BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF044H10

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006367642.1|  PREDICTED: adenylate cyclase, terminal-diffe...    289   4e-91   Solanum tuberosum [potatoes]
ref|XP_006357482.1|  PREDICTED: transcription factor SPT20 homolog      286   4e-90   Solanum tuberosum [potatoes]
ref|XP_009628959.1|  PREDICTED: extensin-like                           283   5e-89   Nicotiana tomentosiformis
ref|XP_004243351.1|  PREDICTED: bromodomain-containing protein 4-...    281   3e-88   Solanum lycopersicum
ref|XP_009628597.1|  PREDICTED: ataxin-2 homolog                        281   4e-88   Nicotiana tomentosiformis
ref|XP_009782624.1|  PREDICTED: pollen-specific leucine-rich repe...    281   4e-88   Nicotiana sylvestris
ref|XP_004248167.1|  PREDICTED: bromodomain-containing protein 4        280   8e-88   Solanum lycopersicum
gb|EYU28592.1|  hypothetical protein MIMGU_mgv1a004659mg                279   1e-87   Erythranthe guttata [common monkey flower]
ref|XP_009782976.1|  PREDICTED: vacuolar protein sorting-associat...    278   4e-87   Nicotiana sylvestris
ref|XP_011098021.1|  PREDICTED: extensin                                277   8e-87   Sesamum indicum [beniseed]
emb|CDP14783.1|  unnamed protein product                                274   2e-85   Coffea canephora [robusta coffee]
ref|XP_008337475.1|  PREDICTED: altered inheritance of mitochondr...    267   5e-83   
ref|XP_008229158.1|  PREDICTED: mediator of RNA polymerase II tra...    267   9e-83   Prunus mume [ume]
ref|XP_007198900.1|  hypothetical protein PRUPE_ppa004117mg             267   9e-83   Prunus persica
ref|XP_008229157.1|  PREDICTED: mediator of RNA polymerase II tra...    266   1e-82   Prunus mume [ume]
ref|XP_004506616.1|  PREDICTED: transcription factor SPT20 homolog      266   2e-82   Cicer arietinum [garbanzo]
gb|KDP24130.1|  hypothetical protein JCGZ_25787                         265   8e-82   Jatropha curcas
ref|XP_004303103.1|  PREDICTED: transcriptional regulator DEF1          262   6e-81   Fragaria vesca subsp. vesca
ref|XP_009357856.1|  PREDICTED: putative uncharacterized protein ...    261   2e-80   Pyrus x bretschneideri [bai li]
ref|XP_010110218.1|  hypothetical protein L484_009824                   261   2e-80   Morus notabilis
ref|NP_194559.2|  uncharacterized protein                               252   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009341977.1|  PREDICTED: ATP-dependent helicase brm-like i...    252   4e-77   Pyrus x bretschneideri [bai li]
ref|XP_002869511.1|  hypothetical protein ARALYDRAFT_491942             251   5e-77   
ref|XP_009336199.1|  PREDICTED: mediator of RNA polymerase II tra...    251   1e-76   Pyrus x bretschneideri [bai li]
ref|XP_008342911.1|  PREDICTED: extensin-like isoform X2                251   1e-76   
ref|XP_002517918.1|  structural constituent of cell wall, putative      250   3e-76   Ricinus communis
gb|KEH17617.1|  structural constituent of cell wall protein, puta...    250   3e-76   Medicago truncatula
gb|KFK35898.1|  hypothetical protein AALP_AA4G050800                    247   1e-75   Arabis alpina [alpine rockcress]
ref|XP_009341976.1|  PREDICTED: ATP-dependent helicase brm-like i...    248   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_009336198.1|  PREDICTED: mediator of RNA polymerase II tra...    246   5e-75   Pyrus x bretschneideri [bai li]
ref|XP_008342910.1|  PREDICTED: extensin-like isoform X1                246   5e-75   
ref|XP_011037330.1|  PREDICTED: putative uncharacterized protein ...    245   1e-74   Populus euphratica
ref|XP_010035753.1|  PREDICTED: RNA polymerase II degradation fac...    245   3e-74   Eucalyptus grandis [rose gum]
ref|XP_006376495.1|  hydroxyproline-rich glycoprotein                   244   5e-74   Populus trichocarpa [western balsam poplar]
gb|KJB31694.1|  hypothetical protein B456_005G201600                    244   5e-74   Gossypium raimondii
ref|XP_006582794.1|  PREDICTED: vacuolar protein sorting-associat...    242   1e-73   
emb|CAB79632.1|  predicted proline-rich protein                         243   1e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KHN35253.1|  hypothetical protein glysoja_042323                     243   2e-73   Glycine soja [wild soybean]
ref|XP_006412973.1|  hypothetical protein EUTSA_v10024987mg             241   4e-73   Eutrema salsugineum [saltwater cress]
ref|XP_002272844.1|  PREDICTED: arginine-glutamic acid dipeptide ...    241   7e-73   Vitis vinifera
ref|XP_011037329.1|  PREDICTED: bromodomain-containing protein 4-...    241   7e-73   Populus euphratica
ref|XP_010438481.1|  PREDICTED: formin-like protein 5                   240   9e-73   Camelina sativa [gold-of-pleasure]
ref|XP_002325597.2|  hydroxyproline-rich glycoprotein                   241   1e-72   Populus trichocarpa [western balsam poplar]
ref|XP_010448000.1|  PREDICTED: vacuolar protein-sorting protein ...    240   1e-72   Camelina sativa [gold-of-pleasure]
gb|KHG27956.1|  S-adenosylmethionine synthase 1                         240   3e-72   Gossypium arboreum [tree cotton]
ref|XP_010433239.1|  PREDICTED: bromodomain-containing protein 4-...    238   5e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008455322.1|  PREDICTED: transcription factor SPT20 homolog      238   7e-72   Cucumis melo [Oriental melon]
ref|XP_006283593.1|  hypothetical protein CARUB_v10004649mg             238   8e-72   Capsella rubella
gb|EPS62243.1|  hypothetical protein M569_12549                         238   8e-72   Genlisea aurea
ref|XP_004136824.1|  PREDICTED: uncharacterized protein LOC101206745    237   1e-71   Cucumis sativus [cucumbers]
ref|XP_007043595.1|  Structural constituent of cell wall                238   2e-71   
ref|XP_011002849.1|  PREDICTED: calcium-binding protein P-like          238   3e-71   Populus euphratica
ref|XP_006592435.1|  PREDICTED: putative uncharacterized protein ...    236   6e-71   Glycine max [soybeans]
gb|KHN31988.1|  hypothetical protein glysoja_025822                     235   9e-71   Glycine soja [wild soybean]
ref|XP_003539922.1|  PREDICTED: putative uncharacterized protein ...    236   1e-70   Glycine max [soybeans]
emb|CDX97433.1|  BnaC08g12980D                                          233   3e-70   
emb|CDY25250.1|  BnaA02g22060D                                          233   3e-70   Brassica napus [oilseed rape]
ref|XP_010689008.1|  PREDICTED: RNA polymerase II degradation fac...    234   5e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008455323.1|  PREDICTED: mediator of RNA polymerase II tra...    233   1e-69   Cucumis melo [Oriental melon]
emb|CDX89188.1|  BnaA01g17050D                                          231   2e-69   
ref|XP_009144355.1|  PREDICTED: protein transport protein SEC31-like    229   1e-68   Brassica rapa
gb|KDO51849.1|  hypothetical protein CISIN_1g008878mg                   230   1e-68   Citrus sinensis [apfelsine]
ref|XP_004136823.1|  PREDICTED: uncharacterized protein LOC101206501    230   2e-68   Cucumis sativus [cucumbers]
ref|XP_006447362.1|  hypothetical protein CICLE_v10014791mg             229   3e-68   Citrus clementina [clementine]
gb|KJB77268.1|  hypothetical protein B456_012G128800                    229   5e-68   Gossypium raimondii
ref|XP_007132659.1|  hypothetical protein PHAVU_011G113900g             226   3e-67   Phaseolus vulgaris [French bean]
ref|XP_010540875.1|  PREDICTED: extensin                                225   3e-67   Tarenaya hassleriana [spider flower]
emb|CDY18985.1|  BnaC01g20830D                                          225   4e-67   Brassica napus [oilseed rape]
gb|KDO51850.1|  hypothetical protein CISIN_1g008878mg                   226   6e-67   Citrus sinensis [apfelsine]
ref|XP_006447363.1|  hypothetical protein CICLE_v10014791mg             225   1e-66   Citrus clementina [clementine]
emb|CDY14248.1|  BnaA08g13790D                                          223   2e-66   Brassica napus [oilseed rape]
ref|XP_010242911.1|  PREDICTED: RNA polymerase II degradation fac...    219   2e-64   Nelumbo nucifera [Indian lotus]
gb|KJB77271.1|  hypothetical protein B456_012G128800                    219   4e-64   Gossypium raimondii
ref|XP_009109102.1|  PREDICTED: formin-like protein 3                   217   6e-64   Brassica rapa
emb|CDY67879.1|  BnaC07g50480D                                          211   5e-62   Brassica napus [oilseed rape]
ref|XP_009137778.1|  PREDICTED: basic salivary proline-rich prote...    211   9e-62   Brassica rapa
gb|ACU16150.1|  unknown                                                 188   3e-56   Glycine max [soybeans]
ref|XP_010919593.1|  PREDICTED: tyrosine-protein phosphatase non-...    191   4e-54   Elaeis guineensis
ref|XP_003540363.1|  PREDICTED: integrator complex subunit 3 homo...    192   4e-54   Glycine max [soybeans]
emb|CBI21851.3|  unnamed protein product                                181   8e-54   Vitis vinifera
gb|KHN36637.1|  hypothetical protein glysoja_001368                     190   2e-53   Glycine soja [wild soybean]
ref|XP_003543336.1|  PREDICTED: RNA polymerase II degradation fac...    190   2e-53   Glycine max [soybeans]
ref|XP_008810225.1|  PREDICTED: ataxin-2 homolog isoform X1             189   3e-53   Phoenix dactylifera
ref|XP_009395702.1|  PREDICTED: pollen-specific leucine-rich repe...    190   4e-53   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN71577.1|  hypothetical protein VITISV_043279                     182   1e-52   Vitis vinifera
gb|KEH39131.1|  structural constituent of cell wall protein, puta...    187   1e-52   Medicago truncatula
ref|XP_007149849.1|  hypothetical protein PHAVU_005G103700g             187   2e-52   Phaseolus vulgaris [French bean]
ref|XP_008798248.1|  PREDICTED: putative cyclin-dependent serine/...    186   4e-52   Phoenix dactylifera
ref|XP_008655245.1|  PREDICTED: uncharacterized protein LOC100383...    187   6e-52   Zea mays [maize]
ref|NP_974630.1|  uncharacterized protein                               184   9e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010924425.1|  PREDICTED: hepatocyte growth factor-regulate...    184   3e-51   Elaeis guineensis
ref|XP_006644725.1|  PREDICTED: mediator of RNA polymerase II tra...    180   2e-49   Oryza brachyantha
ref|NP_001044280.1|  Os01g0754500                                       179   5e-49   
ref|XP_006644724.1|  PREDICTED: mediator of RNA polymerase II tra...    179   5e-49   Oryza brachyantha
ref|XP_002458505.1|  hypothetical protein SORBIDRAFT_03g034890          179   6e-49   Sorghum bicolor [broomcorn]
dbj|BAK01177.1|  predicted protein                                      179   6e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC71500.1|  hypothetical protein OsI_03777                          178   1e-48   Oryza sativa Indica Group [Indian rice]
gb|EMS50510.1|  hypothetical protein TRIUR3_23019                       178   1e-48   Triticum urartu
emb|CDM84126.1|  unnamed protein product                                176   5e-48   Triticum aestivum [Canadian hard winter wheat]
gb|EMT05386.1|  hypothetical protein F775_26441                         176   5e-48   
ref|XP_004969990.1|  PREDICTED: trithorax group protein osa-like        176   5e-48   Setaria italica
ref|XP_010051997.1|  PREDICTED: LOW QUALITY PROTEIN: bromodomain-...    167   4e-45   Eucalyptus grandis [rose gum]
gb|KJB77274.1|  hypothetical protein B456_012G128800                    164   2e-44   Gossypium raimondii
gb|KEH39132.1|  structural constituent of cell wall protein, puta...    164   5e-44   Medicago truncatula
ref|XP_010919602.1|  PREDICTED: tyrosine-protein phosphatase non-...    161   4e-43   Elaeis guineensis
ref|XP_008810226.1|  PREDICTED: ataxin-2 homolog isoform X2             160   9e-43   Phoenix dactylifera
ref|XP_006844887.1|  hypothetical protein AMTR_s00058p00125550          156   6e-41   
gb|KCW89535.1|  hypothetical protein EUGRSUZ_A01820                     150   6e-39   Eucalyptus grandis [rose gum]
ref|XP_009396506.1|  PREDICTED: pinin-like                              148   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001169238.1|  uncharacterized protein LOC100383096               146   2e-37   Zea mays [maize]
gb|EEE55398.1|  hypothetical protein OsJ_03493                          140   7e-36   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99014.1|  hypothetical protein OsI_20972                          125   4e-30   Oryza sativa Indica Group [Indian rice]
gb|AAU10648.1|  hypothetical protein                                    125   4e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006655586.1|  PREDICTED: adenylate cyclase, terminal-diffe...    123   3e-29   
ref|XP_002440244.1|  hypothetical protein SORBIDRAFT_09g028390          117   3e-27   Sorghum bicolor [broomcorn]
ref|XP_004961233.1|  PREDICTED: adenylate cyclase, terminal-diffe...    116   5e-27   Setaria italica
ref|XP_004961232.1|  PREDICTED: adenylate cyclase, terminal-diffe...    116   9e-27   Setaria italica
gb|AFW79145.1|  putative DUF1421 domain family protein                  115   1e-26   
ref|XP_006644504.1|  PREDICTED: mediator of RNA polymerase II tra...    115   2e-26   
ref|NP_001266367.1|  uncharacterized protein LOC101202710               114   4e-26   
tpg|DAA58178.1|  TPA: putative DUF1421 domain family protein            114   4e-26   
ref|NP_001143126.1|  uncharacterized protein LOC100275604               114   4e-26   Zea mays [maize]
gb|ACN33301.1|  unknown                                                 114   4e-26   Zea mays [maize]
ref|XP_002458299.1|  hypothetical protein SORBIDRAFT_03g030820          113   1e-25   Sorghum bicolor [broomcorn]
ref|XP_010232129.1|  PREDICTED: uncharacterized protein LOC100831431    112   3e-25   Brachypodium distachyon [annual false brome]
gb|EAY75332.1|  hypothetical protein OsI_03225                          112   4e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_004960805.1|  PREDICTED: protein diaphanous homolog 1-like       112   6e-25   
gb|EAZ13051.1|  hypothetical protein OsJ_02970                          111   6e-25   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001142422.1|  putative DUF1421 domain family protein             110   1e-24   Zea mays [maize]
ref|XP_003567907.1|  PREDICTED: transcriptional regulator DEF1-like     110   1e-24   Brachypodium distachyon [annual false brome]
ref|XP_008654665.1|  PREDICTED: putative DUF1421 domain family pr...    109   2e-24   Zea mays [maize]
ref|XP_008654664.1|  PREDICTED: putative DUF1421 domain family pr...    110   2e-24   Zea mays [maize]
ref|XP_003568842.1|  PREDICTED: zyxin-like                              109   3e-24   Brachypodium distachyon [annual false brome]
gb|EMS64546.1|  hypothetical protein TRIUR3_27252                       110   4e-24   Triticum urartu
ref|XP_002440684.1|  hypothetical protein SORBIDRAFT_09g005090          109   4e-24   
dbj|BAJ85240.1|  predicted protein                                      109   5e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT01630.1|  hypothetical protein F775_09697                         109   5e-24   
ref|XP_008666394.1|  PREDICTED: putative mediator of RNA polymera...    107   6e-24   Zea mays [maize]
dbj|BAK01901.1|  predicted protein                                      108   6e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94416.1|  predicted protein                                      108   9e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA47389.1|  TPA: hypothetical protein ZEAMMB73_495059              105   2e-23   
emb|CDM83294.1|  unnamed protein product                                106   2e-23   Triticum aestivum [Canadian hard winter wheat]
gb|EMS54596.1|  Tryptophan aminotransferase 1                           108   3e-23   Triticum urartu
