICTED: serine carboxypeptidase 24 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 148/190 (78%), Gaps = 3/190 (2%)
 Frame = +3

Query  69   WGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  248
            +  L+F+L L T+      +++  +Q+LD +  LPG    VSF+ YSGYVTVN++ GRAL
Sbjct  17   YSILVFMLSLTTTTINV--AATAKEQELDRITALPGQP-PVSFSQYSGYVTVNKKHGRAL  73

Query  249  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            FYWF EA   P +KPLVLW NGGPGCSS+A+G +EE+GPF + + G +LY N YSWN  A
Sbjct  74   FYWFTEATASPHNKPLVLWFNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNREA  133

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            N+LF++SPAGVG+SY+NTS+D++  GDKRTA+D+L FLL+W  RFPQYK REFYI+GESY
Sbjct  134  NILFLESPAGVGFSYTNTSADLIDSGDKRTAQDALTFLLQWLSRFPQYKYREFYISGESY  193

Query  609  AGHYVPQLSQ  638
            AGHYVPQL++
Sbjct  194  AGHYVPQLAK  203



>gb|KJB76571.1| hypothetical protein B456_012G095000 [Gossypium raimondii]
Length=472

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 141/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            L++ L++ + +          +Q  D ++ LPG   NV F+ YSGY+TV  ++GRALFYW
Sbjct  15   LVYFLVIGSLVVWSAEGGHRKEQARDRIVKLPGQPRNVKFSQYSGYITVEAKAGRALFYW  74

Query  258  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
              EA     P +KPLVLWLNGGPGCSSIA+G +EEVGPF V +DGK+L  NPY+WN  AN
Sbjct  75   LTEAPAKSRPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVREDGKSLRLNPYAWNQEAN  134

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            LLF+DSPAGVG+SYSNTSSDI T GDKRTAED+  FL+KW ERFP YK R FYI GESYA
Sbjct  135  LLFLDSPAGVGFSYSNTSSDIYTAGDKRTAEDAYTFLMKWLERFPNYKHRPFYIAGESYA  194

Query  612  GHYVPQLSQ  638
            GHY+P+LSQ
Sbjct  195  GHYIPELSQ  203



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/194 (59%), Positives = 145/194 (75%), Gaps = 2/194 (1%)
 Frame = +3

Query  63   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  242
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  243  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  416
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  417  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  596
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI 
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEDAYIFLVNWFERFPQYKHREFYIA  180

Query  597  GESYAGHYVPQLSQ  638
            GESYAGHYVPQL+Q
Sbjct  181  GESYAGHYVPQLAQ  194



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 135/173 (78%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  299
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALFYW  E  A   P S+PL+
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLI  80

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNPYSWNKLANLLFLESPAGVGFSYTN  140

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GD RTAED+  FL+ WFERFPQYK  +FYI GESYAGHYVPQLSQ
Sbjct  141  TTSDLYTAGDGRTAEDAYTFLVNWFERFPQYKHTDFYIAGESYAGHYVPQLSQ  193



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   242 bits (618),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 135/173 (78%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLV  299
            S S+  Q  D +  LPG   NV F  YSGYV+VNQ++GRALFYW  E  A   P S+PL+
Sbjct  21   SYSLADQDKDKITVLPGQPTNVDFNQYSGYVSVNQQAGRALFYWLIESPASRKPESRPLI  80

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSS+A+G AEE+GPF +  DGKTLY NPYSWN  ANLLF++SPAGVG+SY+N
Sbjct  81   LWLNGGPGCSSVAYGAAEEIGPFRIRPDGKTLYLNPYSWNKLANLLFLESPAGVGFSYTN  140

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GD RTAED+  FL+ WFERFPQYK  +FYI GESYAGHYVPQLSQ
Sbjct  141  TTSDLYTAGDGRTAEDAYTFLVNWFERFPQYKHTDFYIAGESYAGHYVPQLSQ  193



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   242 bits (617),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = +3

Query  144  QKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNGG  317
            Q+ D + +LPG   N+ FA YSGYVTVN+++GRALFYW  +  A     S+PLVLWLNGG
Sbjct  23   QERDRITELPGQPKNIGFAQYSGYVTVNKQAGRALFYWLVQSPASRGAESRPLVLWLNGG  82

Query  318  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  497
            PGCSS+A+G AEE+GPF +  DGKTL+ NPY+WN  ANLLF++SPAGVG+SYSNT+SD+ 
Sbjct  83   PGCSSVAYGAAEEIGPFRIRPDGKTLFINPYAWNNLANLLFLESPAGVGFSYSNTTSDLY  142

Query  498  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T GD+RTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  143  TAGDQRTAEDAYTFLINWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  189



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 136/173 (79%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  299
            S+    Q  D + +LPG   NV F  YSGYVT+NQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTSDKITELPGQPKNVGFNQYSGYVTLNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  AN+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWNNLANVLFLESPAGVGFSYTN  136

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  137  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  189



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNG  314
            +++ D + +LPG   N  FA YSGYVTVN+++GRALFYW  E  A   P S+PLVLWLNG
Sbjct  37   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNG  96

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSS+A+GLAEE+GPF +  DGKTLY NPY+W+  ANLLF++SPAG+G+SY+NT+SD+
Sbjct  97   GPGCSSVAYGLAEEIGPFRIRPDGKTLYSNPYAWSKLANLLFLESPAGIGFSYTNTTSDL  156

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             T GD+RTAED+  FL+ WFERFP+YK R+FYI GESYAGHYVPQLSQ
Sbjct  157  YTTGDQRTAEDAYAFLVNWFERFPEYKHRDFYIAGESYAGHYVPQLSQ  204



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 143/189 (76%), Gaps = 2/189 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
             L ++LL T       SS V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW
Sbjct  5    FLVIILLFTISSSWSASSYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYW  64

Query  258  FFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
              E+    DP S+PLVLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  AN
Sbjct  65   LVESPLTRDPKSRPLVLWLNGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLAN  124

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            LLF+++PAGVG+SYSNTSSD+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYA
Sbjct  125  LLFLEAPAGVGFSYSNTSSDLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIIGESYA  184

Query  612  GHYVPQLSQ  638
            GH+VPQLS+
Sbjct  185  GHFVPQLSK  193



>ref|XP_007009790.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
 gb|EOY18600.1| Serine carboxypeptidase-like 28 [Theobroma cacao]
Length=464

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 137/174 (79%), Gaps = 2/174 (1%)
 Frame = +3

Query  123  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  296
            G +   +Q+ D ++ LPG    V+F+ YSGY+TV+ ++GRALFYW  +A     P+SKPL
Sbjct  22   GGNHRKEQERDRIVKLPGQPPKVNFSQYSGYITVDPKAGRALFYWLIKAPFKSQPASKPL  81

Query  297  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  476
            VLWLNGGPGCSS+A+G +EEVGPF V  DGKTL  NPY+WN  ANLLF+DSPAGVG+SYS
Sbjct  82   VLWLNGGPGCSSVAYGASEEVGPFRVRSDGKTLRLNPYAWNQEANLLFLDSPAGVGFSYS  141

Query  477  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            NTSSDI T GDKRTAED+  FL+KW ERFP YK R FYI GESYAGHY+P+LSQ
Sbjct  142  NTSSDIYTVGDKRTAEDAYTFLIKWLERFPNYKHRPFYIAGESYAGHYIPELSQ  195



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  308
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+A+G  EEVGPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSK  195



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 137/173 (79%), Gaps = 3/173 (2%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  299
            S+    Q LD + +LPG   NV F  YSGYVTVNQ++GRALFYW  E+     P S+PLV
Sbjct  17   STCFGDQTLDKITELPGQPKNVGFNQYSGYVTVNQQAGRALFYWLIESPVSRKPESRPLV  76

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+G AEE+GPF +  DGKTLY N Y+WN  +N+LF++SPAGVG+SY+N
Sbjct  77   LWLNGGPGCSSIAYGAAEEIGPFRIRPDGKTLYLNRYAWN-NSNVLFLESPAGVGFSYTN  135

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GDKRTAED+  FL+ WFERFPQYK R+FYI GESYAGHYVPQLSQ
Sbjct  136  TTSDLYTTGDKRTAEDAYVFLVNWFERFPQYKHRDFYIAGESYAGHYVPQLSQ  188



>emb|CBI31484.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 149/197 (76%), Gaps = 5/197 (3%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  233
             S+L +  L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  
Sbjct  21   FSSLFFCVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPR  77

Query  234  SGRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            +GRALFYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NP
Sbjct  78   AGRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNP  137

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            Y+WN  ANLLF+DSPAGVG+SYSNTSSD+   GDKRTA+D+ +FL+ W +RFPQYK R F
Sbjct  138  YAWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKRTAKDAYKFLINWLQRFPQYKHRPF  197

Query  588  YITGESYAGHYVPQLSQ  638
            YI GESYAGHY+P+LSQ
Sbjct  198  YIAGESYAGHYIPELSQ  214



>ref|XP_004496293.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X2 [Cicer 
arietinum]
Length=419

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 139/173 (80%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  299
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALFYW  E+  +  P+ +PLV
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLIESPMNRGPNLRPLV  83

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+LF+DSPAGVG+SY N
Sbjct  84   LWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANILFLDSPAGVGFSYCN  143

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI GESYAGHYVPQL+Q
Sbjct  144  KTTDLYTFGDQKTAEDAYVFLVNWFERFPQYKHREFYIAGESYAGHYVPQLAQ  196



>ref|XP_002274699.1| PREDICTED: serine carboxypeptidase-like 28 [Vitis vinifera]
Length=472

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 149/197 (76%), Gaps = 5/197 (3%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  233
             S+L +  L F +LL +S   G  + + + Q  D ++ LPG   NV F+ YSGY+TV+  
Sbjct  10   FSSLFFCVLGFFILLVSS---GATAGNREDQVRDRIVKLPGEPPNVGFSQYSGYITVDPR  66

Query  234  SGRALFYWFFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNP  407
            +GRALFYW  EA +   P+S+PL+LWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NP
Sbjct  67   AGRALFYWLIEAPKSRGPASRPLILWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNP  126

Query  408  YSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREF  587
            Y+WN  ANLLF+DSPAGVG+SYSNTSSD+   GDKRTA+D+ +FL+ W +RFPQYK R F
Sbjct  127  YAWNAEANLLFLDSPAGVGFSYSNTSSDLPNVGDKRTAKDAYKFLINWLQRFPQYKHRPF  186