gb|ADE75761.1|  unknown                                                 106   4e-23   Picea sitchensis
ref|XP_008656735.1|  PREDICTED: chromatin modification-related pr...    107   4e-23   Zea mays [maize]
ref|XP_006655038.1|  PREDICTED: vegetative cell wall protein gp1-...    104   2e-22   Oryza brachyantha
ref|XP_008801947.1|  PREDICTED: arginine-glutamic acid dipeptide ...    103   3e-22   Phoenix dactylifera
ref|NP_001140648.1|  uncharacterized protein LOC100272723               103   4e-22   Zea mays [maize]
dbj|BAK07367.1|  predicted protein                                      103   5e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM81418.1|  unnamed protein product                                103   8e-22   Triticum aestivum [Canadian hard winter wheat]
gb|EMS67668.1|  hypothetical protein TRIUR3_30524                       102   1e-21   Triticum urartu
ref|NP_001054762.2|  Os05g0169400                                       102   2e-21   
gb|AFW80147.1|  putative DUF1421 domain family protein                  102   2e-21   
gb|EAY96697.1|  hypothetical protein OsI_18619                          101   3e-21   Oryza sativa Indica Group [Indian rice]
emb|CBI34879.3|  unnamed protein product                                100   3e-21   Vitis vinifera
ref|XP_002275607.1|  PREDICTED: protein enabled                         101   4e-21   Vitis vinifera
ref|XP_011097415.1|  PREDICTED: protein enabled-like                    100   4e-21   Sesamum indicum [beniseed]
ref|XP_010108811.1|  hypothetical protein L484_020546                   101   4e-21   Morus notabilis
ref|XP_006643803.1|  PREDICTED: vegetative cell wall protein gp1-...    100   8e-21   Oryza brachyantha
ref|NP_001147786.1|  LOC100281396                                       100   1e-20   
ref|XP_008656734.1|  PREDICTED: mediator of RNA polymerase II tra...    100   1e-20   
gb|AFW83522.1|  putative DUF1421 domain family protein                99.8    1e-20   
ref|XP_008784980.1|  PREDICTED: uncharacterized protein LOC103703781    100   2e-20   Phoenix dactylifera
emb|CAN60421.1|  hypothetical protein VITISV_021069                   99.8    2e-20   Vitis vinifera
ref|XP_002985569.1|  hypothetical protein SELMODRAFT_446314           99.0    2e-20   Selaginella moellendorffii
ref|XP_002455112.1|  hypothetical protein SORBIDRAFT_03g004550        99.4    2e-20   
ref|XP_002987005.1|  hypothetical protein SELMODRAFT_425866           99.0    2e-20   Selaginella moellendorffii
ref|XP_004968338.1|  PREDICTED: class E vacuolar protein-sorting ...  98.6    3e-20   Setaria italica
ref|XP_006833453.1|  hypothetical protein AMTR_s00082p00053170        99.4    3e-20   
ref|XP_010940140.1|  PREDICTED: protein diaphanous homolog 1-like     98.6    3e-20   Elaeis guineensis
gb|KFK25694.1|  hypothetical protein AALP_AA8G147000                  97.8    4e-20   Arabis alpina [alpine rockcress]
ref|XP_008795992.1|  PREDICTED: protein transport protein SEC31-like  97.4    7e-20   
ref|NP_001042136.2|  Os01g0169900                                     97.4    7e-20   
ref|XP_010230500.1|  PREDICTED: uncharacterized protein LOC100838076  98.2    8e-20   Brachypodium distachyon [annual false brome]
ref|XP_010033310.1|  PREDICTED: pollen-specific leucine-rich repe...  97.4    9e-20   Eucalyptus grandis [rose gum]
ref|XP_010551915.1|  PREDICTED: actin cytoskeleton-regulatory com...  95.5    3e-19   Tarenaya hassleriana [spider flower]
ref|XP_002873675.1|  predicted protein                                94.0    5e-19   
ref|XP_010248593.1|  PREDICTED: pollen-specific leucine-rich repe...  95.1    5e-19   Nelumbo nucifera [Indian lotus]
ref|XP_003525675.1|  PREDICTED: arginine-glutamic acid dipeptide ...  95.1    5e-19   Glycine max [soybeans]
gb|KHN27460.1|  hypothetical protein glysoja_022169                   95.1    5e-19   Glycine soja [wild soybean]
ref|XP_010906083.1|  PREDICTED: protein transport protein SEC31       94.4    7e-19   Elaeis guineensis
ref|XP_004232320.1|  PREDICTED: pollen-specific leucine-rich repe...  94.4    8e-19   Solanum lycopersicum
gb|KDP45326.1|  hypothetical protein JCGZ_09575                       94.4    9e-19   Jatropha curcas
emb|CDP02078.1|  unnamed protein product                              94.0    1e-18   Coffea canephora [robusta coffee]
ref|XP_009782100.1|  PREDICTED: pollen-specific leucine-rich repe...  94.0    1e-18   Nicotiana sylvestris
ref|XP_010908580.1|  PREDICTED: pollen-specific leucine-rich repe...  93.2    2e-18   Elaeis guineensis
ref|XP_010492262.1|  PREDICTED: basic salivary proline-rich prote...  92.8    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006338590.1|  PREDICTED: AT-rich interactive domain-contai...  92.8    3e-18   Solanum tuberosum [potatoes]
gb|EYU44780.1|  hypothetical protein MIMGU_mgv1a004985mg              92.4    4e-18   Erythranthe guttata [common monkey flower]
emb|CAB87621.1|  putative protein                                     92.4    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388841.1|  PREDICTED: bromodomain-containing protein 4      92.4    4e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011464066.1|  PREDICTED: formin-like protein 3 isoform X2      92.4    4e-18   Fragaria vesca subsp. vesca
ref|XP_004299014.1|  PREDICTED: formin-like protein 3 isoform X1      92.4    4e-18   Fragaria vesca subsp. vesca
ref|XP_009611188.1|  PREDICTED: transcriptional regulator DEF1 is...  92.4    4e-18   Nicotiana tomentosiformis
ref|NP_196958.2|  uncharacterized protein                             92.4    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009611187.1|  PREDICTED: transcriptional regulator DEF1 is...  92.0    5e-18   Nicotiana tomentosiformis
ref|XP_009403230.1|  PREDICTED: pollen-specific leucine-rich repe...  92.0    5e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006603779.1|  PREDICTED: vacuolar protein sorting-associat...  90.9    1e-17   
gb|KJB75894.1|  hypothetical protein B456_012G063600                  91.7    1e-17   Gossypium raimondii
ref|XP_010910341.1|  PREDICTED: pollen-specific leucine-rich repe...  90.9    1e-17   Elaeis guineensis
ref|XP_003554822.1|  PREDICTED: vacuolar protein sorting-associat...  91.3    1e-17   Glycine max [soybeans]
ref|XP_010910342.1|  PREDICTED: pollen-specific leucine-rich repe...  90.9    1e-17   Elaeis guineensis
ref|XP_008379205.1|  PREDICTED: protein enabled                       90.9    1e-17   
ref|XP_006289230.1|  hypothetical protein CARUB_v10002686mg           90.9    1e-17   Capsella rubella
ref|XP_007031556.1|  Uncharacterized protein TCM_016944               90.9    1e-17   
ref|XP_008365379.1|  PREDICTED: protein enabled-like                  90.9    2e-17   
ref|XP_011098435.1|  PREDICTED: protein diaphanous homolog 1-like     90.9    2e-17   Sesamum indicum [beniseed]
ref|XP_010037529.1|  PREDICTED: vegetative cell wall protein gp1-...  90.1    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010420094.1|  PREDICTED: protein transport protein sec31-like  90.1    2e-17   
ref|XP_009125983.1|  PREDICTED: WW domain-binding protein 11 isof...  89.7    3e-17   Brassica rapa
ref|XP_002524656.1|  DNA binding protein, putative                    89.7    3e-17   Ricinus communis
ref|XP_009125985.1|  PREDICTED: WW domain-binding protein 11 isof...  89.7    3e-17   Brassica rapa
emb|CDX85594.1|  BnaA02g02190D                                        89.4    3e-17   
ref|XP_009334114.1|  PREDICTED: arginine-glutamic acid dipeptide ...  89.7    4e-17   Pyrus x bretschneideri [bai li]
emb|CDX91045.1|  BnaC02g05520D                                        89.0    5e-17   
ref|XP_010453577.1|  PREDICTED: basic salivary proline-rich prote...  89.0    6e-17   Camelina sativa [gold-of-pleasure]
gb|KHG02060.1|  Myosin-2                                              89.0    6e-17   Gossypium arboreum [tree cotton]
gb|KDO55180.1|  hypothetical protein CISIN_1g0084162mg                88.6    6e-17   Citrus sinensis [apfelsine]
ref|XP_004489226.1|  PREDICTED: vacuolar protein sorting-associat...  89.0    7e-17   Cicer arietinum [garbanzo]
ref|XP_008393001.1|  PREDICTED: putative uncharacterized protein ...  88.6    8e-17   
gb|KDO55178.1|  hypothetical protein CISIN_1g0084162mg                88.2    1e-16   Citrus sinensis [apfelsine]
gb|KDO55179.1|  hypothetical protein CISIN_1g0084162mg                88.2    1e-16   Citrus sinensis [apfelsine]
ref|XP_006470271.1|  PREDICTED: COPII coat assembly protein sec16...  88.2    1e-16   Citrus sinensis [apfelsine]
gb|KFK37621.1|  hypothetical protein AALP_AA3G007100                  87.8    1e-16   Arabis alpina [alpine rockcress]
emb|CBI14977.3|  unnamed protein product                              86.7    2e-16   Vitis vinifera
ref|XP_006446566.1|  hypothetical protein CICLE_v10014743mg           87.8    2e-16   Citrus clementina [clementine]
ref|XP_010663116.1|  PREDICTED: vegetative cell wall protein gp1-...  86.7    3e-16   Vitis vinifera
ref|XP_010663115.1|  PREDICTED: proline-rich receptor-like protei...  86.7    3e-16   Vitis vinifera
gb|KEH24794.1|  DNA-binding protein, putative                         86.7    4e-16   Medicago truncatula
ref|XP_008230557.1|  PREDICTED: protein transport protein SEC31       86.3    5e-16   Prunus mume [ume]
ref|XP_006341319.1|  PREDICTED: trithorax group protein osa-like      85.1    1e-15   Solanum tuberosum [potatoes]
gb|KJB40754.1|  hypothetical protein B456_007G076000                  85.1    1e-15   Gossypium raimondii
gb|KJB40753.1|  hypothetical protein B456_007G076000                  85.1    1e-15   Gossypium raimondii
gb|KJB40752.1|  hypothetical protein B456_007G076000                  84.7    2e-15   Gossypium raimondii
tpg|DAA58177.1|  TPA: putative DUF1421 domain family protein          80.5    2e-15   
tpg|DAA58176.1|  TPA: putative DUF1421 domain family protein          80.9    2e-15   
gb|ACN28687.1|  unknown                                               79.7    2e-15   Zea mays [maize]
ref|XP_007217219.1|  hypothetical protein PRUPE_ppa003425mg           84.3    2e-15   Prunus persica
ref|XP_007150938.1|  hypothetical protein PHAVU_004G007500g           84.0    3e-15   Phaseolus vulgaris [French bean]
gb|ACZ74657.1|  hypothetical protein                                  84.0    3e-15   Phaseolus vulgaris [French bean]
ref|XP_009362961.1|  PREDICTED: histone acetyltransferase KAT6A-l...  81.3    8e-15   
ref|XP_008219121.1|  PREDICTED: uncharacterized protein LOC103319367  83.6    1e-14   
ref|XP_009362960.1|  PREDICTED: uncharacterized protein LOC103952...  81.6    1e-14   Pyrus x bretschneideri [bai li]
ref|NP_186805.2|  uncharacterized protein                             82.0    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|AAF01541.1|AC009325_11  unknown protein                            81.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KHG20812.1|  Actin cytoskeleton-regulatory complex PAN1            82.0    1e-14   Gossypium arboreum [tree cotton]
ref|XP_007222918.1|  hypothetical protein PRUPE_ppa003684mg           81.6    2e-14   Prunus persica
ref|XP_011047322.1|  PREDICTED: vacuolar protein sorting-associat...  80.9    4e-14   Populus euphratica
ref|XP_006408524.1|  hypothetical protein EUTSA_v10020517mg           80.1    5e-14   Eutrema salsugineum [saltwater cress]
gb|KCW54142.1|  hypothetical protein EUGRSUZ_I00119                   79.3    7e-14   Eucalyptus grandis [rose gum]
ref|XP_006297454.1|  hypothetical protein CARUB_v10013474mg           79.7    8e-14   
ref|XP_004252212.1|  PREDICTED: extensin-like                         79.3    9e-14   Solanum lycopersicum
ref|XP_002884275.1|  hypothetical protein ARALYDRAFT_477359           78.6    2e-13   
ref|XP_008374404.1|  PREDICTED: TSC22 domain family protein 1-like    78.2    2e-13   
ref|XP_011047827.1|  PREDICTED: arginine-glutamic acid dipeptide ...  77.8    4e-13   Populus euphratica
ref|XP_011047825.1|  PREDICTED: altered inheritance of mitochondr...  77.8    4e-13   Populus euphratica
ref|XP_002511348.1|  conserved hypothetical protein                   77.4    4e-13   
ref|XP_002318061.2|  hypothetical protein POPTR_0012s08510g           77.0    5e-13   Populus trichocarpa [western balsam poplar]
ref|XP_001758183.1|  predicted protein                                76.3    9e-13   
ref|XP_008245310.1|  PREDICTED: uncharacterized protein LOC103343434  75.9    1e-12   Prunus mume [ume]
ref|XP_004298978.1|  PREDICTED: uncharacterized protein LOC101312152  75.9    1e-12   Fragaria vesca subsp. vesca
ref|XP_007210457.1|  hypothetical protein PRUPE_ppa005168m1g          72.8    3e-12   
ref|XP_010694912.1|  PREDICTED: putative uncharacterized protein ...  74.7    4e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007036361.1|  Apoptosis-stimulating of p53 protein 1, puta...  73.9    5e-12   
ref|XP_009613822.1|  PREDICTED: SH3 domain-containing protein C23...  73.9    7e-12   Nicotiana tomentosiformis
ref|XP_009613823.1|  PREDICTED: putative uncharacterized protein ...  73.2    9e-12   Nicotiana tomentosiformis
ref|XP_001770189.1|  predicted protein                                72.8    1e-11   
gb|KHF97501.1|  Maltoporin                                            67.8    1e-11   Gossypium arboreum [tree cotton]
gb|EPS66622.1|  hypothetical protein M569_08156                       69.7    1e-11   Genlisea aurea
gb|KDO69523.1|  hypothetical protein CISIN_1g009789mg                 72.8    1e-11   Citrus sinensis [apfelsine]
ref|XP_006439889.1|  hypothetical protein CICLE_v10019708mg           72.8    1e-11   Citrus clementina [clementine]
gb|KDO69524.1|  hypothetical protein CISIN_1g009789mg                 72.8    1e-11   Citrus sinensis [apfelsine]
ref|XP_006476848.1|  PREDICTED: AT-rich interactive domain-contai...  72.8    1e-11   Citrus sinensis [apfelsine]
ref|XP_001784568.1|  predicted protein                                72.0    2e-11   
ref|XP_009766181.1|  PREDICTED: programmed cell death 6-interacti...  72.8    2e-11   Nicotiana sylvestris
ref|XP_011046206.1|  PREDICTED: uncharacterized protein LOC105140870  72.4    2e-11   Populus euphratica
ref|XP_010102503.1|  hypothetical protein L484_014559                 72.0    3e-11   
ref|XP_008245313.1|  PREDICTED: uncharacterized protein LOC103343438  68.9    1e-10   
ref|XP_005849501.1|  hypothetical protein CHLNCDRAFT_142823           63.2    3e-09   Chlorella variabilis
gb|KDP31054.1|  hypothetical protein JCGZ_11430                       64.7    7e-09   
ref|XP_010496293.1|  PREDICTED: proline-rich receptor-like protei...  62.4    4e-08   
gb|KJB77267.1|  hypothetical protein B456_012G128800                  59.7    3e-07   
ref|XP_011400494.1|  hypothetical protein F751_5373                   57.4    1e-06   
ref|XP_010435634.1|  PREDICTED: proline-rich receptor-like protei...  57.4    2e-06   
ref|XP_008361778.1|  PREDICTED: uncharacterized protein LOC103425469  56.6    2e-06   
ref|XP_010924426.1|  PREDICTED: putative cyclin-dependent serine/...  55.1    9e-06   
ref|XP_002949828.1|  hypothetical protein VOLCADRAFT_90250            55.1    1e-05   
ref|XP_008341426.1|  PREDICTED: YLP motif-containing protein 1-like   54.3    2e-05   
ref|XP_009595505.1|  PREDICTED: uncharacterized protein LOC104091...  51.2    2e-05   
ref|XP_009377181.1|  PREDICTED: protein transport protein SEC31-like  52.8    6e-05   
gb|KHN27461.1|  hypothetical protein glysoja_022170                   49.3    8e-05   
ref|XP_009595507.1|  PREDICTED: uncharacterized protein LOC104091...  49.3    1e-04   
gb|KDO69525.1|  hypothetical protein CISIN_1g009789mg                 51.6    2e-04   
ref|XP_006369924.1|  hypothetical protein POPTR_0001s35000g           50.4    3e-04   
ref|XP_001693070.1|  predicted protein                                49.3    7e-04   