Query  588  YITGESYAGHYVPQLSQ  638
            YI GESYAGHY+P+LSQ
Sbjct  187  YIAGESYAGHYIPELSQ  203



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  308
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+A+G  EEVGPF V  DGKTLY   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGATEEVGPFRVGSDGKTLYNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSK  195



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 143/194 (74%), Gaps = 7/194 (4%)
 Frame = +3

Query  63   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  242
            LS  CLL    + + I      +  + Q  D +  LPG   +  F  YSGYVTV ++SGR
Sbjct  6    LSILCLLVSPFVYSCI-----CAPFEDQGRDKITYLPGQPGSAEFNQYSGYVTVKKQSGR  60

Query  243  ALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  416
            ALFYW  EA     P S+PLVLWLNGGPGCSS+A+G AEE+GPF + +DGKTLY NPY+W
Sbjct  61   ALFYWLVEAPTSRRPESRPLVLWLNGGPGCSSVAYGAAEEIGPFRIRRDGKTLYSNPYAW  120

Query  417  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  596
            N  ANLLF++SPAGVG+SYSNTSSD+ T GD+RTAED+  FL+ WFERFPQYK R+FYI 
Sbjct  121  NKLANLLFLESPAGVGFSYSNTSSDLYTAGDQRTAEDAYTFLVNWFERFPQYKYRDFYIA  180

Query  597  GESYAGHYVPQLSQ  638
            GESYAGHYVPQLSQ
Sbjct  181  GESYAGHYVPQLSQ  194



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  308
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+A+G AEEVGPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGAAEEVGPFRVGSDGKTLHNKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSK  195



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 138/173 (80%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLV  299
            SS V++Q  D + +LPG   NV F  YSGYVTV++E GRALFYW  E+    DP S+PLV
Sbjct  23   SSYVEEQLRDRISNLPGQPSNVDFRQYSGYVTVHEERGRALFYWLVESPLARDPKSRPLV  82

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSN
Sbjct  83   LWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHSKLYAWNKLANLLFLESPAGVGFSYSN  142

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            T+SD+ T GD+RTAEDS  FL+ WFERFPQYK REFYI GESYAGH+VPQLS+
Sbjct  143  TTSDLYTTGDQRTAEDSYIFLVNWFERFPQYKHREFYIVGESYAGHFVPQLSK  195



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = +3

Query  129  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  308
            S  +QQ+ D V  LPG    V FA YSGYVTV   +GRALFYW  EA       PLVLWL
Sbjct  40   SPAEQQEQDRVARLPGQP-RVDFAQYSGYVTVEARAGRALFYWLVEAPPSAQPAPLVLWL  98

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSSIA+G +EE+GPF ++ DGKTLY NPY+WN  AN+LF+DSPAGVG+SY+NTSS
Sbjct  99   NGGPGCSSIAYGASEELGPFRIDSDGKTLYLNPYAWNTVANVLFLDSPAGVGFSYTNTSS  158

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+ T GD RTA D+  FL+KWFERFPQYK REFYI GESYAGHYVPQLSQ
Sbjct  159  DLHTSGDHRTAVDAYNFLVKWFERFPQYKHREFYIAGESYAGHYVPQLSQ  208



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 136/170 (80%), Gaps = 2/170 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  308
            V++QK D +  LPG   NV F  YSGYVTVN++ GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQKRDRITQLPGQPSNVDFRQYSGYVTVNEQRGRALFYWLVESPTTRDPKSRPLVLWL  85

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+A+G AEEVGPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SY+N++S
Sbjct  86   NGGPGCSSVAYGAAEEVGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYTNSTS  145

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSK  195



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   242 bits (618),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 138/168 (82%), Gaps = 2/168 (1%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE--AVEDPSSKPLVLWLNG  314
            +++ D + +LPG   N  FA YSGYVTVN+++GRALFYW  E  A   P S+PLVLWLNG
Sbjct  98   ERERDRIGELPGQPPNAGFAQYSGYVTVNRQAGRALFYWLVESPASRRPESRPLVLWLNG  157

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSS+A+GLAEE+GPF +  DGKTLY NPY+W+  ANLLF++SPAG+G+SY+NT+SD+
Sbjct  158  GPGCSSVAYGLAEEIGPFRIRPDGKTLYSNPYAWSKLANLLFLESPAGIGFSYTNTTSDL  217

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             T GD+RTAED+  FL+ WFERFP+YK R+FYI GESYAGHYVPQLSQ
Sbjct  218  YTTGDQRTAEDAYAFLVNWFERFPEYKHRDFYIAGESYAGHYVPQLSQ  265



>ref|XP_011031766.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=466

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 145/201 (72%), Gaps = 6/201 (3%)
 Frame = +3

Query  54   MSALSWGCLLFVLL----LATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVT  221
            M   S  C LF +L    L  S         +++Q+ D ++ LPG   NVSF+ +SGY+T
Sbjct  1    MRIKSSSCFLFSVLNFATLLLSTPAVTNHDHLEEQRRDRIIKLPGQPPNVSFSQFSGYIT  60

Query  222  VNQESGRALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTL  395
            V+   GRALFYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DG+TL
Sbjct  61   VDPVEGRALFYWLNEAPKIVKPRSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGETL  120

Query  396  YWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYK  575
            + NPY+WN  ANLLF+DSPAGVG+SYSNTSSD+ T GD RTA+D+  FL+ W ERFP+YK
Sbjct  121  HLNPYAWNKVANLLFLDSPAGVGFSYSNTSSDVYTVGDGRTAKDAYTFLINWLERFPRYK  180

Query  576  GREFYITGESYAGHYVPQLSQ  638
             R FYI GESYAGHY+P+LS+
Sbjct  181  HRPFYIAGESYAGHYIPELSR  201



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 139/173 (80%), Gaps = 2/173 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVED--PSSKPLV  299
            S+S++ Q+ D +  LPG   NV F  YSGYVTVN+E+ RALFYW  E+  +  P+ +PLV
Sbjct  24   SASMEDQRRDKIKLLPGQPKNVGFEQYSGYVTVNEENERALFYWLIESPMNRGPNLRPLV  83

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+G +EE+GPFH+  DGK+LY NPY+WN  AN+LF+DSPAGVG+SY N
Sbjct  84   LWLNGGPGCSSIAYGASEEIGPFHIRPDGKSLYLNPYAWNNLANILFLDSPAGVGFSYCN  143

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             ++D+ T GD++TAED+  FL+ WFERFPQYK REFYI GESYAGHYVPQL+Q
Sbjct  144  KTTDLYTFGDQKTAEDAYVFLVNWFERFPQYKHREFYIAGESYAGHYVPQLAQ  196



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  308
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWL  85

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNTSS
Sbjct  86   NGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTSS  145

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  146  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIIGESYAGHFVPQLSK  195



>ref|XP_010260054.1| PREDICTED: serine carboxypeptidase-like 25 isoform X2 [Nelumbo 
nucifera]
Length=421

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  305
            SSS ++++ D +  LPG   NVSF  +SGYVTV+Q +GRALFYW  EAV+DP SKPLV+W
Sbjct  22   SSSHEEEEADRITALPGQP-NVSFQQFSGYVTVDQVAGRALFYWLTEAVQDPVSKPLVVW  80

Query  306  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  485
            LNGGPGCSS+A+G +EE+GPF + + G  LY N +SWN+ ANLLF+++PAGVG+SY+N S
Sbjct  81   LNGGPGCSSVAYGASEEIGPFRLNRSGSGLYINKFSWNILANLLFLETPAGVGFSYTNRS  140

Query  486  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SD+L  GD+RTA+DSLEFL++W +RFP+YK RE Y+TGESYAGHYVPQL++
Sbjct  141  SDLLDTGDQRTAKDSLEFLIRWLDRFPRYKNREVYLTGESYAGHYVPQLAR  191



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  308
            V++Q  D +  LPG   NV F  YSGYVTVN+E GRALFYW  E+    DP S+PLVLWL
Sbjct  26   VEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEERGRALFYWLVESPLTRDPKSRPLVLWL  85

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNTSS
Sbjct  86   NGGPGCSSVAYGGAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTSS  145

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  146  DLYTTGDQRTAEDSYRFLVSWFERFPQYKHRDFYIIGESYAGHFVPQLSK  195



>ref|XP_009399563.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=458

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = +3

Query  129  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  308
            ++ D+Q LD +  LPG    VSFA ++GYVTVNQE GRALFYW  EAV D + KPLVLWL
Sbjct  22   AAADRQALDRISALPGQP-RVSFAQFAGYVTVNQERGRALFYWLTEAVTDAAKKPLVLWL  80

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+A+G +EE+GPF +++ G +LY N +SWN  ANLLF++SPAGVG+SY+N SS
Sbjct  81   NGGPGCSSVAYGASEEIGPFRIDRTGSSLYLNKFSWNREANLLFLESPAGVGFSYANVSS  140

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+ + GD+RTA+D+L FL++W  RFP+YK REFYI+GESYAGHYVPQL++
Sbjct  141  DLQSVGDERTAQDALAFLIRWMSRFPEYKHREFYISGESYAGHYVPQLAR  190



>ref|XP_002315293.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
 gb|EEF01464.2| hypothetical protein POPTR_0010s22700g [Populus trichocarpa]
Length=469

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 145/193 (75%), Gaps = 6/193 (3%)
 Frame = +3

Query  78   LLFVLLLAT---SIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  248
            LL+VL LAT   S         +++Q+ D ++ L G   NVSF+ +SGY+TV+  +GRAL
Sbjct  12   LLYVLNLATLLLSTIAATNHGHLEEQRRDKIIKLQGQPPNVSFSQFSGYITVDPLAGRAL  71

Query  249  FYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  422
            FYW  EA  +  P SKPLVLWLNGGPGCSS+A+G +EEVGPF V  DGKTL+ NPY+WN 
Sbjct  72   FYWLIEAPKIVKPKSKPLVLWLNGGPGCSSVAYGASEEVGPFRVRPDGKTLHLNPYAWNK  131

Query  423  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGE  602
             ANLLF+DSPAGVG+SYSNTSSD  T GDKRTA+D+  FL+ WFERF QYK R FYI GE
Sbjct  132  VANLLFLDSPAGVGFSYSNTSSDTYTVGDKRTAKDAYTFLVNWFERFTQYKHRPFYIAGE  191

Query  603  SYA-GHYVPQLSQ  638
            SYA GHY+P+LS+
Sbjct  192  SYAGGHYIPELSR  204



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 143/194 (74%), Gaps = 2/194 (1%)
 Frame = +3

Query  63   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  242
            + +     VL ++    G   +SS++ QK D +  LPG   NV F  YSGYVTVN++SGR
Sbjct  1    MGYSIFYIVLFVSIFCVGISLASSIEDQKRDKIRQLPGQPKNVGFEQYSGYVTVNEQSGR  60

Query  243  ALFYWFFEAV--EDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  416
            ALFYW  EA     P+S+PLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+L+ N Y+W
Sbjct  61   ALFYWLIEAPLNRGPNSRPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLFLNRYAW  120

Query  417  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  596
            N  AN+LF+DSPAGVG+SY N ++D+ T GD++TAE +  FL+ WFERFPQYK REFYI 
Sbjct  121  NNLANILFLDSPAGVGFSYCNKTTDLYTFGDQKTAEGAYIFLVNWFERFPQYKHREFYIA  180

Query  597  GESYAGHYVPQLSQ  638
            GESY GHYVPQL+Q
Sbjct  181  GESYVGHYVPQLAQ  194



>ref|XP_010260044.1| PREDICTED: serine carboxypeptidase-like 25 isoform X1 [Nelumbo 
nucifera]
Length=462

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 142/171 (83%), Gaps = 1/171 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  305
            SSS ++++ D +  LPG   NVSF  +SGYVTV+Q +GRALFYW  EAV+DP SKPLV+W
Sbjct  22   SSSHEEEEADRITALPGQP-NVSFQQFSGYVTVDQVAGRALFYWLTEAVQDPVSKPLVVW  80

Query  306  LNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTS  485
            LNGGPGCSS+A+G +EE+GPF + + G  LY N +SWN+ ANLLF+++PAGVG+SY+N S
Sbjct  81   LNGGPGCSSVAYGASEEIGPFRLNRSGSGLYINKFSWNILANLLFLETPAGVGFSYTNRS  140

Query  486  SDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SD+L  GD+RTA+DSLEFL++W +RFP+YK RE Y+TGESYAGHYVPQL++
Sbjct  141  SDLLDTGDQRTAKDSLEFLIRWLDRFPRYKNREVYLTGESYAGHYVPQLAR  191



>ref|XP_006297634.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30532.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=434

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  308
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALFYW  E+     P S+PLVLWL
Sbjct  29   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWL  88

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNT+S
Sbjct  89   NGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTTS  148

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  149  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSK  198



>ref|XP_010505097.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=469

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 141/190 (74%), Gaps = 2/190 (1%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  248
            C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVTV+  +GRAL
Sbjct  12   CMFLVCMMIALLDVVSSSDDADKEQKTKDKIISLPGQPPNLNFSQFSGYVTVDSTAGRAL  71

Query  249  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF +  DGKTL +N Y+WN  A
Sbjct  72   FYWLTEAPRPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRINPDGKTLRFNIYAWNKVA  131

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            N+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESY
Sbjct  132  NVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESY  191

Query  609  AGHYVPQLSQ  638
            AGHY+P+L+Q
Sbjct  192  AGHYIPELAQ  201



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 140/186 (75%), Gaps = 1/186 (1%)
 Frame = +3

Query  81   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            + +LLL  S+      +  +QQ+LD +  LPG    V FA YSGYVTV+  +GRALFYW 
Sbjct  25   MCLLLLVGSLAAAAACTPAEQQELDRIARLPGQP-PVDFAQYSGYVTVDARAGRALFYWL  83

Query  261  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  440
             EA       PLVLWLNGGPGCSS+A+G +EE+GPF +  DGKTLY NPY+WN  AN+LF
Sbjct  84   VEAAPAAQPAPLVLWLNGGPGCSSVAYGASEELGPFRIRSDGKTLYLNPYAWNTVANVLF  143

Query  441  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  620
            ++SPAGVG+SYSNTSSD+ T GD RTA D+ +FL+ WFERFPQYK REFYI GESYAGHY
Sbjct  144  LESPAGVGFSYSNTSSDLYTAGDNRTAADAYKFLVNWFERFPQYKHREFYIAGESYAGHY  203

Query  621  VPQLSQ  638
            VPQLSQ
Sbjct  204  VPQLSQ  209



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 139/187 (74%), Gaps = 1/187 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            L F L LA  ++ G        +  D +  LPG    V F+ YSGYVTVN  +GRALFYW
Sbjct  29   LSFSLTLALVLNYGVVGGLAASRASDRIYRLPGQP-PVGFSQYSGYVTVNARAGRALFYW  87

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
            F EA       PLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL+ NPY+WN  ANLL
Sbjct  88   FIEAPPATQPAPLVLWLNGGPGCSSIAYGASEEIGPFRIHPDGKTLFLNPYAWNSEANLL  147

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F+DSPAGVG+SYSNTSSD+ T GD+RTA D+ +FLL WFERFPQYK R+FYI+GESYAGH
Sbjct  148  FLDSPAGVGFSYSNTSSDLYTAGDQRTAIDAYKFLLNWFERFPQYKYRDFYISGESYAGH  207

Query  618  YVPQLSQ  638
            YVPQLSQ
Sbjct  208  YVPQLSQ  214



>gb|KDO48446.1| hypothetical protein CISIN_1g016137mg [Citrus sinensis]
Length=394

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            LL VL LA  +     S+   +Q+ D ++ LPG   NV+F+ YSGY+TV++++GRALFYW
Sbjct  12   LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW  71

Query  258  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
              EA  D  P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V +DGK L  NPY+WN  AN
Sbjct  72   LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNKEAN  131

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            +LF+DSPAGVG+SY+ T  DI T GDKRT +D+  FL+ WF RFPQYK R FY+ GESYA
Sbjct  132  ILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYA  191

Query  612  GHYVPQLSQ  638
            GHY+P+L Q
Sbjct  192  GHYIPELCQ  200



>ref|XP_009792407.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana sylvestris]
Length=468

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 2/187 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            LL +L L  +I+    +S   +Q+ D ++ LPG    V+F+ +SGYVTVN+  GRALFYW
Sbjct  16   LLIILSLTITINN-VAASLTKEQEFDRIISLPGQP-PVTFSQFSGYVTVNENHGRALFYW  73

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
              EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN  AN+L
Sbjct  74   LTEATTQPEKKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWNKVANIL  133

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F++SPAGVG+SY+NTSSD+   GDKRTA+D+L FL++W  RFPQYK R+FYI+GESYAGH
Sbjct  134  FLESPAGVGFSYTNTSSDLKDSGDKRTAQDALIFLIRWMSRFPQYKYRDFYISGESYAGH  193

Query  618  YVPQLSQ  638
            Y PQL+Q
Sbjct  194  YGPQLAQ  200



>ref|XP_002280058.1| PREDICTED: serine carboxypeptidase-like 25 [Vitis vinifera]
Length=473

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 143/196 (73%), Gaps = 5/196 (3%)
 Frame = +3

Query  63   LSWGCLLFVLLLATSIDGG----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  230
            +S   +L  LLL   +D G     G    ++++ D +  LPG    VSF  YSGYVTVN 
Sbjct  8    ISASMVLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNH  66

Query  231  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
             +GRALFYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +
Sbjct  67   VAGRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKF  126

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            SWN  ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSL FL++W ERFP+YK RE Y
Sbjct  127  SWNTLANLLFLETPAGVGFSYSNKSSDLLDTGDRRTAKDSLVFLVRWLERFPRYKHREVY  186

Query  591  ITGESYAGHYVPQLSQ  638
            I GESYAGHYVPQL++
Sbjct  187  INGESYAGHYVPQLAR  202



>emb|CBI21207.3| unnamed protein product [Vitis vinifera]
Length=471

 Score =   237 bits (605),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 143/196 (73%), Gaps = 5/196 (3%)
 Frame = +3

Query  63   LSWGCLLFVLLLATSIDGG----KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  230
            +S   +L  LLL   +D G     G    ++++ D +  LPG    VSF  YSGYVTVN 
Sbjct  6    ISASMVLLSLLLIAVVDAGSHGVNGVRGGEEEEADRITALPGQP-KVSFQQYSGYVTVNH  64

Query  231  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
             +GRALFYW  EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +
Sbjct  65   VAGRALFYWLNEAVHDPLSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKF  124

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            SWN  ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSL FL++W ERFP+YK RE Y
Sbjct  125  SWNTLANLLFLETPAGVGFSYSNKSSDLLDTGDRRTAKDSLVFLVRWLERFPRYKHREVY  184

Query  591  ITGESYAGHYVPQLSQ  638
            I GESYAGHYVPQL++
Sbjct  185  INGESYAGHYVPQLAR  200



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPLVLWL  308
            V++Q  D + +LPG   NV F  YSGYVTVN++ GRALFYW  E+     P S+PLVLWL
Sbjct  27   VEEQLRDRISELPGQPSNVDFRQYSGYVTVNEKRGRALFYWLVESPLTRSPKSRPLVLWL  86

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYSNT+S
Sbjct  87   NGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNKLANLLFLESPAGVGFSYSNTTS  146

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  147  DLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSK  196



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 142/184 (77%), Gaps = 0/184 (0%)
 Frame = +3

Query  87   VLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFE  266
             +LL T++         + ++ D + +LPG   NV F+ YSGYVTV+Q++GRALFYW  E
Sbjct  10   TILLTTALFIFFFCCRAEDEEGDKISELPGQPGNVGFSQYSGYVTVDQDAGRALFYWLVE  69

Query  267  AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVD  446
            A    ++ PL+LWLNGGPGCSSIA+G AEE+GPF +  +G+TL+ NPYSWN  ANLLF+D
Sbjct  70   AEAAAATAPLILWLNGGPGCSSIAYGSAEEIGPFRIHPNGRTLFSNPYSWNKLANLLFLD  129

Query  447  SPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVP  626
            SPAGVGYSY+NT+SD+ T GD+RTAEDS  FLL W ERFP+YK REFYI GESYAGHY+P
Sbjct  130  SPAGVGYSYTNTTSDLYTTGDQRTAEDSYAFLLNWLERFPRYKHREFYIVGESYAGHYIP  189

Query  627  QLSQ  638
            QLSQ
Sbjct  190  QLSQ  193



>ref|NP_181120.2| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
 sp|Q8S8K6.2|SCP28_ARATH RecName: Full=Serine carboxypeptidase-like 28; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEC09159.1| serine carboxypeptidase-like 28 [Arabidopsis thaliana]
Length=462

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 140/188 (74%), Gaps = 5/188 (3%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALFY
Sbjct  15   CMVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFY  69

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            W  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+
Sbjct  70   WLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANV  129

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESYAG
Sbjct  130  LFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYIAGESYAG  189