>ref|XP_006367642.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
[Solanum tuberosum]
Length=548

 Score =   289 bits (740),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +2

Query  65   MASGSSGLPNNS-ASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrm  241
            MASGSSG P+NS  SK FDF SDDILCSYEDY +Q+ S  +HSDPA+A+NSAKEFHK+RM
Sbjct  1    MASGSSGRPSNSSGSKGFDFGSDDILCSYEDYPHQDASNGTHSDPAIATNSAKEFHKNRM  60

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
            TRSSM PTS Y PPE+SSFNQD+I  VEK+MKKY DNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  61   TRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYTDNLMRFLEGISSRLSQLELYCYNLD  120

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMRSDLV DHGE D KLK+LEKH+QEVHRSVQILRDKQELA+ QKELAKLQ AQ E
Sbjct  121  KSIGEMRSDLVRDHGEADLKLKALEKHVQEVHRSVQILRDKQELAETQKELAKLQFAQKE  180

Query  602  SGSANNSQ  625
              SANNSQ
Sbjct  181  PASANNSQ  188



>ref|XP_006357482.1| PREDICTED: transcription factor SPT20 homolog [Solanum tuberosum]
Length=537

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG  NN+ SK FDFASDDILCSYEDY NQ+ S  +HSDP +A+NSAKEFHKSRMT
Sbjct  1    MASGSSGRSNNAGSKGFDFASDDILCSYEDYANQDPSNGTHSDPVIAANSAKEFHKSRMT  60

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RSSM P  AY PPE+SSFNQD+I  +EK+MKKY DNLMRFLEG+SSRLSQLELYCYNLDK
Sbjct  61   RSSMFPAPAYSPPEESSFNQDMICTIEKTMKKYTDNLMRFLEGISSRLSQLELYCYNLDK  120

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            SIGEMRSDLV DHGE DSKLK+LEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ
Sbjct  121  SIGEMRSDLVRDHGEADSKLKALEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQ  177



>ref|XP_009628959.1| PREDICTED: extensin-like [Nicotiana tomentosiformis]
Length=534

 Score =   283 bits (724),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 164/188 (87%), Gaps = 1/188 (1%)
 Frame = +2

Query  65   MASGSSGLPNNS-ASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrm  241
            MASGSSG P+NS  SK FDF SDDILCSYED+   + S  SHSDP+ A+NSAKEFHKSRM
Sbjct  1    MASGSSGRPSNSSGSKGFDFGSDDILCSYEDFPRHDPSNGSHSDPSAANNSAKEFHKSRM  60

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
            TRSSM PTS Y PPE+SSFNQD+I  VEK+MKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  61   TRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYADNLMRFLEGISSRLSQLELYCYNLD  120

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMR+DLV DHGE DSKLK+LEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  121  KSIGEMRADLVRDHGEADSKLKALEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQKE  180

Query  602  SGSANNSQ  625
              + +NSQ
Sbjct  181  PATPSNSQ  188



>ref|XP_004243351.1| PREDICTED: bromodomain-containing protein 4-like [Solanum lycopersicum]
Length=537

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG  NN+ SK FDFASDDILCSYEDY NQ+ S  +HSD  +A+NSAKEFHKSRMT
Sbjct  1    MASGSSGRSNNAGSKGFDFASDDILCSYEDYANQDPSNGTHSDSVIAANSAKEFHKSRMT  60

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RSSM P  AY PPE+SSFNQD+I  +EK+MKKY DNLMRFLEG+SSRLSQLELYCYNLDK
Sbjct  61   RSSMFPAPAYSPPEESSFNQDMICTIEKTMKKYTDNLMRFLEGISSRLSQLELYCYNLDK  120

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            SIGEMRSDLV DHGE DSKLK+LEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ
Sbjct  121  SIGEMRSDLVRDHGEADSKLKALEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQ  177



>ref|XP_009628597.1| PREDICTED: ataxin-2 homolog [Nicotiana tomentosiformis]
Length=535

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 162/188 (86%), Gaps = 4/188 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYG-NQEKSARSHSDPAVASNSAKEFHKsrm  241
            MASGSSG PNN     FDF SDDILCSYED+  NQ+ S  +HSDP +A NSAKEFHKSRM
Sbjct  1    MASGSSGRPNNGG---FDFGSDDILCSYEDFAANQDPSNGTHSDPVIAPNSAKEFHKSRM  57

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
            TRSSM P  AY PPE+SSFNQD+I  VEK+MKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  58   TRSSMFPAPAYSPPEESSFNQDMICTVEKTMKKYADNLMRFLEGISSRLSQLELYCYNLD  117

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMRSDLV DHGE DSKLK+LEKH+QEVHR+VQILRDKQELA+ QKELAKLQLAQ +
Sbjct  118  KSIGEMRSDLVRDHGEADSKLKALEKHVQEVHRAVQILRDKQELAETQKELAKLQLAQKD  177

Query  602  SGSANNSQ  625
            S S++N Q
Sbjct  178  STSSSNCQ  185



>ref|XP_009782624.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=539

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +2

Query  65   MASGSSGLPNNS-ASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrm  241
            MASGSSG P+NS  SK FDF SDDILCSYED+ + + S  SHSDP+ A+NSAKEFHKSRM
Sbjct  1    MASGSSGRPSNSSGSKGFDFGSDDILCSYEDFPHHDPSNGSHSDPSAANNSAKEFHKSRM  60

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
            TRSSM PTS Y PPE+SSFNQD+I  V+K+MKKYADN+MRFLEG+SSRLSQLELYCYNLD
Sbjct  61   TRSSMFPTSTYSPPEESSFNQDMICTVDKTMKKYADNIMRFLEGISSRLSQLELYCYNLD  120

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMR+DLV DHGE DSKLK+LEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  121  KSIGEMRADLVRDHGEADSKLKALEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQKE  180

Query  602  SGSANNSQ  625
              + +NSQ
Sbjct  181  PATPSNSQ  188



>ref|XP_004248167.1| PREDICTED: bromodomain-containing protein 4 [Solanum lycopersicum]
Length=545

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 163/188 (87%), Gaps = 1/188 (1%)
 Frame = +2

Query  65   MASGSSGLPNNS-ASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrm  241
            MASGSSG P+NS  SK FDF SDDILCSYEDY +Q+ S  + SDPA+A++SAKEFHK+RM
Sbjct  1    MASGSSGRPSNSSGSKGFDFGSDDILCSYEDYPHQDASNGTLSDPAIATSSAKEFHKNRM  60

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
            TRSSM PTS Y PPE+SSFNQD+I  VEK+MKKY DNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  61   TRSSMFPTSTYSPPEESSFNQDMICTVEKTMKKYTDNLMRFLEGISSRLSQLELYCYNLD  120

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMRSDLV DHGE D KLK+LEKH+QEVHRSVQILRDKQELA+ QKELAKLQ A  E
Sbjct  121  KSIGEMRSDLVRDHGEADLKLKALEKHVQEVHRSVQILRDKQELAETQKELAKLQFAPKE  180

Query  602  SGSANNSQ  625
              SANNSQ
Sbjct  181  PASANNSQ  188



>gb|EYU28592.1| hypothetical protein MIMGU_mgv1a004659mg [Erythranthe guttata]
Length=516

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 157/187 (84%), Gaps = 0/187 (0%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG  NNS S  FDF SDDILCSYEDYGNQ+ +   HSDP  ++NS KEF+KSRM 
Sbjct  1    MASGSSGRVNNSGSNAFDFGSDDILCSYEDYGNQDGNNGIHSDPPSSANSGKEFNKSRMA  60

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RSS+ P   Y  PE+SSFNQ VI  VE +MKK+ DNLMRFLEG+SSRLSQLELYCYNLDK
Sbjct  61   RSSVFPAPTYGTPEESSFNQGVISTVENTMKKHTDNLMRFLEGISSRLSQLELYCYNLDK  120