Query  615  HYVPQLSQ  638
            HY+P+L+Q
Sbjct  190  HYIPELAQ  197



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNV-SFAHYSGYVTVNQESGRALFY  254
            L+F+       +   G SS D Q+ D +++LPG   NV  F+ YSGYVTV+Q +GRALFY
Sbjct  10   LMFLGFCLLIWEAEAGISSSDDQERDRIIELPGEPANVVDFSQYSGYVTVDQNAGRALFY  69

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            W  E+   PS +PLVLWLNGGPGCSS+A+G AEE+GPFH+  DGK+L+ NPY+WN  AN+
Sbjct  70   WLTESPTRPSLRPLVLWLNGGPGCSSVAYGAAEELGPFHINPDGKSLFLNPYAWNKLANI  129

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+DSPAGVG+SYSN+SSD+   GD +TA D+  FL+ W  RFPQYK REFYI GESYAG
Sbjct  130  LFLDSPAGVGFSYSNSSSDLKHPGDNQTAADAYAFLVNWLGRFPQYKYREFYIAGESYAG  189

Query  615  HYVPQLSQ  638
            HYVPQL+Q
Sbjct  190  HYVPQLAQ  197



>ref|XP_006436272.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
 ref|XP_006485877.1| PREDICTED: serine carboxypeptidase-like 28-like [Citrus sinensis]
 gb|ESR49512.1| hypothetical protein CICLE_v10031437mg [Citrus clementina]
Length=468

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 142/189 (75%), Gaps = 2/189 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            LL VL LA  +     S+   +Q+ D ++ LPG   NV+F+ YSGY+TV++++GRALFYW
Sbjct  12   LLCVLGLAIVLFPSPVSAIFKEQEKDRIIKLPGQPPNVNFSQYSGYITVDRKAGRALFYW  71

Query  258  FFEAVED--PSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
              EA  D  P+SKPLVLWLNGGPGCSS+A+G +EEVGPF V +DGK L  NPY+WN  AN
Sbjct  72   LVEAPVDRQPASKPLVLWLNGGPGCSSVAYGASEEVGPFRVRRDGKRLKLNPYAWNREAN  131

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            +LF+DSPAGVG+SY+ T  DI T GDKRT +D+  FL+ WF RFPQYK R FY+ GESYA
Sbjct  132  ILFLDSPAGVGFSYTKTREDIYTVGDKRTGKDAYTFLVNWFVRFPQYKHRPFYLAGESYA  191

Query  612  GHYVPQLSQ  638
            GHY+P+L Q
Sbjct  192  GHYIPELCQ  200



>dbj|BAK05698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=372

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 140/194 (72%), Gaps = 6/194 (3%)
 Frame = +3

Query  72   GCLLFV--LLLATSIDGGKGSSSVD---QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQES  236
            GC L +  LLL  ++ GG G+   +   QQ  D V  LPG    V FA Y+GYVTV++  
Sbjct  18   GCFLGLAFLLLCGAVRGGGGAPDAEAARQQAADRVGRLPGQP-AVKFAQYAGYVTVDEAH  76

Query  237  GRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  416
            GRALFYWFFEA    + KPLVLWLNGGPGCSSI +G AEE+GPF V+K    L WNPYSW
Sbjct  77   GRALFYWFFEATAGAAKKPLVLWLNGGPGCSSIGYGEAEELGPFLVQKGKPELKWNPYSW  136

Query  417  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  596
            N  ANL+F++SP GVG+SY+NTSSD+   GDK TA D+  FLL WF+RFPQYK  EFYI 
Sbjct  137  NKEANLMFLESPVGVGFSYTNTSSDLGKLGDKITAADAYVFLLNWFKRFPQYKHHEFYIA  196

Query  597  GESYAGHYVPQLSQ  638
            GESYAGHYVPQLS+
Sbjct  197  GESYAGHYVPQLSE  210



>ref|XP_010265559.1| PREDICTED: serine carboxypeptidase 24-like isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 146/193 (76%), Gaps = 5/193 (3%)
 Frame = +3

Query  60   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  239
            A  W  +L +L ++     G G S+ +Q+ LD +  LPG    V+F+ YSGY+TV+   G
Sbjct  2    ASQWRTILMILFISLI---GVGESATEQE-LDRISALPGQP-QVTFSQYSGYITVDSTHG  56

Query  240  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  419
            RALFYWF EA  DP +KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSWN
Sbjct  57   RALFYWFTEATTDPQNKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNKYSWN  116

Query  420  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  599
              AN+LF++SPAGVG+SY+NTSS++   GD+RTA ++  F+++W  RFPQYK R+FYI+G
Sbjct  117  KEANILFLESPAGVGFSYTNTSSELKHSGDRRTAREAFLFMVRWMTRFPQYKYRDFYISG  176

Query  600  ESYAGHYVPQLSQ  638
            ESYAGHYVPQL++
Sbjct  177  ESYAGHYVPQLAK  189



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +3

Query  123  GSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEA--VEDPSSKPL  296
             +S V++Q  D +  LPG   NV F  YSGYVTVN+  GRALFYW  E+    DP  +PL
Sbjct  19   NASYVEEQLRDRISKLPGQPSNVDFRQYSGYVTVNEVRGRALFYWLVESPSTRDPKFRPL  78

Query  297  VLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYS  476
            VLWLNGGPGCSS+A+G AEE+GPF V  DGKTL+   Y+WN  ANLLF++SPAGVG+SYS
Sbjct  79   VLWLNGGPGCSSVAYGAAEEIGPFRVGSDGKTLHPKLYAWNQLANLLFLESPAGVGFSYS  138

Query  477  NTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            NT+SD+ T GD+RTAEDS  FL+ WFERFPQYK R+FYI GESYAGH+VPQLS+
Sbjct  139  NTTSDLYTTGDQRTAEDSYRFLVNWFERFPQYKHRDFYIVGESYAGHFVPQLSK  192



>ref|XP_006294164.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
 gb|EOA27062.1| hypothetical protein CARUB_v10023157mg [Capsella rubella]
Length=464

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 144/199 (72%), Gaps = 2/199 (1%)
 Frame = +3

Query  48   LEMSALSWGCLLFVLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVT  221
            + ++   + C+  V ++   +D    S   D  Q+  D ++ LPG   N++F+ +SGYVT
Sbjct  1    MMITKKQYQCVFLVCMVIALLDQVSSSDDGDKVQKMKDKIISLPGQPPNLNFSQFSGYVT  60

Query  222  VNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYW  401
            V+  +GRALFYW  EA     +KPLVLWLNGGPGCSSIA+G +EE+GPF V  DGKTL  
Sbjct  61   VDSTAGRALFYWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEIGPFRVNPDGKTLRL  120

Query  402  NPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGR  581
            N Y+WN  AN+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R
Sbjct  121  NIYAWNKVANVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKER  180

Query  582  EFYITGESYAGHYVPQLSQ  638
             FYI GESYAGHY+P+L+Q
Sbjct  181  PFYIAGESYAGHYIPELAQ  199



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = +3

Query  63   LSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  242
            +S      VL L     G   +SS+ +QK D +  LPG    V F  YSGYVTVN+ESGR
Sbjct  1    MSHSIFCVVLFLTIFCVGISLASSIKEQKRDKIKWLPGQPKIVGFEQYSGYVTVNEESGR  60

Query  243  ALFYWFFEA--VEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSW  416
            ALFYW  EA     P+SKPLVLWLNGGPGCSSIA+G +EE+GPF +  DGK+LY NPY+W
Sbjct  61   ALFYWLTEAPLSHGPNSKPLVLWLNGGPGCSSIAYGASEEIGPFRIRPDGKSLYLNPYAW  120

Query  417  NLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYIT  596
            N  AN+LF++SPAGVG+SY N ++D+   GD++TAED+  FL+ WFERFPQYK REFY+ 
Sbjct  121  NNLANILFLESPAGVGFSYCNKTTDMQNFGDQKTAEDAYIFLVNWFERFPQYKHREFYMA  180

Query  597  GESYAGHYVPQLSQ  638
            GESYAGHYV QL+Q
Sbjct  181  GESYAGHYVLQLAQ  194



>emb|CDO99728.1| unnamed protein product [Coffea canephora]
Length=470

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 142/190 (75%), Gaps = 3/190 (2%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
             L FV L   S      +     Q+ D ++ LPG   N++F+ YSGYVTV++ +GRALFY
Sbjct  14   VLCFVTLHLASPIFVANAKQGRHQESDRIIRLPGQPANITFSQYSGYVTVDKIAGRALFY  73

Query  255  WFFE--AVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            W  E  A E P +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  +PY+WN  A
Sbjct  74   WLIESPASEKPETKPLVLWLNGGPGCSSIAYGASEEVGPFRVSPDGKTLGLSPYAWNKVA  133

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            NLLF+DSPAGVG+SYSNTS D++T GDKRTA+D+  FL +W+ERFPQYK R FYI GESY
Sbjct  134  NLLFLDSPAGVGFSYSNTSFDMVT-GDKRTAKDAYNFLKRWYERFPQYKNRPFYIAGESY  192

Query  609  AGHYVPQLSQ  638
            AGHY+P+LSQ
Sbjct  193  AGHYIPELSQ  202



>gb|KJB75609.1| hypothetical protein B456_012G048700 [Gossypium raimondii]
Length=327

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 142/187 (76%), Gaps = 2/187 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            L+ + LL   +   +G S+ +++  D +  LPG    VSF  +SGYVTVN+ +GRALFYW
Sbjct  26   LISMALLLLFVSNSEGYSAAEEEA-DRISALPGQP-KVSFPQFSGYVTVNEVAGRALFYW  83

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
              E+   PSSKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  84   LTESPNSPSSKPLVIWLNGGPGCSSVAYGASEEIGPFRINKSASGLYLNKFSWNNVANLL  143

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F+++PAGVG+SY+N SSD+L  GD+RTA DSLEFL++W +RFP+YK RE YITGESYAGH
Sbjct  144  FLETPAGVGFSYTNRSSDLLDTGDRRTAMDSLEFLIRWLDRFPRYKNREVYITGESYAGH  203

Query  618  YVPQLSQ  638
            YVPQL++
Sbjct  204  YVPQLAR  210



>ref|XP_006410746.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
 gb|ESQ52199.1| hypothetical protein EUTSA_v10016610mg [Eutrema salsugineum]
Length=465

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 141/189 (75%), Gaps = 1/189 (1%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKL-DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALF  251
            C+  + ++   +D    S    +QK+ D ++ LPG    ++F+ +SGYVTV+  +GRALF
Sbjct  15   CMCLLCMVIALLDVVTSSDDAKEQKMKDKIISLPGQPPQLNFSQFSGYVTVDSAAGRALF  74

Query  252  YWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAAN  431
            YW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN
Sbjct  75   YWLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNIYAWNKVAN  134

Query  432  LLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYA  611
            +LF+DSPAGVG+SY+NTSSD LT GDKRT ED+ +FL++W ERFP+YK R FYI GESYA
Sbjct  135  VLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDTYKFLVRWIERFPEYKERPFYIAGESYA  194

Query  612  GHYVPQLSQ  638
            GHY+P+L+Q
Sbjct  195  GHYIPELAQ  203



>gb|KJB77373.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=483

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 146/203 (72%), Gaps = 7/203 (3%)
 Frame = +3

Query  48   LEMSALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYS  209
            +  +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+
Sbjct  1    MASNAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYA  59

Query  210  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  389
            GYVTVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +
Sbjct  60   GYVTVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQ  119

Query  390  TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQ  569
            TL  NP+ WN AANLLF++SP GVG+SY+NTSSDI   GDK TAEDS  FL+ WF+RFPQ
Sbjct  120  TLKLNPHRWNKAANLLFLESPVGVGFSYTNTSSDIHQLGDKITAEDSYIFLVNWFKRFPQ  179

Query  570  YKGREFYITGESYAGHYVPQLSQ  638
            +K R+FYI GESYAGHYVPQL++
Sbjct  180  FKSRDFYIAGESYAGHYVPQLAE  202



>ref|XP_008789080.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
27 [Phoenix dactylifera]
Length=473

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/185 (64%), Positives = 140/185 (76%), Gaps = 1/185 (1%)
 Frame = +3

Query  84   FVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFF  263
            F L LA  ++ G        Q+ D +  LPG    V F+ YSGYVTV+  +GRALFYWF 
Sbjct  25   FFLSLALVLNYGVAGGLAASQESDRITWLPGQP-PVGFSQYSGYVTVDARAGRALFYWFI  83

Query  264  EAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFV  443
            EA       PL+LWLNGGPGCSSIA+G +EE+GPFH+  DGKTL+ NPY+WN AANLLF+
Sbjct  84   EAPPAAQPAPLILWLNGGPGCSSIAYGASEELGPFHIHPDGKTLFLNPYAWNSAANLLFL  143

Query  444  DSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYV  623
            +SPAGVG+SYSNTSSD+ T GD+RTA D+  FL+ WFERFPQYK R+FYITGESYAGHYV
Sbjct  144  ESPAGVGFSYSNTSSDLYTAGDRRTAMDAYNFLVNWFERFPQYKYRDFYITGESYAGHYV  203

Query  624  PQLSQ  638
            PQLSQ
Sbjct  204  PQLSQ  208



>ref|XP_002529402.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF32998.1| serine carboxypeptidase, putative [Ricinus communis]
Length=469

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 144/192 (75%), Gaps = 6/192 (3%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVD-----QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  242
            + F+ L+     G   ++ VD     +Q+LD +  LPG    V+F+ +SGYVTVN++ GR
Sbjct  9    VFFLSLILVVFSGMDTTTIVDALANKEQELDRISALPGQP-PVTFSQFSGYVTVNEKHGR  67

Query  243  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  422
            ALFYW  EA   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + + G +LY N YSWN 
Sbjct  68   ALFYWLTEATSSPHHKPLVLWLNGGPGCSSVAYGASEEIGPFRINRTGSSLYLNKYSWNT  127

Query  423  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGE  602
             AN+LF++SPAGVG+SY+NTSSD+   GDKRTA+D+L FLL+WF RFPQYK R+F+I GE
Sbjct  128  EANILFLESPAGVGFSYTNTSSDLKDSGDKRTAQDALVFLLRWFSRFPQYKYRDFFIAGE  187

Query  603  SYAGHYVPQLSQ  638
            SYAGHYVPQL++
Sbjct  188  SYAGHYVPQLAK  199



>gb|KJB77375.1| hypothetical protein B456_012G134700 [Gossypium raimondii]
Length=509

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/203 (57%), Positives = 146/203 (72%), Gaps = 7/203 (3%)
 Frame = +3

Query  48   LEMSALSWGCLLFVLLLATSIDGGKG------SSSVDQQKLDAVLDLPGLGFNVSFAHYS  209
            +  +A  W     ++LL+ + +G +       S  + QQ+ D V++LPG    V F  Y+
Sbjct  1    MASNAAVWLGFFVLVLLSVNSEGSRHGGELSHSDVLRQQEADRVVELPGQP-AVEFKQYA  59

Query  210  GYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGK  389
            GYVTVN+  GRALFYWFFEA   P  KPL+LWLNGGPGCSSI +G AEE+GPF  +KD +
Sbjct  60   GYVTVNESHGRALFYWFFEATSKPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKDEQ  119

Query  390  TLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQ  569
            TL  NP+ WN AANLLF++SP GVG+SY+NTSSDI   GDK TAEDS  FL+ WF+RFPQ
Sbjct  120  TLKLNPHRWNKAANLLFLESPVGVGFSYTNTSSDIHQLGDKITAEDSYIFLVNWFKRFPQ  179

Query  570  YKGREFYITGESYAGHYVPQLSQ  638
            +K R+FYI GESYAGHYVPQL++
Sbjct  180  FKSRDFYIAGESYAGHYVPQLAE  202



>ref|XP_007139483.1| hypothetical protein PHAVU_008G033300g [Phaseolus vulgaris]
 gb|ESW11477.1| hypothetical protein PHAVU_008G033300g [Phaseolus vulgaris]
Length=465

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 7/187 (4%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            +L VL+ A+    G+G ++      D +L LPG    VSF  +SGYVTVN+ +GRALFYW
Sbjct  14   VLMVLVGASCAKAGEGEAA------DRILALPGQP-KVSFQQFSGYVTVNKLAGRALFYW  66

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
              EA ++P +KPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  67   LTEAAQNPLTKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYINKFSWNTVANLL  126

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F+++PAGVG+SY+N SSD+L  GD RTA+DSLEF+L+W ERFP+YK RE YITGESYAGH
Sbjct  127  FLEAPAGVGFSYTNRSSDLLDTGDHRTAQDSLEFVLQWLERFPRYKNRELYITGESYAGH  186

Query  618  YVPQLSQ  638
            YVPQL++
Sbjct  187  YVPQLAK  193



>gb|KDP25724.1| hypothetical protein JCGZ_23945 [Jatropha curcas]
Length=467

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 135/170 (79%), Gaps = 2/170 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVE--DPSSKPLVLWL  308
            + +Q+ D ++ LPG   NV+F+ YSGY++V+  +GRALFYW  EA +   P  KPLVLWL
Sbjct  32   LKEQEKDRIIKLPGQPSNVNFSQYSGYISVDPVAGRALFYWLTEAPKTVQPKLKPLVLWL  91

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSSIA+G +EEVGPF V  DGKTL+ NPY+WN  ANLLF+DSPAGVG+SYSNTSS
Sbjct  92   NGGPGCSSIAYGASEEVGPFRVRPDGKTLHLNPYAWNKEANLLFLDSPAGVGFSYSNTSS  151

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            DI   GDKRTA+D+  FL+ W +RFPQYK R F+I GESYAGHY+P+LSQ
Sbjct  152  DISNVGDKRTAKDAYTFLVNWLKRFPQYKHRPFFIAGESYAGHYIPELSQ  201



>gb|ABR16028.1| unknown [Picea sitchensis]
Length=479

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 142/188 (76%), Gaps = 4/188 (2%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C+ F+ +L  + D   G ++   Q+ D V +LPG     SFAHY+GY+TVN+  GRALFY
Sbjct  19   CIYFLFMLVVNGDHKDGLTA---QQADRVYNLPGQP-KASFAHYAGYITVNESHGRALFY  74

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            WFFEA +  S KPLVLWLNGGPGCSS+ +G A+E+GPF V+ +G  L  N YSWN  ANL
Sbjct  75   WFFEAEDKSSKKPLVLWLNGGPGCSSVGYGAAQELGPFQVKTNGTGLSLNTYSWNKEANL  134

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF++SP GVG+SY+NTSSD+L   D+ TAEDS EFLL+WF+RFPQYK  +FYI GESYAG
Sbjct  135  LFLESPVGVGFSYTNTSSDLLELNDQFTAEDSYEFLLRWFKRFPQYKTHDFYIGGESYAG  194

Query  615  HYVPQLSQ  638
            HYVPQL++
Sbjct  195  HYVPQLAE  202



>gb|KJB07560.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=405

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 142/193 (74%), Gaps = 9/193 (5%)
 Frame = +3

Query  60   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  239
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  240  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  419
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  420  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  599
            + AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  RFP Y+ REFYI G
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSRFPAYRHREFYIAG  206

Query  600  ESYAGHYVPQLSQ  638
            ESYAGHYVPQL++
Sbjct  207  ESYAGHYVPQLAK  219



>gb|AAM15112.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
Length=447

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 139/187 (74%), Gaps = 5/187 (3%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            ++  LL   S D  K     +Q+  D ++ LPG   N++F+ +SGYVTV+  +GRALFYW
Sbjct  1    MVIALLDVVSSDDAK-----EQKMKDKIISLPGQPPNLNFSQFSGYVTVDPAAGRALFYW  55

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
              EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+L
Sbjct  56   LTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANVL  115

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESYAGH
Sbjct  116  FLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWLERFPEYKERAFYIAGESYAGH  175

Query  618  YVPQLSQ  638
            Y+P+L+Q
Sbjct  176  YIPELAQ  182



>ref|XP_010273635.1| PREDICTED: serine carboxypeptidase 24-like [Nelumbo nucifera]
Length=458

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 139/187 (74%), Gaps = 7/187 (4%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            ++F+ L+  +ID  K      +Q+LD +  LPG    V F  YSGYVTV+   GRALFYW
Sbjct  11   IIFISLVGITIDAAK------EQELDRIWALPGQP-QVEFLQYSGYVTVDPVRGRALFYW  63

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
              EA  +P  KPLVLWLNGGPGCSSIA+G +EE+GPF + KDG +LY N YSWN  AN+L
Sbjct  64   LTEATAEPEKKPLVLWLNGGPGCSSIAYGASEEIGPFRINKDGSSLYLNEYSWNKEANIL  123

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F++SP GVG+SY+NTSSD+   GD+RTA ++  F+++W ERFPQYK R+FYI GESYAGH
Sbjct  124  FLESPVGVGFSYTNTSSDLKHSGDRRTAREAFVFMVRWMERFPQYKYRDFYIAGESYAGH  183