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            SIGEMRSDLV DHGE++SKLKSL+KH+QEVHRSVQILRDKQELAD QKELAKL LAQ ES
Sbjct  121  SIGEMRSDLVRDHGESESKLKSLDKHIQEVHRSVQILRDKQELADTQKELAKLHLAQKES  180

Query  605  GSANNSQ  625
            GSA N+Q
Sbjct  181  GSATNTQ  187



>ref|XP_009782976.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Nicotiana sylvestris]
Length=535

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 162/188 (86%), Gaps = 4/188 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYG-NQEKSARSHSDPAVASNSAKEFHKsrm  241
            MASGSSG PNN+    F+F SD ILCSYEDY  NQ+ S  +HSDP +A NSAKEFHKSRM
Sbjct  1    MASGSSGRPNNAG---FNFGSDGILCSYEDYAANQDPSNGTHSDPVIAPNSAKEFHKSRM  57

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
            TRSSM P  AY PPE+SSFNQD+I  VEK+MKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  58   TRSSMFPAPAYSPPEESSFNQDMISTVEKTMKKYADNLMRFLEGISSRLSQLELYCYNLD  117

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMRSDLV DHGE DSKLK+LEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ +
Sbjct  118  KSIGEMRSDLVRDHGEADSKLKALEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQKD  177

Query  602  SGSANNSQ  625
            S S++ SQ
Sbjct  178  STSSSISQ  185



>ref|XP_011098021.1| PREDICTED: extensin [Sesamum indicum]
Length=525

 Score =   277 bits (709),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 158/185 (85%), Gaps = 0/185 (0%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGS+G  N+S SK FDF SDDILCSYEDYGNQ+ +   HSDP+ A+NS KEF+KSRM 
Sbjct  1    MASGSTGRANSSGSKAFDFGSDDILCSYEDYGNQDGNNGIHSDPSSATNSTKEFNKSRMA  60

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RSS+ P S Y PPE+SSFNQ VI  VE +MKKY DN+MRFLEG+SSR+SQLELYCYNLDK
Sbjct  61   RSSVFPASTYSPPEESSFNQGVITTVENTMKKYTDNIMRFLEGISSRMSQLELYCYNLDK  120

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            SIGEMRSDL+ DHGE++SKLKSLEKH+QEVHRSVQILRDKQELAD QKELAKLQLAQ ES
Sbjct  121  SIGEMRSDLLRDHGESESKLKSLEKHIQEVHRSVQILRDKQELADTQKELAKLQLAQKES  180

Query  605  GSANN  619
             +  N
Sbjct  181  SNQQN  185



>emb|CDP14783.1| unnamed protein product [Coffea canephora]
Length=539

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 161/187 (86%), Gaps = 2/187 (1%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCS-YEDYGNQEKS-ARSHSDPAVASNSAKEFHKsr  238
            MASGS+G P+NS SK F+F SDDILC  YEDYGNQ+ S   SHSDPA+ + SAKEFHK+R
Sbjct  1    MASGSAGRPSNSGSKPFNFVSDDILCGPYEDYGNQDGSNGTSHSDPAIGATSAKEFHKNR  60

Query  239  mtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNL  418
            M RSS+ P ++Y PPE+SSFNQDVI  VE++MKKYADNLMRFLEG+SSRLSQLELYCYNL
Sbjct  61   MARSSVFPAASYSPPEESSFNQDVIATVERTMKKYADNLMRFLEGISSRLSQLELYCYNL  120

Query  419  DKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQX  598
            DKSI EMRS+L  DH E ++KLKSLEKHLQEVHRSVQILRDKQELA+AQKELAKL LAQ 
Sbjct  121  DKSIAEMRSELGGDHTEAETKLKSLEKHLQEVHRSVQILRDKQELAEAQKELAKLHLAQK  180

Query  599  ESGSANN  619
            ES SA+N
Sbjct  181  ESSSASN  187



>ref|XP_008337475.1| PREDICTED: altered inheritance of mitochondria protein 3-like 
[Malus domestica]
Length=521

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/187 (74%), Positives = 156/187 (83%), Gaps = 2/187 (1%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MA+GSSG   N  S+ FDF SDDILCSYEDYGNQ+ S  +HS+P + +N  K+FHKSRM+
Sbjct  1    MATGSSGR-GNPVSQGFDFGSDDILCSYEDYGNQDSSNGNHSEPVMGNNPGKDFHKSRMS  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            R SM  + AY  PE+S  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLDK
Sbjct  60   RQSMFSSPAYSQPEES-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDK  118

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            SIGEMR+DL  DHGE DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ  S
Sbjct  119  SIGEMRTDLGRDHGEADSKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQKGS  178

Query  605  GSANNSQ  625
            GS+ +SQ
Sbjct  179  GSSTHSQ  185



>ref|XP_008229158.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X2 [Prunus mume]
Length=529

 Score =   267 bits (682),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 158/188 (84%), Gaps = 3/188 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKE-FHKsrm  241
            MASGSSG   N  ++ FDFASDDILCSYEDYGNQ+ S  +HSDP + +N +K+ FHKSRM
Sbjct  1    MASGSSGR-ANPGTQGFDFASDDILCSYEDYGNQDSSNGNHSDPVMGNNPSKQDFHKSRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             R SM  ++AY  PEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  60   ARQSMFSSAAYSQPEDS-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMRSDLV DHGE DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ  
Sbjct  119  KSIGEMRSDLVRDHGEADSKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQKG  178

Query  602  SGSANNSQ  625
            S S+ +SQ
Sbjct  179  SASSTHSQ  186



>ref|XP_007198900.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
 gb|EMJ00099.1| hypothetical protein PRUPE_ppa004117mg [Prunus persica]
Length=529

 Score =   267 bits (682),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 158/188 (84%), Gaps = 3/188 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKE-FHKsrm  241
            MASGSSG   N  ++ FDFASDDILCSYEDYGNQ+ S  +HSDP + +N +K+ FHKSRM
Sbjct  1    MASGSSGR-ANPGTQGFDFASDDILCSYEDYGNQDSSNGNHSDPVMGNNPSKQDFHKSRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             R SM  ++AY  PEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  60   ARQSMFSSAAYSQPEDS-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMRSDLV DHGE DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ  
Sbjct  119  KSIGEMRSDLVRDHGEADSKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQKG  178

Query  602  SGSANNSQ  625
            S S+ +SQ
Sbjct  179  SASSTHSQ  186



>ref|XP_008229157.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 isoform X1 [Prunus mume]
Length=530

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 158/189 (84%), Gaps = 4/189 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKE--FHKsr  238
            MASGSSG   N  ++ FDFASDDILCSYEDYGNQ+ S  +HSDP + +N +K+  FHKSR
Sbjct  1    MASGSSGR-ANPGTQGFDFASDDILCSYEDYGNQDSSNGNHSDPVMGNNPSKQQDFHKSR  59

Query  239  mtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNL  418
            M R SM  ++AY  PEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNL
Sbjct  60   MARQSMFSSAAYSQPEDS-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNL  118

Query  419  DKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQX  598
            DKSIGEMRSDLV DHGE DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ 
Sbjct  119  DKSIGEMRSDLVRDHGEADSKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQK  178

Query  599  ESGSANNSQ  625
             S S+ +SQ
Sbjct  179  GSASSTHSQ  187



>ref|XP_004506616.1| PREDICTED: transcription factor SPT20 homolog [Cicer arietinum]
Length=523

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 162/188 (86%), Gaps = 3/188 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSAR-SHSDPAVASNSAKEFHKsrm  241
            MASGSSG   N +SK FDFASDDILCSYED+ N++ ++  +HSD A+A NS K+FHK+R+
Sbjct  1    MASGSSGR-GNPSSKGFDFASDDILCSYEDFSNRDSNSNGNHSDSAIAPNSNKDFHKTRV  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             R+S+ PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  60   ARTSVFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMRSDL  DHGE DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  119  KSIGEMRSDLNRDHGEQDSKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQKE  178

Query  602  SGSANNSQ  625
            S S ++SQ
Sbjct  179  SSSTSHSQ  186



>gb|KDP24130.1| hypothetical protein JCGZ_25787 [Jatropha curcas]
Length=532

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 140/187 (75%), Positives = 158/187 (84%), Gaps = 2/187 (1%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG   NS SK FDF SDDILCSYEDY NQ+ S  +HSDP + SNS+K+FHK RM 
Sbjct  1    MASGSSGR-ANSGSKGFDFGSDDILCSYEDYTNQDSSNGTHSDPVIGSNSSKDFHKGRMA  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RSS+ P ++Y  PEDS F+QD+I   EKSMKK+ DN+MRFLEG+SSRLSQLELYCYNLDK
Sbjct  60   RSSVFPANSYSQPEDS-FSQDMISFFEKSMKKHTDNVMRFLEGVSSRLSQLELYCYNLDK  118

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            SIGEMRSDLV DHGE D+KLKSL KH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ ES
Sbjct  119  SIGEMRSDLVRDHGEADAKLKSLGKHIQEVHRSVQILRDKQELAETQKELAKLQLAQKES  178

Query  605  GSANNSQ  625
             S+N+SQ
Sbjct  179  ASSNHSQ  185



>ref|XP_004303103.1| PREDICTED: transcriptional regulator DEF1 [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   262 bits (670),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 152/178 (85%), Gaps = 3/178 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYG-NQEKSARSHSDPAVASNSAKEFHKsrm  241
            MASGSSG   N  SK FDFASDDILCSYED+G NQ+ S  SH+DPA+ +NS ++FHKSRM
Sbjct  1    MASGSSGR-ANPGSKGFDFASDDILCSYEDFGSNQDSSNGSHNDPAIGTNSTQDFHKSRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             RS M  ++AY  PEDS  NQ+VI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  60   ARSPMYSSAAYGQPEDS-LNQEVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            KSIGEMRSDL  DHGE D+KLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ
Sbjct  119  KSIGEMRSDLNRDHGEADTKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQ  176



>ref|XP_009357856.1| PREDICTED: putative uncharacterized protein DDB_G0294196 [Pyrus 
x bretschneideri]
 ref|XP_009357877.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Pyrus x bretschneideri]
Length=521

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 155/187 (83%), Gaps = 2/187 (1%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MA+GSSG   N  S+ FDF SDDILCSYEDYGNQ+ S  +H++P + +N  K+FHKSRM+
Sbjct  1    MATGSSGR-GNPVSQGFDFGSDDILCSYEDYGNQDSSNGNHNEPVMGNNPGKDFHKSRMS  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            R SM  + AY  PE+S  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLDK
Sbjct  60   RQSMFSSPAYSQPEES-LHQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDK  118

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            SIGEMRSDL  DH E DSKLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ  S
Sbjct  119  SIGEMRSDLGRDHEEADSKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQKGS  178

Query  605  GSANNSQ  625
            GS+ +SQ
Sbjct  179  GSSIHSQ  185



>ref|XP_010110218.1| hypothetical protein L484_009824 [Morus notabilis]
 gb|EXC25515.1| hypothetical protein L484_009824 [Morus notabilis]
Length=527

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/179 (75%), Positives = 148/179 (83%), Gaps = 3/179 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG   NS SK FDFASDDILCSYEDYGNQ+     HS+P ++S+S K+FH +R  
Sbjct  1    MASGSSGR-ANSGSKGFDFASDDILCSYEDYGNQDSPNGGHSEPVISSSSGKDFHNTRRG  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RS      AY  PEDS FNQDVI AVEKSMK+ ADNLMRFLEG+SSRLSQLELYCYNLDK
Sbjct  60   RSVFTGA-AYTQPEDS-FNQDVISAVEKSMKRNADNLMRFLEGISSRLSQLELYCYNLDK  117

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            SIGEMRSDL+ DHGE DSKLK+++KHLQEVHRS+QILRDKQELAD QKELAKLQL Q E
Sbjct  118  SIGEMRSDLIRDHGEADSKLKAIDKHLQEVHRSIQILRDKQELADTQKELAKLQLVQKE  176



>ref|NP_194559.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL36251.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AAM20028.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|AEE85466.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=496

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVA-SNSAKEFHKsrm  241
            MASGSSG   NS SK FDF SDDILCSY+DY NQ+ S   HSDPA+A SNS KEFHK+RM
Sbjct  1    MASGSSGR-VNSGSKGFDFGSDDILCSYDDYTNQDSSNGPHSDPAIAASNSNKEFHKTRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             RSS+ PTS+Y PPEDS  +QD+ D VE++MK YADN+MRFLEGLSSRLSQLELYCYNLD
Sbjct  60   ARSSVFPTSSYSPPEDS-LSQDITDTVERTMKMYADNMMRFLEGLSSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            K+IGEMRS+L H H + D KL+SL+KHLQEVHRSVQILRDKQELAD QKELAKLQL Q E
Sbjct  119  KTIGEMRSELTHAHEDADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELAKLQLVQKE  178



>ref|XP_009341977.1| PREDICTED: ATP-dependent helicase brm-like isoform X2 [Pyrus 
x bretschneideri]
Length=521

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 153/187 (82%), Gaps = 2/187 (1%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSS       S+ FDFASDDILCSYEDYGNQ+ S  +HS+P + +NS K+FH+SRM+
Sbjct  1    MASGSSAR-ATPGSQGFDFASDDILCSYEDYGNQDSSNGNHSEPVMGNNSGKDFHRSRMS  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQLELYCYN+DK
Sbjct  60   RQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNVDK  118

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            SIGEMRSDL  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+AQKELAKLQLAQ  S
Sbjct  119  SIGEMRSDLGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAEAQKELAKLQLAQKGS  178

Query  605  GSANNSQ  625
             S+ +SQ
Sbjct  179  ASSTHSQ  185



>ref|XP_002869511.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45770.1| hypothetical protein ARALYDRAFT_491942 [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score =   251 bits (641),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 153/180 (85%), Gaps = 3/180 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVAS-NSAKEFHKsrm  241
            MASGSSG   NS SK FDF SDDILCSY+DY NQ+ S   +SDPA+A+ NS KEFHK+RM
Sbjct  1    MASGSSGR-VNSGSKGFDFGSDDILCSYDDYTNQDSSNGPNSDPAIAAANSNKEFHKTRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLELYCYNLD
Sbjct  60   ARSSVFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            K+IGEMRS+L H+H E D KL+SL+KHLQEVHRSVQILRDKQELAD QKELAKLQL Q E
Sbjct  119  KTIGEMRSELTHEHEEADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELAKLQLVQKE  178



>ref|XP_009336199.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Pyrus x bretschneideri]
Length=521

 Score =   251 bits (641),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 152/187 (81%), Gaps = 2/187 (1%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSS    N  S+ FDFASDDILCSYEDYGNQ+ S  +HS+P + +NS K+ H+SR+ 
Sbjct  1    MASGSSTR-GNPGSQGFDFASDDILCSYEDYGNQDSSNGNHSEPVMGNNSGKDIHRSRLA  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQLELYCYN+DK
Sbjct  60   RQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNVDK  118

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            SIGEMRS+L  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+AQKELAKLQLAQ  S
Sbjct  119  SIGEMRSELGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAEAQKELAKLQLAQKGS  178

Query  605  GSANNSQ  625
             S+ +SQ
Sbjct  179  ASSTHSQ  185



>ref|XP_008342911.1| PREDICTED: extensin-like isoform X2 [Malus domestica]
Length=521

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 151/187 (81%), Gaps = 2/187 (1%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSS    N  S+ FDF SDDILCSYEDYGNQ+ S  +HS+P + +NS K+F +SRM+
Sbjct  1    MASGSSAR-GNPGSQGFDFGSDDILCSYEDYGNQDSSNGNHSEPVMGNNSGKDFQRSRMS  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            R  M  + AY  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQLELYCYN+DK
Sbjct  60   RQPMFSSPAYSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNVDK  118

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            SIGEMRSDL  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+ QKELAKLQLAQ  S
Sbjct  119  SIGEMRSDLGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAETQKELAKLQLAQKGS  178

Query  605  GSANNSQ  625
             S+ +SQ
Sbjct  179  ASSTHSQ  185



>ref|XP_002517918.1| structural constituent of cell wall, putative [Ricinus communis]
 gb|EEF44436.1| structural constituent of cell wall, putative [Ricinus communis]
Length=536

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 154/187 (82%), Gaps = 2/187 (1%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSS   +NS SK FDF +DDILCSYEDYGN++ +  SHSDP + SNS K++HKSRM+
Sbjct  1    MASGSSDR-SNSGSKGFDFGTDDILCSYEDYGNKDSTNGSHSDPVIVSNSTKDYHKSRMS  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RSS+   S+Y  PEDS F+QDVI  VE+SMKK+ D LMRFLEG+SSRLSQLEL CYNLDK
Sbjct  60   RSSLFHASSYSQPEDS-FSQDVISVVERSMKKHTDGLMRFLEGVSSRLSQLELNCYNLDK  118

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            SIGEMRSDLV    + DSKLKSLEKHLQEVHRSVQILRDKQELAD QKELAKLQL Q E 
Sbjct  119  SIGEMRSDLVRHRADGDSKLKSLEKHLQEVHRSVQILRDKQELADTQKELAKLQLVQKEP  178

Query  605  GSANNSQ  625
             S+++SQ
Sbjct  179  SSSSHSQ  185



>gb|KEH17617.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=527

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 150/179 (84%), Gaps = 8/179 (4%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG  N      FDFASDDILCSYED+ N++ ++ +H+DP   SNS K+FHKSR+ 
Sbjct  1    MASGSSGRGNPG----FDFASDDILCSYEDFSNRDSNSNNHNDP---SNSTKDFHKSRVA  53

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            R+S+ P  AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLDK
Sbjct  54   RTSVFPAPAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDK  112

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            SIGE+RSDL  DHG+ DSKLKSLEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  113  SIGEIRSDLNRDHGDQDSKLKSLEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQKE  171



>gb|KFK35898.1| hypothetical protein AALP_AA4G050800 [Arabis alpina]
Length=484

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 157/188 (84%), Gaps = 3/188 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVA-SNSAKEFHKsrm  241
            MASGSSG   NS SK FDF SDDILCSY+DY NQ+ S   +SDPA+A +NS KEFHK+RM
Sbjct  1    MASGSSGR-VNSGSKGFDFGSDDILCSYDDYTNQDSSNGPNSDPAIAATNSNKEFHKTRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             RSS+ PTS+Y PPEDS  +Q++   VE+SMKKYADN+MRFLEG+SSRLSQLELYCYNLD
Sbjct  60   ARSSVFPTSSYSPPEDS-LSQELTATVERSMKKYADNMMRFLEGISSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            K+IGEMRSDL  +H + D KL+SL+KHLQEVHRSVQILRDKQELAD QKELA+LQ+ Q +
Sbjct  119  KTIGEMRSDLTREHDDADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELARLQIVQKD  178

Query  602  SGSANNSQ  625
            S S+ +SQ
Sbjct  179  SSSSTHSQ  186



>ref|XP_009341976.1| PREDICTED: ATP-dependent helicase brm-like isoform X1 [Pyrus 
x bretschneideri]
Length=522

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 153/188 (81%), Gaps = 3/188 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKE-FHKsrm  241
            MASGSS       S+ FDFASDDILCSYEDYGNQ+ S  +HS+P + +NS K+ FH+SRM
Sbjct  1    MASGSSAR-ATPGSQGFDFASDDILCSYEDYGNQDSSNGNHSEPVMGNNSGKQDFHRSRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
            +R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQLELYCYN+D
Sbjct  60   SRQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNVD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMRSDL  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+AQKELAKLQLAQ  
Sbjct  119  KSIGEMRSDLGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAEAQKELAKLQLAQKG  178

Query  602  SGSANNSQ  625
            S S+ +SQ
Sbjct  179  SASSTHSQ  186



>ref|XP_009336198.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Pyrus x bretschneideri]
Length=522

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 152/188 (81%), Gaps = 3/188 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKE-FHKsrm  241
            MASGSS    N  S+ FDFASDDILCSYEDYGNQ+ S  +HS+P + +NS K+  H+SR+
Sbjct  1    MASGSSTR-GNPGSQGFDFASDDILCSYEDYGNQDSSNGNHSEPVMGNNSGKQDIHRSRL  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             R  M  + A+  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQLELYCYN+D
Sbjct  60   ARQPMFSSPAFSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNVD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMRS+L  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+AQKELAKLQLAQ  
Sbjct  119  KSIGEMRSELGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAEAQKELAKLQLAQKG  178

Query  602  SGSANNSQ  625
            S S+ +SQ
Sbjct  179  SASSTHSQ  186



>ref|XP_008342910.1| PREDICTED: extensin-like isoform X1 [Malus domestica]
Length=522

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 151/188 (80%), Gaps = 3/188 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKE-FHKsrm  241
            MASGSS    N  S+ FDF SDDILCSYEDYGNQ+ S  +HS+P + +NS K+ F +SRM
Sbjct  1    MASGSSAR-GNPGSQGFDFGSDDILCSYEDYGNQDSSNGNHSEPVMGNNSGKQDFQRSRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
            +R  M  + AY  PE+S  +QDV   VEKSMKKYADNLMRFLEG+SSRLSQLELYCYN+D
Sbjct  60   SRQPMFSSPAYSQPEES-LHQDVTATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNVD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEMRSDL  DH E +SKLKSLEKHLQEVHRSVQI+RDKQELA+ QKELAKLQLAQ  
Sbjct  119  KSIGEMRSDLGRDHEEAESKLKSLEKHLQEVHRSVQIIRDKQELAETQKELAKLQLAQKG  178

Query  602  SGSANNSQ  625
            S S+ +SQ
Sbjct  179  SASSTHSQ  186



>ref|XP_011037330.1| PREDICTED: putative uncharacterized protein DDB_G0294196 isoform 
X2 [Populus euphratica]
Length=526

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYG--NQEKSARSHSDPAVASNSAKEFHKsr  238
            MASGSSG   NS SK FDF SDDILCSYEDYG  NQ+ S  SHSD  + SNS+K+FHKSR
Sbjct  1    MASGSSGR-TNSGSKGFDFGSDDILCSYEDYGTNNQDSSNLSHSDAVIGSNSSKDFHKSR  59

Query  239  mtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNL  418
            MTRSSM P ++Y  PEDS F QDV+  VEKSMKK  DN+MRFLEG+SSRLSQLEL CYNL
Sbjct  60   MTRSSMFPATSYSQPEDS-FTQDVVSIVEKSMKKQTDNIMRFLEGISSRLSQLELCCYNL  118

Query  419  DKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQX  598
            DKSIGEMRSD VHD+ E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKEL KLQLAQ 
Sbjct  119  DKSIGEMRSDFVHDNEEADLKLKSLEKHIQEVHRSVQILRDKQELAETQKELYKLQLAQK  178

Query  599  E  601
            E
Sbjct  179  E  179



>ref|XP_010035753.1| PREDICTED: RNA polymerase II degradation factor 1-like [Eucalyptus 
grandis]
 gb|KCW47211.1| hypothetical protein EUGRSUZ_K01026 [Eucalyptus grandis]
Length=535

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 152/187 (81%), Gaps = 4/187 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGN-QEKSARSHSDPAV-ASNSAKEFHKsr  238
            MASGSSG P  + SK FDFASDDILCSYEDY N Q+ S  SHSD A+  +N  K+FHKSR
Sbjct  1    MASGSSGRPG-TGSKGFDFASDDILCSYEDYSNSQDASNGSHSDSALNVANPGKDFHKSR  59

Query  239  mtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNL  418
            + R  +    AY  PEDS FNQD+I +VEKSMKK+ D+LMRFLEG+SSRLS+LELYCYNL
Sbjct  60   LVRPMVYSAPAYSQPEDS-FNQDLIASVEKSMKKHTDSLMRFLEGISSRLSELELYCYNL  118

Query  419  DKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQX  598
            DKSIGEMRS L  DHG+ D+KLKSL+KHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ 
Sbjct  119  DKSIGEMRSQLNRDHGDADTKLKSLDKHLQEVHRSVQILRDKQELAETQKELAKLQLAQK  178

Query  599  ESGSANN  619
            ES S ++
Sbjct  179  ESSSGHD  185



>ref|XP_006376495.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|ERP54292.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=532

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYG--NQEKSARSHSDPAVASNSAKEFHKsr  238
            MASGSSG   NS SK FDF SDDILCSYEDYG  NQ+ S  SHSD  + SNS+K+FHKSR
Sbjct  1    MASGSSGR-TNSGSKGFDFGSDDILCSYEDYGTNNQDSSNLSHSDTVIGSNSSKDFHKSR  59

Query  239  mtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNL  418
            MTRSSM P ++Y  PEDS FNQDV+  VEKSMKK  DN+MRFLEG+SSRLSQLEL CYNL
Sbjct  60   MTRSSMFPATSYSQPEDS-FNQDVVSIVEKSMKKQTDNIMRFLEGISSRLSQLELCCYNL  118

Query  419  DKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQX  598
            DKSIGEMRSD V D+ E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKEL KLQLAQ 
Sbjct  119  DKSIGEMRSDFVRDNEEADLKLKSLEKHIQEVHRSVQILRDKQELAETQKELYKLQLAQK  178

Query  599  E  601
            E
Sbjct  179  E  179



>gb|KJB31694.1| hypothetical protein B456_005G201600 [Gossypium raimondii]
Length=546

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 146/179 (82%), Gaps = 5/179 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG  N   SK FDF SDDILCSYEDYGNQE S  +H++P   ++S KEFHK R+ 
Sbjct  1    MASGSSGRGNTGNSKGFDFGSDDILCSYEDYGNQESSNGNHTEP---NSSNKEFHKGRVA  57

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RS   P+  Y  PEDS F+ DV   VEK+MK+Y DNLMRFLEG+SSRLSQLELYCYNLD+
Sbjct  58   RSMFPPS-GYSQPEDS-FSSDVAATVEKTMKRYTDNLMRFLEGISSRLSQLELYCYNLDR  115

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            SIG+MR+DLVH +G+ DSKLKS+EKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  116  SIGDMRADLVHGNGDADSKLKSIEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQKE  174



>ref|XP_006582794.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Glycine max]
Length=486

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 151/180 (84%), Gaps = 11/180 (6%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSAR-SHSDPAVASNSAKEFHKsrm  241
            MASGSSG   NSASK FDFASDDILCSY+DY N++ ++  +H+DP        +FHKSRM
Sbjct  1    MASGSSGR-GNSASKGFDFASDDILCSYDDYANRDSTSNGNHTDP--------DFHKSRM  51

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             R+SM PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  52   ARTSMFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLD  110

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEM+SD+  DH E DS+LKSLEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  111  KSIGEMKSDINRDHVEQDSRLKSLEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQKE  170



>emb|CAB79632.1| predicted proline-rich protein [Arabidopsis thaliana]
Length=508

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 151/192 (79%), Gaps = 15/192 (8%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVA-SNSAKEFHKsrm  241
            MASGSSG   NS SK FDF SDDILCSY+DY NQ+ S   HSDPA+A SNS KEFHK+RM
Sbjct  1    MASGSSGR-VNSGSKGFDFGSDDILCSYDDYTNQDSSNGPHSDPAIAASNSNKEFHKTRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             RSS+ PTS+Y PPEDS  +QD+ D VE++MK YADN+MRFLEGLSSRLSQLELYCYNLD
Sbjct  60   ARSSVFPTSSYSPPEDS-LSQDITDTVERTMKMYADNMMRFLEGLSSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQE------------VHRSVQILRDKQELADAQ  565
            K+IGEMRS+L H H + D KL+SL+KHLQE            VHRSVQILRDKQELAD Q
Sbjct  119  KTIGEMRSELTHAHEDADVKLRSLDKHLQEVCYCYAMFLILFVHRSVQILRDKQELADTQ  178