Query  618  YVPQLSQ  638
            YVPQL++
Sbjct  184  YVPQLAK  190



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 147/196 (75%), Gaps = 2/196 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSV-DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQ  230
            M+  S   + F+ LL  +      + +V  +Q+ D +L LPG    V+F+ +SGYVTVN+
Sbjct  2    MTFQSKAGIFFLCLLIIAFSSINLAVAVPKEQEQDRILALPGQP-RVAFSQFSGYVTVNE  60

Query  231  ESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPY  410
            + GRALFYW  E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y
Sbjct  61   QHGRALFYWLTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKY  120

Query  411  SWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFY  590
            +WN  A++LF++SPAGVG+SY+NTSSD+ T GDKRTA+D+L FL++W  RFPQYK REFY
Sbjct  121  AWNKEASILFLESPAGVGFSYTNTSSDLKTSGDKRTAQDALVFLIRWMSRFPQYKYREFY  180

Query  591  ITGESYAGHYVPQLSQ  638
            I GESYAGHYVPQL++
Sbjct  181  IAGESYAGHYVPQLAK  196



>ref|XP_006373363.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
 gb|ERP51160.1| hypothetical protein POPTR_0017s12960g [Populus trichocarpa]
Length=432

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 138/187 (74%), Gaps = 1/187 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNSVANLL  130

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F+++PAGVG+SYSN SSD+L  GD RTA DSLEFLL W  RFP++K RE Y+TGESYAGH
Sbjct  131  FLETPAGVGFSYSNRSSDVLDTGDVRTAMDSLEFLLGWMNRFPRFKHREVYLTGESYAGH  190

Query  618  YVPQLSQ  638
            YVPQL++
Sbjct  191  YVPQLAR  197



>ref|XP_010509563.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=467

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 142/190 (75%), Gaps = 2/190 (1%)
 Frame = +3

Query  75   CLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  248
            C+L V ++   +D    +  ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRAL
Sbjct  12   CMLVVCMVIALVDVVSSRDDANKEQKIKDKIIALPGQPPKLNFSQFSGYVTVDSTAGRAL  71

Query  249  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            FYW  E      +KPLVLWLNGGPGCSSIA+G +EE+GPF +  DGKTL +N Y+WN  A
Sbjct  72   FYWLTETPRPSDTKPLVLWLNGGPGCSSIAYGASEEIGPFRINPDGKTLRFNIYAWNKVA  131

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            N+LF+DSPAGVG+SY+NTSSD +T GDKRT ED+  FL++W ERFP+YK R FYI GESY
Sbjct  132  NVLFLDSPAGVGFSYTNTSSDEVTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESY  191

Query  609  AGHYVPQLSQ  638
            AGHY+P+L+Q
Sbjct  192  AGHYIPELAQ  201



>ref|XP_009618061.1| PREDICTED: serine carboxypeptidase-like 34 [Nicotiana tomentosiformis]
Length=232

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 134/187 (72%), Gaps = 1/187 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            LL VL             ++ QQ+ D V  LPG    VSF  Y+GYVTVN+  GRALFYW
Sbjct  9    LLLVLNFGVLARSHISEKALAQQEADRVNRLPGQP-PVSFKQYAGYVTVNETHGRALFYW  67

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
            FFEA  +P  KPL+LWLNGGPGCSSI +G AEE+GPF  +K+   L +N +SWN AANLL
Sbjct  68   FFEATTNPEKKPLLLWLNGGPGCSSIGYGEAEELGPFFTQKNKPELKFNNFSWNKAANLL  127

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F++SP GVG+SY+NTSSDI   GD  TA+DS +FL+ WF RFPQ+K  EFYI GESYAGH
Sbjct  128  FLESPVGVGFSYTNTSSDITELGDTVTAQDSYKFLVNWFRRFPQFKTHEFYIAGESYAGH  187

Query  618  YVPQLSQ  638
            YVPQL++
Sbjct  188  YVPQLAE  194



>ref|XP_002881413.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57672.1| hypothetical protein ARALYDRAFT_321290 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 138/188 (73%), Gaps = 0/188 (0%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            C+  + ++   +D      + +Q+  D ++ LPG   N++F+ +SGYVTV+  +GR LFY
Sbjct  10   CMCLLCMVIAILDVVSSDDAKEQKMKDKIISLPGQPPNLNFSQFSGYVTVDSAAGRNLFY  69

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            W  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  N Y+WN  AN+
Sbjct  70   WLTEAPRPSGTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNPDGKTLRLNLYAWNKVANV  129

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+DSPAGVG+SY+NTSSD LT GDKR  ED+  FL++W ERFP+YK R FYI GESYAG
Sbjct  130  LFLDSPAGVGFSYTNTSSDELTVGDKRAGEDAYRFLVRWMERFPEYKERPFYIAGESYAG  189

Query  615  HYVPQLSQ  638
            HY+P+L+Q
Sbjct  190  HYIPELAQ  197



>emb|CDP10248.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +3

Query  138  DQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGG  317
            +QQ++D +L+LPG    VSF+ +SGYV VN++ GRALFYW  EA   P  KPLVLWLNGG
Sbjct  24   EQQEMDRILELPGQP-PVSFSQFSGYVPVNEDHGRALFYWLTEATSSPEKKPLVLWLNGG  82

Query  318  PGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDIL  497
            PGCSS+A+G +EE+GPF + K   +LY N +SWN  AN+LF++SPAGVG+SY+NTSSD+ 
Sbjct  83   PGCSSVAYGASEEIGPFRISKTASSLYLNKHSWNREANILFLESPAGVGFSYTNTSSDLK  142

Query  498  THGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLS  635
              GDKRTA+D+L FLL+W  RFPQYK R+FYI+GESYAGHY PQL+
Sbjct  143  DSGDKRTAQDALIFLLRWMSRFPQYKDRDFYISGESYAGHYAPQLA  188



>ref|XP_007032751.1| Serine carboxypeptidase-like 25 isoform 4 [Theobroma cacao]
 gb|EOY03677.1| Serine carboxypeptidase-like 25 isoform 4 [Theobroma cacao]
Length=363

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = +3

Query  129  SSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWL  308
            S  ++++ D +  LPG    VSF  +SGYVTVN+ +GRALFYW  EA  DP SKPLV+WL
Sbjct  27   SVREEEEADRISALPGQP-KVSFQQFSGYVTVNKAAGRALFYWLTEAANDPLSKPLVIWL  85

Query  309  NGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSS  488
            NGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+SYSN SS
Sbjct  86   NGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNNVANLLFLETPAGVGFSYSNHSS  145

Query  489  DILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            D+   GD+RTA DSLEFL++W +RFP+YK R+ YITGESYAGHYVPQL++
Sbjct  146  DLFDTGDRRTAMDSLEFLIRWLDRFPRYKNRDIYITGESYAGHYVPQLAR  195



>ref|XP_010032541.1| PREDICTED: serine carboxypeptidase-like 25 [Eucalyptus grandis]
 gb|KCW51926.1| hypothetical protein EUGRSUZ_J01381 [Eucalyptus grandis]
Length=520

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 143/188 (76%), Gaps = 5/188 (3%)
 Frame = +3

Query  87   VLLLATSIDGGKGSSS----VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFY  254
            V++L + ++   G  S       ++ D ++ LPG    V F  +SGYVTV++ +GRALFY
Sbjct  59   VVILISRLNATSGHDSREAAAAAEEADRIVSLPGQP-KVPFRQFSGYVTVHEAAGRALFY  117

Query  255  WFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
            W  EA  DPSSKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANL
Sbjct  118  WLTEAYSDPSSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNTEANL  177

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF+++PAGVG+SYSN SSD+L  GD+RTAEDSLEFL++W ERFP+YKGRE ++TGESYAG
Sbjct  178  LFLETPAGVGFSYSNRSSDLLDTGDRRTAEDSLEFLVRWMERFPRYKGREVFLTGESYAG  237

Query  615  HYVPQLSQ  638
            HYVPQL++
Sbjct  238  HYVPQLAR  245



>ref|XP_010089631.1| Serine carboxypeptidase-like 25 [Morus notabilis]
 gb|EXB38102.1| Serine carboxypeptidase-like 25 [Morus notabilis]
Length=479

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 144/192 (75%), Gaps = 5/192 (3%)
 Frame = +3

Query  75   CLLFVLLLATSIDGGKGSSSVDQQK----LDAVLDLPGLGFNVSFAHYSGYVTVNQESGR  242
            C+L   L   +  G K      QQ+     D +++LPG    VSF  +SGYVTV++ +GR
Sbjct  15   CVLPFGLQVRASHGVKEEREKRQQREEEARDRIVELPGQP-KVSFQQFSGYVTVSRVAGR  73

Query  243  ALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNL  422
            ALFYW  EAV +P S+PLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN 
Sbjct  74   ALFYWLTEAVHEPLSRPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNT  133

Query  423  AANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGE  602
             ANLLF+++PAGVG+SYSN SSD+L  GD+RTA+DSLEFL++W +RFP+YKGRE ++TGE
Sbjct  134  VANLLFLETPAGVGFSYSNRSSDLLDTGDRRTAKDSLEFLIRWLDRFPRYKGREVFLTGE  193

Query  603  SYAGHYVPQLSQ  638
            SYAGHYVPQL++
Sbjct  194  SYAGHYVPQLAR  205



>ref|XP_010258045.1| PREDICTED: serine carboxypeptidase-like 25 [Nelumbo nucifera]
Length=471

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            +LF  LL  S+    G+ +  +++ D +  LPG    VSF  +SGYVTVNQ +GRALFYW
Sbjct  17   VLFAFLLLVSVGASHGAGA--EEEADRIKALPGQP-KVSFQQFSGYVTVNQVAGRALFYW  73

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
              EAV +P SKPLV+WLNGGPGCSS+A+G +EE+GPF + K G  LY N +SWN  ANLL
Sbjct  74   LTEAVHEPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRLNKSGSGLYLNKFSWNTVANLL  133

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F+++PAGVG+SYSN SSD+L  GD+RTA+DSLEFL++W  RF +YK RE ++TGESYAGH
Sbjct  134  FLETPAGVGFSYSNRSSDLLDTGDRRTAKDSLEFLIRWLGRFLRYKNREVFLTGESYAGH  193

Query  618  YVPQLSQ  638
            YVPQL++
Sbjct  194  YVPQLAR  200



>ref|XP_010516781.1| PREDICTED: serine carboxypeptidase-like 28 [Camelina sativa]
Length=465

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 141/190 (74%), Gaps = 2/190 (1%)
 Frame = +3

Query  75   CLLFVLLLATSID--GGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRAL  248
            C+L V ++   +D       ++ +Q+  D ++ LPG    ++F+ +SGYVTV+  +GRAL
Sbjct  10   CMLLVCMVIALLDVVSSSDDANKEQKMKDKIISLPGQPPKLNFSQFSGYVTVDSTAGRAL  69

Query  249  FYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAA  428
            FYW  EA     +KPLVLWLNGGPGCSSIA+G +EEVGPF V  DGKTL  + Y+WN  A
Sbjct  70   FYWLTEAPSPSDTKPLVLWLNGGPGCSSIAYGASEEVGPFRVNTDGKTLRLSIYAWNKVA  129

Query  429  NLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESY  608
            N+LF+DSPAGVG+SY+NTSSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESY
Sbjct  130  NVLFLDSPAGVGFSYTNTSSDELTVGDKRTGEDAYRFLVRWMERFPEYKERPFYIAGESY  189

Query  609  AGHYVPQLSQ  638
            AGHY+P+L+Q
Sbjct  190  AGHYIPELAQ  199



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
             L +L+ A S      ++   +Q+ D +  LPG    V+F+ +SGYVTVN++ GR+LFYW
Sbjct  12   FLCLLIFAFSSINILAAAVPKEQEQDRISALPGQP-RVAFSQFSGYVTVNEQHGRSLFYW  70

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
            F E+   P +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y+WN  AN+L
Sbjct  71   FTESPTSPQNKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYAWNREANVL  130

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F++SPAGVG+SY+NTSSD+ T GDKRTA+D+L F+++W  RFPQYK REFYI GESYAGH
Sbjct  131  FLESPAGVGFSYTNTSSDLKTSGDKRTAQDALIFVIRWMSRFPQYKYREFYIAGESYAGH  190

Query  618  YVPQLSQ  638
            YVPQL++
Sbjct  191  YVPQLAK  197



>ref|XP_003530438.1| PREDICTED: serine carboxypeptidase-like 25-like isoform X1 [Glycine 
max]
 ref|XP_006585779.1| PREDICTED: serine carboxypeptidase-like 25-like isoform X2 [Glycine 
max]
 ref|XP_006585780.1| PREDICTED: serine carboxypeptidase-like 25-like isoform X3 [Glycine 
max]
Length=471

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 144/186 (77%), Gaps = 3/186 (2%)
 Frame = +3

Query  87   VLLLATSIDGGKGSSSVD--QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            V+LL   + G + + + +  ++  D +L LPG    VSF  +SGYVTVN+ +GRALFYW 
Sbjct  11   VILLLMFLVGARFAKAKEGGEEAADRILKLPGQP-KVSFKQFSGYVTVNKVAGRALFYWL  69

Query  261  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  440
             EA ++P +KPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF
Sbjct  70   AEAAQNPLTKPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYKNKFSWNSVANLLF  129

Query  441  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  620
            +++PAGVG+SY+N SSD+L  GD+RTA+DSLEF+++W ERFP+YK RE YITGESYAGHY
Sbjct  130  LEAPAGVGFSYTNRSSDLLDTGDRRTAQDSLEFVIQWLERFPRYKTRELYITGESYAGHY  189

Query  621  VPQLSQ  638
            VPQL++
Sbjct  190  VPQLAK  195



>ref|XP_011079399.1| PREDICTED: serine carboxypeptidase 24 [Sesamum indicum]
Length=462

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/195 (55%), Positives = 146/195 (75%), Gaps = 1/195 (1%)
 Frame = +3

Query  54   MSALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQE  233
            M  L    +L +  L++S+     ++    Q+LD +  LPG    V+F+ +SGYVTVN++
Sbjct  1    MEVLLRPHVLLLCFLSSSVLTALLAALPADQELDRISALPGQP-PVNFSQFSGYVTVNEQ  59

Query  234  SGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYS  413
             GRALFYW  EA  +  +KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YS
Sbjct  60   QGRALFYWLTEATSNAHTKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYS  119

Query  414  WNLAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYI  593
            WN  AN+LF++SPAGVG+SY+NTSS++   GDKRTA+D+L FL++W  RFPQY+ R+FYI
Sbjct  120  WNRVANILFLESPAGVGFSYTNTSSNLKDSGDKRTAQDALVFLIRWMHRFPQYRYRDFYI  179

Query  594  TGESYAGHYVPQLSQ  638
            +GESYAGHYVPQL++
Sbjct  180  SGESYAGHYVPQLAK  194



>gb|KJB07562.1| hypothetical protein B456_001G032600 [Gossypium raimondii]
Length=448

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 142/193 (74%), Gaps = 9/193 (5%)
 Frame = +3

Query  60   ALSWGCLLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESG  239
            ++ +  LLF ++ A ++          QQ+LD +  LPG    V F+ +SGYVTVN++ G
Sbjct  36   SICYSLLLFGIVAANAVP--------KQQELDRISSLPGQP-PVGFSQFSGYVTVNEKHG  86

Query  240  RALFYWFFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWN  419
            RALFYWF EA   P  KPL+LWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN
Sbjct  87   RALFYWFTEATTVPEKKPLLLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWN  146

Query  420  LAANLLFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITG  599
            + AN+LF++SPAGVG+SY+NTSSD+   GD RTA+D+L FL +W  RFP Y+ REFYI G
Sbjct  147  MEANILFLESPAGVGFSYTNTSSDLKDSGDDRTAQDALIFLTRWMSRFPAYRHREFYIAG  206

Query  600  ESYAGHYVPQLSQ  638
            ESYAGHYVPQL++
Sbjct  207  ESYAGHYVPQLAK  219



>ref|XP_009631140.1| PREDICTED: serine carboxypeptidase 24-like [Nicotiana tomentosiformis]
Length=464

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
              +Q+ D ++ LPG    V+F+ +SGYVTVN+  GRALFYW  EA   P  KPLVLWLNG
Sbjct  34   TKEQEFDRIISLPGQP-PVTFSQFSGYVTVNENHGRALFYWLTEATTQPEKKPLVLWLNG  92

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSS+A+G +EE+GPF + K G +LY N YSWN  AN+LF++SPAGVG+SY+NTSSD+
Sbjct  93   GPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWNKVANILFLESPAGVGFSYTNTSSDL  152

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
               GDKRTA+D+L FL +W  RFPQYK R+FYI+GESYAGHYVPQL+ 
Sbjct  153  KDSGDKRTAQDALIFLTRWMSRFPQYKYRDFYISGESYAGHYVPQLAH  200



>ref|XP_003552566.1| PREDICTED: serine carboxypeptidase-like 25-like isoform 1 [Glycine 
max]
Length=467

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +3

Query  153  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGPGCSS  332
            D +L+LPG    VSF  +SGYVTVN+ +GRALFYW  EA ++P +KPLV+WLNGGPGCSS
Sbjct  34   DRILELPGQP-KVSFQQFSGYVTVNKVAGRALFYWLTEAAQNPLTKPLVIWLNGGPGCSS  92

Query  333  IAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGDK  512
            +A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+SY+N SSD+L  GD+
Sbjct  93   VAYGASEEIGPFRINKTASGLYINKFSWNTVANLLFLEAPAGVGFSYANRSSDLLNTGDR  152

Query  513  RTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            RTA+DSLEF+++W ERFP+YK RE YITGESYAGHYVPQL++
Sbjct  153  RTAQDSLEFVIQWLERFPRYKNRELYITGESYAGHYVPQLAK  194



>ref|XP_011018041.1| PREDICTED: serine carboxypeptidase 24-like isoform X2 [Populus 
euphratica]
Length=392

 Score =   230 bits (586),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
             +QQ+LD +  L G    V+F+ +SGYVTVN++ GRALFYW  EA   P  KPLVLWLNG
Sbjct  29   TEQQELDRISSLLGQP-PVTFSQFSGYVTVNEKHGRALFYWLTEATTTPDKKPLVLWLNG  87

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSS+A+G +EE+GPF + + G +LY N YSWN  AN+LF++SPAGVG+SY+NTSS++
Sbjct  88   GPGCSSVAYGASEEIGPFRINRTGSSLYMNKYSWNREANILFLESPAGVGFSYTNTSSNL  147

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
               GDKRTA+D+L F+++W  RFPQYK REFYI GESYAGHYVPQL++
Sbjct  148  KDSGDKRTAQDALVFVIRWMSRFPQYKYREFYIAGESYAGHYVPQLAK  195



>ref|XP_002324116.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF04249.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=468

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 138/187 (74%), Gaps = 1/187 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
            ++FVLLL          +  ++++ D +  LPG    VSF  +SGYVTVN+  GRALFYW
Sbjct  12   IVFVLLLVVFSSASHHHAVNEEEEADRISSLPGQP-KVSFQQFSGYVTVNKAVGRALFYW  70

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
              EAV DP SKPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLL
Sbjct  71   LTEAVHDPLSKPLVVWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNSVANLL  130

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F+++PAGVG+SYSN SSD+L  GD RTA DSLEFLL W  RFP++K RE Y+TGESYAGH
Sbjct  131  FLETPAGVGFSYSNRSSDVLDTGDVRTAMDSLEFLLGWMNRFPRFKHREVYLTGESYAGH  190

Query  618  YVPQLSQ  638
            YVPQL++
Sbjct  191  YVPQLAR  197



>ref|XP_006343642.1| PREDICTED: serine carboxypeptidase 24-like [Solanum tuberosum]
Length=471

 Score =   232 bits (591),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 140/186 (75%), Gaps = 1/186 (1%)
 Frame = +3

Query  81   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            L +++ + +I     + +  +Q+LD +  LPG    V+F+ +SGYV+VN+  GRALFYW 
Sbjct  15   LILIIFSLTIINVVVALTTKEQELDRITTLPGQP-PVTFSQFSGYVSVNEGHGRALFYWL  73

Query  261  FEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLF  440
             +A   P  KPLVLWLNGGPGCSS+A+G +EE+GPF + K G +LY N YSWN  AN+LF
Sbjct  74   TQATTHPEKKPLVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYSWNKVANILF  133

Query  441  VDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHY  620
            ++SPAGVG+SY+NTSSD+   GDKRTA+D+L FL +W  RFPQYK R+FYI GESYAGHY
Sbjct  134  LESPAGVGFSYTNTSSDLKDSGDKRTAQDALIFLTRWMSRFPQYKYRDFYIAGESYAGHY  193

Query  621  VPQLSQ  638
            VPQL+Q
Sbjct  194  VPQLAQ  199



>ref|XP_006453595.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
 gb|ESR66835.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
Length=356