Query  566  KELAKLQLAQXE  601
            KELAKLQL Q E
Sbjct  179  KELAKLQLVQKE  190



>gb|KHN35253.1| hypothetical protein glysoja_042323 [Glycine soja]
Length=531

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 151/180 (84%), Gaps = 11/180 (6%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSAR-SHSDPAVASNSAKEFHKsrm  241
            MASGSSG   NSASK FDFASDDILCSY+DY N++ ++  +H+DP        +FHKSRM
Sbjct  1    MASGSSGR-GNSASKGFDFASDDILCSYDDYANRDSTSNGNHTDP--------DFHKSRM  51

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             R+SM PT+AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  52   ARTSMFPTTAYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLD  110

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEM+SD+  DH E DS+LKSLEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  111  KSIGEMKSDINRDHVEQDSRLKSLEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQKE  170



>ref|XP_006412973.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
 gb|ESQ54426.1| hypothetical protein EUTSA_v10024987mg [Eutrema salsugineum]
Length=499

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 151/178 (85%), Gaps = 3/178 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAV-ASNSAKEFHKsrm  241
            MASGSSG   NS SK FDF SDDILCSY+DY NQ+ +  ++SDPA+ A+N+ KEFHK+RM
Sbjct  1    MASGSSGR-VNSGSKGFDFGSDDILCSYDDYTNQDSANGTNSDPAIGATNANKEFHKTRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             RSS+ PTS+Y PPEDS  +QD+   VE++MKKYADN+MRFLEG+SSRLSQLELYCYNLD
Sbjct  60   ARSSVFPTSSYSPPEDS-LSQDLTATVERTMKKYADNMMRFLEGISSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            K+IGEMRSDL  +H E D KL+S++KHLQEVHRSVQILRDKQELAD QKELA+LQL +
Sbjct  119  KTIGEMRSDLTREHEEADVKLRSMDKHLQEVHRSVQILRDKQELADTQKELARLQLGK  176



>ref|XP_002272844.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Vitis 
vinifera]
Length=550

 Score =   241 bits (616),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 148/172 (86%), Gaps = 5/172 (3%)
 Frame = +2

Query  113  FDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssm-mptsAYIPPED  289
            FDFASDDILCSY+++ NQE S  +HSDPA    S K+FHK+RM+RSS+   ++ Y   E+
Sbjct  16   FDFASDDILCSYDEFSNQESSNGTHSDPA----SGKDFHKARMSRSSLFPASNVYGQQEE  71

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            SS NQ++I  VEK++KKYADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSDLV DHGE
Sbjct  72   SSLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDHGE  131

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNSQ  625
             DSKLKSL+KH+QEVHRSVQILRDKQELADAQKELAKLQL Q ES ++++SQ
Sbjct  132  ADSKLKSLDKHIQEVHRSVQILRDKQELADAQKELAKLQLVQKESSTSSHSQ  183



>ref|XP_011037329.1| PREDICTED: bromodomain-containing protein 4-like isoform X1 [Populus 
euphratica]
Length=527

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 149/182 (82%), Gaps = 5/182 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYG--NQEKSARSHSDPAVASNSAKE-FHKs  235
            MASGSSG   NS SK FDF SDDILCSYEDYG  NQ+ S  SHSD  + SNS+K+ FHKS
Sbjct  1    MASGSSGR-TNSGSKGFDFGSDDILCSYEDYGTNNQDSSNLSHSDAVIGSNSSKQDFHKS  59

Query  236  rmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYN  415
            RMTRSSM P ++Y  PEDS F QDV+  VEKSMKK  DN+MRFLEG+SSRLSQLEL CYN
Sbjct  60   RMTRSSMFPATSYSQPEDS-FTQDVVSIVEKSMKKQTDNIMRFLEGISSRLSQLELCCYN  118

Query  416  LDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            LDKSIGEMRSD VHD+ E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKEL KLQLAQ
Sbjct  119  LDKSIGEMRSDFVHDNEEADLKLKSLEKHIQEVHRSVQILRDKQELAETQKELYKLQLAQ  178

Query  596  XE  601
             E
Sbjct  179  KE  180



>ref|XP_010438481.1| PREDICTED: formin-like protein 5 [Camelina sativa]
Length=497

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 149/179 (83%), Gaps = 5/179 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG   NS SK FDF SDDILCS  DY NQ+ S   HSDP++A+ S  EFHK+RM 
Sbjct  1    MASGSSGR-VNSGSKGFDFGSDDILCS--DYTNQDSSNGPHSDPSIAA-SNMEFHKTRMA  56

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLELYCYNLDK
Sbjct  57   RSSIFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLELYCYNLDK  115

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            +IGEMRS+L H+H E D KL+SL+KHLQEVHRSVQILRDKQELAD QKELAKLQL Q E
Sbjct  116  TIGEMRSELTHEHEEADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELAKLQLVQKE  174



>ref|XP_002325597.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE99978.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=537

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 150/182 (82%), Gaps = 4/182 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYG--NQEKSARSHSDPAVASNSAKEFHKsr  238
            MASGSSG   NS SK FDF +DDILCSYEDYG  NQ+ S  SHSDP + SNS+K+FHKS+
Sbjct  1    MASGSSGR-ANSGSKGFDFGTDDILCSYEDYGTNNQDSSNGSHSDPVIGSNSSKDFHKSK  59

Query  239  mtrssmmptsAYIPPEDS-SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYN  415
            MTRSS+ P S+Y  PEDS  F+ DV+  VEK MKK+ DN+MRFLEG+SSRLSQLEL CYN
Sbjct  60   MTRSSVYPASSYSQPEDSFHFSPDVVSTVEKGMKKHTDNIMRFLEGISSRLSQLELSCYN  119

Query  416  LDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            LDK+IG+MRSD + D+ E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ
Sbjct  120  LDKAIGDMRSDSIRDNEEADLKLKSLEKHIQEVHRSVQILRDKQELAETQKELAKLQLAQ  179

Query  596  XE  601
             E
Sbjct  180  KE  181



>ref|XP_010448000.1| PREDICTED: vacuolar protein-sorting protein BRO1-like [Camelina 
sativa]
Length=495

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 149/179 (83%), Gaps = 5/179 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG   NS SK FDF SDDILCS  DY NQ+ S   HSDP++A+ S  EFHK+RM 
Sbjct  1    MASGSSGR-VNSGSKGFDFGSDDILCS--DYTNQDSSNGPHSDPSIAA-SNMEFHKTRMA  56

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLELYCYNLDK
Sbjct  57   RSSIFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLELYCYNLDK  115

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            +IGEMRS+L H+H E D KL+SL+KHLQEVHRSVQILRDKQELAD QKELAKLQL Q E
Sbjct  116  TIGEMRSELTHEHEEADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELAKLQLVQKE  174



>gb|KHG27956.1| S-adenosylmethionine synthase 1 [Gossypium arboreum]
Length=552

 Score =   240 bits (612),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 148/182 (81%), Gaps = 5/182 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAV---ASNSAKEFHKs  235
            MASG SG  N+S SK FDF SDDILCSYEDYGNQE S  SH++ A+   A++S+ +FHK 
Sbjct  1    MASGLSGRGNSSGSKGFDFGSDDILCSYEDYGNQESSNGSHAEAALGTTATSSSTDFHKG  60

Query  236  rmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYN  415
            R+ RS      AY  P+DS ++ DV   VEK+MKKYADNLMRFLEG+SSRLSQLELYCYN
Sbjct  61   RVARSIFPAN-AYSQPDDSLYS-DVTATVEKTMKKYADNLMRFLEGISSRLSQLELYCYN  118

Query  416  LDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            LDKSIGEMRSDL+ D+ + DSKLKS+EKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ
Sbjct  119  LDKSIGEMRSDLIRDNEDADSKLKSIEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQ  178

Query  596  XE  601
             E
Sbjct  179  KE  180



>ref|XP_010433239.1| PREDICTED: bromodomain-containing protein 4-like [Camelina sativa]
Length=494

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 149/179 (83%), Gaps = 5/179 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG   NS SK FDF SDDILCS  DY NQ+ S   HSDP++A+ S  EFHK+RM 
Sbjct  1    MASGSSGR-VNSGSKGFDFGSDDILCS--DYTNQDSSNGPHSDPSIAA-SNMEFHKTRMA  56

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLELYCYNLDK
Sbjct  57   RSSIFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLELYCYNLDK  115

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            +IGEMRS+L H+H + D KL+SL+KHLQEVHRSVQILRDKQELAD QKELAKLQL Q E
Sbjct  116  TIGEMRSELTHEHEDADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELAKLQLVQKE  174



>ref|XP_008455322.1| PREDICTED: transcription factor SPT20 homolog [Cucumis melo]
Length=514

 Score =   238 bits (608),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 145/187 (78%), Gaps = 4/187 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGS+G PN S+ K FDF SDDILCS+EDYG Q+ S  S SDP   +N  K+FHKSRM+
Sbjct  1    MASGSAGRPN-SSPKSFDFGSDDILCSFEDYGKQDPSNGSLSDPVSVTNPGKDFHKSRMS  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
                          D + +Q+VI  VE SMKK++DNL+RFLEG+SSRLSQLELYCYNLDK
Sbjct  60   TVFPAAGYGQA---DDTISQNVISTVENSMKKHSDNLLRFLEGISSRLSQLELYCYNLDK  116

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            S+GEMRS+L  DH E DSKLKSLEKH+QEVHRSVQI+RDKQELA+ QK+LAKLQ++Q E 
Sbjct  117  SVGEMRSELARDHEEADSKLKSLEKHVQEVHRSVQIIRDKQELAETQKDLAKLQVSQKEP  176

Query  605  GSANNSQ  625
             S+N+SQ
Sbjct  177  SSSNHSQ  183



>ref|XP_006283593.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
 gb|EOA16491.1| hypothetical protein CARUB_v10004649mg [Capsella rubella]
Length=497

 Score =   238 bits (606),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 152/182 (84%), Gaps = 6/182 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCS---YEDYGNQEKSARSHSDPAVASNSAKEFHKs  235
            MASGSSG   NS SK FDF SDDILCS    +DY NQ+ S  S+SDPA+A+ + KEFHK+
Sbjct  1    MASGSSGR-VNSGSKGFDFGSDDILCSDYTNQDYINQDSSNGSNSDPAIAATN-KEFHKT  58

Query  236  rmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYN  415
            RM RSS+ PTS+Y PPEDS  +QD+ D VE++MKKYADN+MRFLEG+SSRLSQLELYCYN
Sbjct  59   RMARSSVFPTSSYSPPEDS-LSQDLTDTVERTMKKYADNMMRFLEGISSRLSQLELYCYN  117

Query  416  LDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            LDK+IGEMRS+L H++ E D KL+S++KHLQEVHRSVQILRDKQELAD QKELAKLQL Q
Sbjct  118  LDKTIGEMRSELTHENEEADVKLRSMDKHLQEVHRSVQILRDKQELADTQKELAKLQLVQ  177

Query  596  XE  601
             E
Sbjct  178  KE  179



>gb|EPS62243.1| hypothetical protein M569_12549, partial [Genlisea aurea]
Length=512

 Score =   238 bits (607),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 156/197 (79%), Gaps = 12/197 (6%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MAS SS     S +K FDFASDDIL SYEDYGNQ+ +  +H+D +  ++ ++EFHKSRM+
Sbjct  1    MASRSSARGTGSGTKPFDFASDDILSSYEDYGNQDGNNGTHADSSSIAHDSQEFHKSRMS  60

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            RSS+ PT+ Y PPE+SSFNQ V+ AVE S+KKY DN++RFLEG+SSRLSQLELYCYNLDK
Sbjct  61   RSSVFPTATYNPPEESSFNQTVVSAVENSVKKYTDNILRFLEGISSRLSQLELYCYNLDK  120

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQE------------VHRSVQILRDKQELADAQK  568
            SIGEMRSDL+ DH E+DSKLKS+EKH+ E            VHRSVQILRDKQEL++AQ+
Sbjct  121  SIGEMRSDLIRDHSESDSKLKSIEKHMHEAINSLLPLLQMQVHRSVQILRDKQELSEAQR  180

Query  569  ELAKLQLAQXESGSANN  619
            ELAKLQLAQ ES S++ 
Sbjct  181  ELAKLQLAQIESSSSSG  197



>ref|XP_004136824.1| PREDICTED: uncharacterized protein LOC101206745 [Cucumis sativus]
 ref|XP_004155474.1| PREDICTED: uncharacterized protein LOC101231079 [Cucumis sativus]
 gb|KGN43616.1| hypothetical protein Csa_7G048000 [Cucumis sativus]
Length=515

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 143/187 (76%), Gaps = 4/187 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGS+G PN S+ K FDF SDDILCS+EDYG Q+ S  S SDP   +N  K+FHK RM+
Sbjct  1    MASGSAGRPN-SSPKSFDFGSDDILCSFEDYGKQDPSNGSLSDPVSVNNPGKDFHKGRMS  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
                          D + +Q+VI  VE SMKK++DNL+RFLEG+SSRLSQLELYCYNLDK
Sbjct  60   TVFPASGYGQA---DDTISQNVISTVENSMKKHSDNLLRFLEGISSRLSQLELYCYNLDK  116

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            S+GEMRS+L  DH E DSKLKSLEKH+QEVHRSVQI+RDKQELA+ QK+LAKLQ++Q E 
Sbjct  117  SVGEMRSELARDHEEADSKLKSLEKHVQEVHRSVQIIRDKQELAETQKDLAKLQVSQKEP  176

Query  605  GSANNSQ  625
             S N+SQ
Sbjct  177  SSTNHSQ  183



>ref|XP_007043595.1| Structural constituent of cell wall [Theobroma cacao]
 gb|EOX99426.1| Structural constituent of cell wall [Theobroma cacao]
Length=552

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 135/164 (82%), Gaps = 3/164 (2%)
 Frame = +2

Query  113  FDFASDDILCSYEDYGNQEKSARSHSDPAVASNS-AKEFHKsrmtrssmmptsAYIPPED  289
            FDF SDDILCSYEDYGNQE S  SH++P V +NS AK+FHK R  RS   P  AY  PED
Sbjct  17   FDFGSDDILCSYEDYGNQESSNGSHAEPVVGTNSSAKDFHKGRAARSIFPPN-AYSQPED  75

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S F+ DV   VEK+MKKYADNLMRFLEG+SSRLSQLELYCYNLDK+IGEMRSDLV DH +
Sbjct  76   S-FSTDVTATVEKTMKKYADNLMRFLEGISSRLSQLELYCYNLDKTIGEMRSDLVRDHVD  134

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             D KLKS+EKHLQEVHRSVQILRDKQELA+ QKELAKLQL Q E
Sbjct  135  ADLKLKSIEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKE  178



>ref|XP_011002849.1| PREDICTED: calcium-binding protein P-like [Populus euphratica]
Length=549

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 4/182 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYG--NQEKSARSHSDPAVASNSAKEFHKsr  238
            MASGSSG   N  SK FDF +DDILCSYEDYG  NQ+ S  SHSDP + SNS+K+FHKS+
Sbjct  1    MASGSSGR-ANPGSKGFDFGTDDILCSYEDYGTNNQDSSNGSHSDPVIGSNSSKDFHKSK  59

Query  239  mtrssmmptsAYIPPEDS-SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYN  415
            MTRSS+ P S+Y  PEDS  F+ DV+  VEK MKK+ D++MRFLEG+SSRLSQLEL CYN
Sbjct  60   MTRSSVYPASSYSQPEDSFHFSPDVVSTVEKGMKKHTDSIMRFLEGISSRLSQLELSCYN  119

Query  416  LDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            LDK+IG+MRSD + D+ E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ
Sbjct  120  LDKAIGDMRSDSIRDNEEADLKLKSLEKHIQEVHRSVQILRDKQELAETQKELAKLQLAQ  179

Query  596  XE  601
             E
Sbjct  180  KE  181



>ref|XP_006592435.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoform X2 [Glycine max]
Length=534

 Score =   236 bits (603),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 144/180 (80%), Gaps = 14/180 (8%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSAR-SHSDPAVASNSAKEFHKsrm  241
            MASGSSG   NSASK FDFASDDILCSY+DY N++ S+  +H+DP       ++FHKSR 
Sbjct  1    MASGSSGR-GNSASKGFDFASDDILCSYDDYANRDSSSNGNHTDP-------QDFHKSRR  52

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
               +     AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  53   MFPTT----AYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLD  107

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEM+ D+  DH E +S+LKSLEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  108  KSIGEMKCDINRDHVEQESRLKSLEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQKE  167



>gb|KHN31988.1| hypothetical protein glysoja_025822 [Glycine soja]
Length=505

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 144/180 (80%), Gaps = 14/180 (8%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSAR-SHSDPAVASNSAKEFHKsrm  241
            MASGSSG   NSASK FDFASDDILCSY+DY N++ S+  +H+DP       ++FHKSR 
Sbjct  1    MASGSSGR-GNSASKGFDFASDDILCSYDDYANRDSSSNGNHTDP-------QDFHKSRR  52

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
               +     AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  53   MFPTT----AYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLD  107

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEM+ D+  DH E +S+LKSLEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  108  KSIGEMKCDINRDHVEQESRLKSLEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQKE  167



>ref|XP_003539922.1| PREDICTED: putative uncharacterized protein DDB_G0271606-like 
isoformX1 [Glycine max]
Length=533

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 143/180 (79%), Gaps = 15/180 (8%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSAR-SHSDPAVASNSAKEFHKsrm  241
            MASGSSG   NSASK FDFASDDILCSY+DY N++ S+  +H+DP        +FHKSR 
Sbjct  1    MASGSSGR-GNSASKGFDFASDDILCSYDDYANRDSSSNGNHTDP--------DFHKSRR  51

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
               +     AY PPEDS  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLD
Sbjct  52   MFPTT----AYNPPEDS-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLD  106

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            KSIGEM+ D+  DH E +S+LKSLEKH+QEVHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  107  KSIGEMKCDINRDHVEQESRLKSLEKHVQEVHRSVQILRDKQELAETQKELAKLQLAQKE  166



>emb|CDX97433.1| BnaC08g12980D [Brassica napus]
Length=492

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAV-ASNSAKEFHKsrm  241
            MASG+SG   N  SK FDF SDDILCSY+D+ N + S  S+SDPA+ ASNS KEFHK+RM
Sbjct  1    MASGASGR-VNPGSKGFDFGSDDILCSYDDFTNHDSSDGSNSDPAIGASNSNKEFHKTRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             RSS+ PT +Y PPEDS   +++   VE+SMKKY+DN+MRFLEGLSSRLSQLELYCYNLD
Sbjct  60   ARSSVFPTGSYAPPEDSLREEELTATVERSMKKYSDNMMRFLEGLSSRLSQLELYCYNLD  119

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            K+IGEMRSDL   + E D KL+SL+KHLQEVHRSVQ+LRDKQELAD QKELA+LQL 
Sbjct  120  KTIGEMRSDLTRHNEEADVKLRSLDKHLQEVHRSVQVLRDKQELADTQKELARLQLV  176



>emb|CDY25250.1| BnaA02g22060D [Brassica napus]
Length=492

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAV-ASNSAKEFHKsrm  241
            MASG+SG   N  SK FDF SDDILCSY+D+ N + S  S+SDPA+ ASNS KEFHK+RM
Sbjct  1    MASGASGR-VNPGSKGFDFGSDDILCSYDDFTNHDSSDGSNSDPAIGASNSNKEFHKTRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             RSS+ PT +Y PPEDS   +++   VE+SMKKY+DN+MRFLEGLSSRLSQLELYCYNLD
Sbjct  60   ARSSVFPTGSYAPPEDSLREEELTATVERSMKKYSDNMMRFLEGLSSRLSQLELYCYNLD  119

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            K+IGEMRSDL   + E D KL+SL+KHLQEVHRSVQ+LRDKQELAD QKELA+LQL 
Sbjct  120  KTIGEMRSDLTRHNEEADVKLRSLDKHLQEVHRSVQVLRDKQELADTQKELARLQLV  176



>ref|XP_010689008.1| PREDICTED: RNA polymerase II degradation factor 1 [Beta vulgaris 
subsp. vulgaris]
Length=542

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +2

Query  113  FDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPPEDS  292
            FDFASDDILCSYED+ NQE +   HSDP++ +NS K+F KSR++RSS+ PT+      + 
Sbjct  16   FDFASDDILCSYEDFANQESANGGHSDPSLGANSGKDFQKSRISRSSVFPTTNAYSQLEE  75

Query  293  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  472
              +Q++I AVE++MKKYADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSDL  DH E 
Sbjct  76   PLSQELISAVERTMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLGRDHSEA  135

Query  473  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSA  613
            DSKLK LEKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ ES SA
Sbjct  136  DSKLKFLEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQKESSSA  182



>ref|XP_008455323.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Cucumis melo]
Length=542

 Score =   233 bits (594),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 143/179 (80%), Gaps = 5/179 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGS+G PN S SK FDF +DD+LCSYEDYGNQE S  SHSD +VA NS+K+FHKSRM+
Sbjct  1    MASGSTGRPN-SGSKGFDFGTDDVLCSYEDYGNQESSNGSHSDLSVA-NSSKDFHKSRMS  58

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
                    AY   EDS   QDVI  VE SMKKY+DN++RFLEG+SSRLSQLEL CYNLDK
Sbjct  59   TVYPAA--AYGQSEDS-IKQDVISTVENSMKKYSDNILRFLEGISSRLSQLELNCYNLDK  115

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            S+GEMRSD++ DH E D KLKSLEKHLQEVHRSVQI+RDKQELA+ QK+LAKL L Q E
Sbjct  116  SVGEMRSDVLRDHEEEDLKLKSLEKHLQEVHRSVQIIRDKQELAETQKDLAKLHLLQKE  174



>emb|CDX89188.1| BnaA01g17050D [Brassica napus]
Length=470

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 153/179 (85%), Gaps = 5/179 (3%)
 Frame = +2

Query  95   NSASKVFDFASDDILCSYEDYGNQEKSARS-HSDPAVASNSAKEFHKsrmtrssmmptsA  271
            NS SK FDF SDDILCSY+D+ NQE S+   +SDPA+A+N  KEFHK+RM RSS+ PTS+
Sbjct  7    NSGSKGFDFGSDDILCSYDDFANQEDSSNGPNSDPAIAAN--KEFHKTRMARSSVFPTSS  64

Query  272  YIPPEDSSFNQDVIDA-VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  448
            Y PP+DS  +QD+I+A VE++MKKY+DN+MRFLEG+SSRLSQLELYCYNLDK+IGEMRS+
Sbjct  65   YTPPDDS-LSQDIINATVERTMKKYSDNVMRFLEGISSRLSQLELYCYNLDKTIGEMRSE  123

Query  449  LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNSQ  625
            L  D+ E D+KL+S++KHLQEVHRSVQILRDKQEL D QKELA+LQL Q +S S+++ +
Sbjct  124  LTRDNEEADAKLRSMDKHLQEVHRSVQILRDKQELFDTQKELARLQLVQKDSSSSSHGE  182



>ref|XP_009144355.1| PREDICTED: protein transport protein SEC31-like [Brassica rapa]
Length=476

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 152/179 (85%), Gaps = 5/179 (3%)
 Frame = +2

Query  95   NSASKVFDFASDDILCSYEDYGNQEKSARS-HSDPAVASNSAKEFHKsrmtrssmmptsA  271
            NS SK FDF SDDILCSY+D+ NQE S+   +SDPA+A+N  KEFHK+RM RSS+ PTS+
Sbjct  7    NSGSKGFDFGSDDILCSYDDFANQEDSSNGPNSDPAIAAN--KEFHKTRMARSSVFPTSS  64

Query  272  YIPPEDSSFNQDVIDA-VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  448
            Y PP+DS  +QD+I+A VE++MKKY+DN+MRFLEG+SSRLSQLELYCYNLDK+IGEMRS+
Sbjct  65   YTPPDDS-LSQDIINATVERTMKKYSDNVMRFLEGISSRLSQLELYCYNLDKTIGEMRSE  123

Query  449  LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNSQ  625
            L  D+ E D KL+S++KHLQEVHRSVQILRDKQEL D QKELA+LQL Q +S S+++ +
Sbjct  124  LSRDNEEADVKLRSMDKHLQEVHRSVQILRDKQELFDTQKELARLQLVQKDSSSSSHGE  182



>gb|KDO51849.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=549

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 138/177 (78%), Gaps = 4/177 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG   NS SK FDF SDDILCSYEDY NQ+ S  SHSD    S S+K+F K R  
Sbjct  1    MASGSSGR-ANSGSKGFDFGSDDILCSYEDYPNQDASNGSHSDLVTGSGSSKDFQKGRRP  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            R SM    AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLDK
Sbjct  60   RPSMFH--AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDK  116

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            S+ EMRSDLV DHGE D+KLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQL Q
Sbjct  117  SMVEMRSDLVRDHGEADTKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQ  173



>ref|XP_004136823.1| PREDICTED: uncharacterized protein LOC101206501 [Cucumis sativus]
 ref|XP_004155475.1| PREDICTED: uncharacterized protein LOC101231301 [Cucumis sativus]
 gb|KGN43615.1| Structural constituent of cell wall [Cucumis sativus]
Length=545

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 141/179 (79%), Gaps = 5/179 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGS+G PN S SK FDF +DD+LCSYEDYGNQE S  SHSD +VA NS K+FHKSRM+
Sbjct  1    MASGSTGRPN-SGSKGFDFGTDDVLCSYEDYGNQESSNGSHSDLSVA-NSTKDFHKSRMS  58

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
                    AY   EDS   QDVI  VE SMKKY+DN++RFLEG+SSRLSQLEL CYNLDK
Sbjct  59   TVYPAA--AYGQSEDS-IKQDVISTVENSMKKYSDNILRFLEGISSRLSQLELNCYNLDK  115

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            S+GEMRSD++ D  E D KLKSLEKHLQEVHRSVQI+RDKQELA+ QK+LAKL L Q E
Sbjct  116  SVGEMRSDVLRDREEEDLKLKSLEKHLQEVHRSVQIIRDKQELAETQKDLAKLHLLQKE  174



>ref|XP_006447362.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60602.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=553

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASGSSG   NS SK FDF SDDILCSYEDY NQ+ S  SHSD    S S+K+F K R  
Sbjct  1    MASGSSGR-ANSGSKGFDFGSDDILCSYEDYPNQDASNGSHSDLVTGSGSSKDFQKGRRP  59

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            R SM    AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLDK
Sbjct  60   RPSMFH--AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLDK  116

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            S+ EMRSDLV DHGE D+KLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQL Q +
Sbjct  117  SMVEMRSDLVRDHGEADTKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKD  175



>gb|KJB77268.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77270.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77272.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=551

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 144/182 (79%), Gaps = 5/182 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAK---EFHKs  235
            MAS  SG  N+S SK FDFASDDILCSYEDYGNQE S  SH++ A+ + +     +FHK 
Sbjct  1    MASELSGRGNSSGSKGFDFASDDILCSYEDYGNQESSNGSHAEAALGTTTTSSSTDFHKG  60

Query  236  rmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYN  415
            R+ RS      AY  P+DS ++ DV   VEK+MKKYADNLMRFLEGLSSRLSQLELYCYN
Sbjct  61   RVARSIFPAN-AYSQPDDSLYS-DVTATVEKTMKKYADNLMRFLEGLSSRLSQLELYCYN  118

Query  416  LDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            LDKSIGEM+SDL+ D+ + DSKL S+EKHLQEVHRSVQILRDKQELA+ QKELAKLQLAQ
Sbjct  119  LDKSIGEMQSDLIRDNEDADSKLNSIEKHLQEVHRSVQILRDKQELAETQKELAKLQLAQ  178