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
              QQKLD +  LPG    V+F+ +SGYVTVN+  GRALFYW  EA      KPLVLWLNG
Sbjct  31   TKQQKLDRISALPGQP-PVTFSQFSGYVTVNENHGRALFYWLTEAASSALKKPLVLWLNG  89

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSS+A+G +EE+GPF + ++G +LY N YSW+  AN+LF++SPAGVG+SY+NTSS++
Sbjct  90   GPGCSSVAYGASEEIGPFRINRNGSSLYLNKYSWSREANILFLESPAGVGFSYTNTSSNL  149

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
               GD RTA+D+L FL++W  RFPQYK REFYI GESYAGHYVPQL++
Sbjct  150  KDSGDNRTAQDALVFLIRWMSRFPQYKYREFYIAGESYAGHYVPQLAK  197



>gb|KHN42831.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 143/187 (76%), Gaps = 1/187 (1%)
 Frame = +3

Query  78   LLFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYW  257
             L +L+ A S      ++   +Q+ D +  LPG    V+F+ +SGYVTVN++ GR+LFYW
Sbjct  11   FLCLLIFAFSSINILAAAVPKEQEQDRISALPGQP-RVAFSQFSGYVTVNEQHGRSLFYW  69

Query  258  FFEAVEDPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLL  437
            F E+   P +KP+VLWLNGGPGCSS+A+G +EE+GPF + K G +LY N Y+WN  AN+L
Sbjct  70   FTESPTSPQNKPVVLWLNGGPGCSSVAYGASEEIGPFRINKTGSSLYLNKYAWNREANVL  129

Query  438  FVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGH  617
            F++SPAGVG+SY+NTSSD+ T GDKRTA+D+L F+++W  RFPQYK REFYI GESYAGH
Sbjct  130  FLESPAGVGFSYTNTSSDLKTSGDKRTAQDALIFVIRWMSRFPQYKYREFYIAGESYAGH  189

Query  618  YVPQLSQ  638
            YVPQL++
Sbjct  190  YVPQLAK  196



>ref|XP_009420309.1| PREDICTED: serine carboxypeptidase 24-like [Musa acuminata subsp. 
malaccensis]
Length=464

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 132/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  135  VDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNG  314
             DQQ  D +  LPG    V+FA +SGYVTVN+E GRALFYW  EA  D + KPLVLWLNG
Sbjct  33   ADQQAHDRITALPGQP-PVTFAQFSGYVTVNKEQGRALFYWLTEAATDAAKKPLVLWLNG  91

Query  315  GPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDI  494
            GPGCSS+A+G +EE+GPF + +   +LY N +SWN  ANLLF++SPAGVG+SY+NTSSD+
Sbjct  92   GPGCSSVAYGASEEIGPFRISRTCSSLYLNQFSWNREANLLFLESPAGVGFSYTNTSSDL  151

Query  495  LTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             T GD+RTA D+L FL+ W  RFPQYK R+FYI+GESYAGHYVPQL++
Sbjct  152  KTSGDERTAGDALMFLIGWMSRFPQYKARDFYISGESYAGHYVPQLAK  199



>ref|XP_008221066.1| PREDICTED: serine carboxypeptidase-like 34 [Prunus mume]
Length=488

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = +3

Query  126  SSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLW  305
            S+   QQK D V  LPG    VSF H++GYVTVN+  GRALFYWFFEA+ +P  KPL+LW
Sbjct  37   SAHQQQQKADQVSGLPGQP-PVSFKHFAGYVTVNKTHGRALFYWFFEAINNPQDKPLLLW  95

Query  306  LNGGPGCSSIAFGLAEEVGPFHVEKDGK-TLYWNPYSWNLAANLLFVDSPAGVGYSYSNT  482
            LNGGPGCSSI +G  EE+GPF V+K  +  L +NPY+WN AANLLFV+SP GVG+SY+NT
Sbjct  96   LNGGPGCSSIGYGATEELGPFFVQKGSELKLKFNPYTWNNAANLLFVESPVGVGFSYTNT  155

Query  483  SSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            S DI   GDK TAEDS  FL+ WF+RFPQYK  +FY+ GESYAGHYVPQLS+
Sbjct  156  SEDIRQLGDKITAEDSYNFLINWFQRFPQYKSHDFYMAGESYAGHYVPQLSE  207



>ref|NP_001140896.1| hypothetical protein precursor [Zea mays]
 gb|ACF84908.1| unknown [Zea mays]
 gb|AFW80079.1| hypothetical protein ZEAMMB73_598140 [Zea mays]
Length=241

 Score =   224 bits (571),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 128/163 (79%), Gaps = 2/163 (1%)
 Frame = +3

Query  153  DAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPS-SKPLVLWLNGGPGCS  329
            D +  LPG    V+F+ YSGYVTV+  +GRALFYWF EA   P+ S PLVLWLNGGPGCS
Sbjct  30   DRIGRLPGQP-PVNFSMYSGYVTVDAAAGRALFYWFIEAAGVPAESAPLVLWLNGGPGCS  88

Query  330  SIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILTHGD  509
            S+ +G +EE+G F +  DG+TLY NPY WN  AN+LF+DSPAGVGYSYSN++SD+ T GD
Sbjct  89   SVGYGASEELGAFRINADGRTLYLNPYPWNKVANMLFLDSPAGVGYSYSNSTSDLYTAGD  148

Query  510  KRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             +TA DS  FL+ W ERFPQYK R+FYITGESYAGHYVPQLSQ
Sbjct  149  NKTAHDSYNFLVNWLERFPQYKHRDFYITGESYAGHYVPQLSQ  191



>ref|XP_004232164.1| PREDICTED: serine carboxypeptidase-like 25 [Solanum lycopersicum]
Length=464

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 136/177 (77%), Gaps = 1/177 (1%)
 Frame = +3

Query  108  IDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSS  287
            +   K +   D++  D ++ LPG    VSF  YSGYVTVNQ +GRALFYW  EA+++P +
Sbjct  18   VSAAKLNKYQDEEDADRIISLPGQP-KVSFHQYSGYVTVNQFAGRALFYWLTEAIDEPLT  76

Query  288  KPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGY  467
            KPLV+WLNGGPGCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+
Sbjct  77   KPLVIWLNGGPGCSSVAYGASEEIGPFRINKTASGLYLNKFSWNKLANLLFLETPAGVGF  136

Query  468  SYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
            SYSN SSD+L  GD RTA+DSL+FL+ W  RFP+Y+ RE YITGESYAGHYVPQL++
Sbjct  137  SYSNRSSDLLDTGDIRTAKDSLQFLIHWMNRFPRYRNREVYITGESYAGHYVPQLAR  193



>gb|KFK36473.1| hypothetical protein AALP_AA4G129300 [Arabis alpina]
Length=439

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +3

Query  120  KGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLV  299
            + + + +Q+  D ++ LPG   +++F+ YSGYVTV+  +GRALFYW  EA     +KPLV
Sbjct  3    RNNDAKEQKMKDKIISLPGQPPHLNFSQYSGYVTVDSAAGRALFYWLTEAPSPSGTKPLV  62

Query  300  LWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSN  479
            LWLNGGPGCSSIA+G +EEVGPF V  DGK+L+ N Y+WN  ANLLF+DSPAGVG+SY+N
Sbjct  63   LWLNGGPGCSSIAYGASEEVGPFRVNPDGKSLHLNLYAWNKVANLLFLDSPAGVGFSYTN  122

Query  480  TSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             SSD LT GDKRT ED+  FL++W ERFP+YK R FYI GESYAGHY+P+L+Q
Sbjct  123  ASSDELTVGDKRTGEDAYRFLVRWMERFPEYKQRPFYIAGESYAGHYIPKLAQ  175



>gb|KHN41581.1| Serine carboxypeptidase-like 25 [Glycine soja]
Length=453

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = +3

Query  141  QQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWFFEAVEDPSSKPLVLWLNGGP  320
            ++  D +L LPG    VSF  +SGYVTVN+ +GRALFYW  EA ++P +KPLV+WLNGGP
Sbjct  16   EEAADRILKLPGQP-KVSFKQFSGYVTVNKVAGRALFYWLAEAAQNPLTKPLVIWLNGGP  74

Query  321  GCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANLLFVDSPAGVGYSYSNTSSDILT  500
            GCSS+A+G +EE+GPF + K    LY N +SWN  ANLLF+++PAGVG+SY+N SSD+L 
Sbjct  75   GCSSVAYGASEEIGPFRINKTASGLYKNKFSWNSVANLLFLEAPAGVGFSYTNRSSDLLD  134

Query  501  HGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAGHYVPQLSQ  638
             GD+RTA+DSLEF+++W ERFP+YK RE YITGESYAGHYVPQL++
Sbjct  135  TGDRRTAQDSLEFVIQWLERFPRYKTRELYITGESYAGHYVPQLAK  180



>ref|XP_003570294.1| PREDICTED: serine carboxypeptidase 24 [Brachypodium distachyon]
Length=478

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/188 (59%), Positives = 139/188 (74%), Gaps = 2/188 (1%)
 Frame = +3

Query  81   LFVLLLATSIDGGKGSSSVDQQKLDAVLDLPGLGFNVSFAHYSGYVTVNQESGRALFYWF  260
            + V LLA     G  S   ++++ D V  LPG      F  +SGYVTV++E GRALFYW 
Sbjct  14   VLVFLLAAGGGAGAASEGCEERERDKVEALPGQPAAARFVQFSGYVTVSEERGRALFYWL  73

Query  261  FEAVE--DPSSKPLVLWLNGGPGCSSIAFGLAEEVGPFHVEKDGKTLYWNPYSWNLAANL  434
             EA    D  +KPLVLWLNGGPGCSS+A+G +EE+GPF ++ +G  LY N YSWN  ANL
Sbjct  74   TEAAAGADAGTKPLVLWLNGGPGCSSVAYGASEEIGPFRIKPNGTGLYLNKYSWNREANL  133

Query  435  LFVDSPAGVGYSYSNTSSDILTHGDKRTAEDSLEFLLKWFERFPQYKGREFYITGESYAG  614
            LF++SPAGVG+SYSNT+SD+ T GD+RTAEDSL+FL+ W  RFPQY+ R+FYI GESYAG
Sbjct  134  LFLESPAGVGFSYSNTTSDLKTSGDERTAEDSLQFLISWMSRFPQYRHRDFYIAGESYAG  193

Query  615  HYVPQLSQ  638
            HYVPQL++
Sbjct  194  HYVPQLAR  201



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125