Query  596  XE  601
             E
Sbjct  179  KE  180



>ref|XP_007132659.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
 gb|ESW04653.1| hypothetical protein PHAVU_011G113900g [Phaseolus vulgaris]
Length=541

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 138/164 (84%), Gaps = 10/164 (6%)
 Frame = +2

Query  113  FDFASDDILCSYEDYGNQEKSAR-SHSDPAVASNSAKEFHKsrmtrssmmptsAYIPPED  289
            FDF SDDILCSY+DY N++ S+  +H+DP        +FHK+RM+R+SM PT+AY PPED
Sbjct  16   FDFGSDDILCSYDDYANRDSSSNGNHADP--------DFHKARMSRTSMFPTTAYNPPED  67

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S  +QDVI  VEKSMKKYADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSDL  D+ E
Sbjct  68   S-LSQDVIATVEKSMKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLTRDNVE  126

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             DS+LKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQ AQ E
Sbjct  127  QDSRLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQHAQKE  170



>ref|XP_010540875.1| PREDICTED: extensin [Tarenaya hassleriana]
Length=492

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 147/180 (82%), Gaps = 3/180 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAV-ASNSAKEFHKsrm  241
            MASGSSG   NS SK FDF SDDILCSYEDYGNQ+ S   HSDPA+ A+N  KEF+K+RM
Sbjct  1    MASGSSGR-VNSGSKGFDFGSDDILCSYEDYGNQDSSNGPHSDPAIGATNPNKEFNKTRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             RSS+ P+S+Y P  + S +QD+   VE++MKKYADN+MRFLEG+SSRLSQLELYCYNLD
Sbjct  60   ARSSVFPSSSYSP-PEESLSQDITATVERTMKKYADNMMRFLEGISSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            K+IGEMRSDL  ++ E D KL+SL+KHLQEVHRSVQILRDKQELA+ QKELAKLQ    E
Sbjct  119  KTIGEMRSDLTRENQEADVKLRSLDKHLQEVHRSVQILRDKQELAETQKELAKLQHGHKE  178



>emb|CDY18985.1| BnaC01g20830D [Brassica napus]
Length=479

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 145/177 (82%), Gaps = 3/177 (2%)
 Frame = +2

Query  95   NSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAY  274
            NS SK FDF SDDILCSY+D+ NQ+ S   +SD A+A+N  KEFHK+RM RSS+ PTS+Y
Sbjct  7    NSGSKGFDFGSDDILCSYDDFANQDSSNGPNSDHAIAAN--KEFHKTRMARSSVFPTSSY  64

Query  275  IPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLV  454
             PPEDS  +QD+   VE +MKKY+DN+MRFLEG+SSRLSQLELYCYNLDK+IGEMRSDL 
Sbjct  65   SPPEDS-LSQDINATVESTMKKYSDNMMRFLEGISSRLSQLELYCYNLDKTIGEMRSDLT  123

Query  455  HDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNSQ  625
             D+ E D KL+S++KHLQEVHRSVQILRDKQEL D QKELA+LQL   +S S+++ +
Sbjct  124  RDNDEADVKLRSMDKHLQEVHRSVQILRDKQELFDTQKELARLQLVHKDSSSSSHGE  180



>gb|KDO51850.1| hypothetical protein CISIN_1g008878mg [Citrus sinensis]
Length=550

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKE-FHKsrm  241
            MASGSSG   NS SK FDF SDDILCSYEDY NQ+ S  SHSD    S S+K+ F K R 
Sbjct  1    MASGSSGR-ANSGSKGFDFGSDDILCSYEDYPNQDASNGSHSDLVTGSGSSKQDFQKGRR  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             R SM    AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLD
Sbjct  60   PRPSMFH--AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLD  116

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            KS+ EMRSDLV DHGE D+KLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQL Q
Sbjct  117  KSMVEMRSDLVRDHGEADTKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQ  174



>ref|XP_006447363.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
 gb|ESR60603.1| hypothetical protein CICLE_v10014791mg [Citrus clementina]
Length=554

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKE-FHKsrm  241
            MASGSSG   NS SK FDF SDDILCSYEDY NQ+ S  SHSD    S S+K+ F K R 
Sbjct  1    MASGSSGR-ANSGSKGFDFGSDDILCSYEDYPNQDASNGSHSDLVTGSGSSKQDFQKGRR  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             R SM    AY  P+D   N+DV+  VE +MKK+ D ++RFLEG+SSRLSQLELYCYNLD
Sbjct  60   PRPSMFH--AYSQPDDC-LNEDVVSTVEITMKKHTDGVVRFLEGISSRLSQLELYCYNLD  116

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            KS+ EMRSDLV DHGE D+KLKSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQL Q
Sbjct  117  KSMVEMRSDLVRDHGEADTKLKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQ  174



>emb|CDY14248.1| BnaA08g13790D [Brassica napus]
Length=491

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAV-ASNSAKEFHKsrm  241
            MASG+SG   N  SK FDF SDDILCSY+D+ N + S  S+SD  + ASNS KEFHK+RM
Sbjct  1    MASGASGR-VNPGSKGFDFGSDDILCSYDDFTNHDSSNGSNSDQLIGASNSNKEFHKTRM  59

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             +SS+ PT +Y PPEDS   +++   VE+SMKKY+DN+MRFLEGLSSRLSQLELYCYNLD
Sbjct  60   AKSSVFPTGSYGPPEDS-LREELTATVERSMKKYSDNMMRFLEGLSSRLSQLELYCYNLD  118

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            K+IGEMRSDL  D+ E   KL+SL+KHLQEVHRSVQ+LRDKQELAD QKELA+LQL 
Sbjct  119  KTIGEMRSDLSRDNEEAHVKLRSLDKHLQEVHRSVQVLRDKQELADTQKELARLQLV  175



>ref|XP_010242911.1| PREDICTED: RNA polymerase II degradation factor 1 [Nelumbo nucifera]
Length=560

 Score =   219 bits (559),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 132/166 (80%), Gaps = 3/166 (2%)
 Frame = +2

Query  107  KVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPPE  286
            K FDF SDDILCSY+D+GNQ+ S  S +DP +  N  K+F + RM RS+++        +
Sbjct  14   KAFDFGSDDILCSYDDFGNQDASGGSRADPPMGGNPGKDFREGRMGRSTLLHVYNQ---Q  70

Query  287  DSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHG  466
            + SFNQ+VI  VE++MKKYADNL+RFLEG+S RL QLELYCYNL+KS+GEMRSDL  D+ 
Sbjct  71   EESFNQEVIATVERTMKKYADNLLRFLEGISGRLQQLELYCYNLEKSVGEMRSDLERDNN  130

Query  467  ETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            E +SKLKSLEKH+QEVHRSVQILRDKQELA+ QKELAKLQLA  ES
Sbjct  131  EANSKLKSLEKHVQEVHRSVQILRDKQELAETQKELAKLQLAHKES  176



>gb|KJB77271.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
 gb|KJB77273.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=566

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 144/197 (73%), Gaps = 20/197 (10%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAK---EFHKs  235
            MAS  SG  N+S SK FDFASDDILCSYEDYGNQE S  SH++ A+ + +     +FHK 
Sbjct  1    MASELSGRGNSSGSKGFDFASDDILCSYEDYGNQESSNGSHAEAALGTTTTSSSTDFHKG  60

Query  236  rmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYN  415
            R+ RS      AY  P+DS ++ DV   VEK+MKKYADNLMRFLEGLSSRLSQLELYCYN
Sbjct  61   RVARSIFPAN-AYSQPDDSLYS-DVTATVEKTMKKYADNLMRFLEGLSSRLSQLELYCYN  118

Query  416  LDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE---------------VHRSVQILRDKQE  550
            LDKSIGEM+SDL+ D+ + DSKL S+EKHLQE               VHRSVQILRDKQE
Sbjct  119  LDKSIGEMQSDLIRDNEDADSKLNSIEKHLQEQHAREVHQIWIRKDLVHRSVQILRDKQE  178

Query  551  LADAQKELAKLQLAQXE  601
            LA+ QKELAKLQLAQ E
Sbjct  179  LAETQKELAKLQLAQKE  195



>ref|XP_009109102.1| PREDICTED: formin-like protein 3 [Brassica rapa]
Length=500

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 137/176 (78%), Gaps = 10/176 (6%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASG+SG   N  SK FDF SDDILCSY+D+ N + S          SNS KEFHK+RM 
Sbjct  1    MASGASGR-VNPGSKGFDFGSDDILCSYDDFTNHDSSN--------GSNSNKEFHKTRMA  51

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            +SS+ PT +Y PPED    +++   VE+SMKKY+DN+MRFLEGLSSRLSQLELYCYNLDK
Sbjct  52   KSSVFPTGSYGPPEDC-LREELTATVERSMKKYSDNMMRFLEGLSSRLSQLELYCYNLDK  110

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            +IGEMRSDL  D+ E D KL+SL+KHLQEVHRSVQ+LRDKQELAD QKELA+LQL 
Sbjct  111  TIGEMRSDLTRDNEEADVKLRSLDKHLQEVHRSVQVLRDKQELADTQKELARLQLV  166



>emb|CDY67879.1| BnaC07g50480D [Brassica napus]
Length=478

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 113/165 (68%), Positives = 137/165 (83%), Gaps = 3/165 (2%)
 Frame = +2

Query  113  FDFASDDILCSYEDY-GNQEKSARSHSDPAVA-SNSAKEFHKsrmtrssmmptsAYIPPE  286
            FDF SDDIL +Y+D+  NQ+ S  S+SDP++A +N  KEFHK+RM RSS+ PTS+Y PPE
Sbjct  10   FDFGSDDILRTYDDFTNNQDSSNGSNSDPSIAATNFNKEFHKTRMARSSVFPTSSYSPPE  69

Query  287  DSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHG  466
            DS  +QDV   VE++MKKY DN+MRFLEG+SSRLSQLELYCYNLDK+IGEMRSDL  D+ 
Sbjct  70   DS-LSQDVTATVERTMKKYTDNVMRFLEGISSRLSQLELYCYNLDKTIGEMRSDLTRDNE  128

Query  467  ETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            E D KL+S+EKHLQEV RSVQILRDKQELAD QK+LA+LQ+ Q +
Sbjct  129  EADVKLRSVEKHLQEVRRSVQILRDKQELADTQKDLARLQVVQKD  173



>ref|XP_009137778.1| PREDICTED: basic salivary proline-rich protein 1-like [Brassica 
rapa]
 emb|CDY29896.1| BnaA03g49170D [Brassica napus]
Length=487

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 137/166 (83%), Gaps = 4/166 (2%)
 Frame = +2

Query  113  FDFASDDILCSYEDY-GNQEKSARSHSDPAVAS--NSAKEFHKsrmtrssmmptsAYIPP  283
            FDF SDDIL +Y+D+  NQ+ S  S+SDP++A+  N  KEFHK+RM RSS+ PTS+Y PP
Sbjct  10   FDFGSDDILRTYDDFTNNQDSSNGSNSDPSIAATNNFNKEFHKTRMARSSVFPTSSYSPP  69

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            EDS  +QDV   VE++MKKY DN+MRFLEG+SSRLSQLELYCYNLDK+IGEMRSDL  D+
Sbjct  70   EDS-LSQDVTATVERTMKKYTDNVMRFLEGISSRLSQLELYCYNLDKTIGEMRSDLTRDN  128

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             E D KL+S+EKHLQEV RSVQILRDKQELAD QK+LA+LQ+ Q +
Sbjct  129  EEADVKLRSMEKHLQEVRRSVQILRDKQELADTQKDLARLQVVQKD  174



>gb|ACU16150.1| unknown [Glycine max]
Length=193

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 126/170 (74%), Gaps = 8/170 (5%)
 Frame = +2

Query  95   NSASKVFDFASDDILCSYE-DYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsA  271
            N  S  FD  S  ILCSYE D  N + S  +H DPA  S      H SRM R+S++P +A
Sbjct  10   NGGSNGFDLGSGGILCSYEEDNTNHDSSDGTHIDPAKGS------HASRMARTSVVPATA  63

Query  272  YIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  451
            Y   EDS  +QDVI  VEKSMK +ADNLMRFLEGLS+RLSQLELYCYNLDKSIG M+SDL
Sbjct  64   YSSSEDS-LSQDVIAIVEKSMKTHADNLMRFLEGLSTRLSQLELYCYNLDKSIGAMQSDL  122

Query  452  VHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
              DH ETDSKLKSL+KHLQEVHRSV ILRDKQELA+ +KELAKL+  + E
Sbjct  123  TCDHEETDSKLKSLDKHLQEVHRSVLILRDKQELAETRKELAKLKHVRKE  172



>ref|XP_010919593.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X1 [Elaeis guineensis]
Length=515

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 122/169 (72%), Gaps = 10/169 (6%)
 Frame = +2

Query  110  VFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPPED  289
            +FDF SDD+LCSY+DY  Q+ S    SDP     S K+FH+SRM R  +         ED
Sbjct  16   LFDFGSDDVLCSYDDYTTQDNSNGKRSDP-----SGKDFHESRMGRPLVNIYEQ----ED  66

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
             S  + VI AVEK MKKYADNL+R LEG+S RLSQLELYC+ +++SIGE RSD++ D  E
Sbjct  67   YS-KEKVIPAVEKCMKKYADNLLRSLEGISGRLSQLELYCFKIERSIGEFRSDIIRDQSE  125

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSAN  616
            T+ K K+LEKHLQEVHRSVQILRDKQELA+ QKELAKLQL Q ES   N
Sbjct  126  TELKFKTLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKESPQKN  174



>ref|XP_003540363.1| PREDICTED: integrator complex subunit 3 homolog isoform 1 [Glycine 
max]
 gb|KHN27890.1| hypothetical protein glysoja_007622 [Glycine soja]
Length=532

 Score =   192 bits (487),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 127/170 (75%), Gaps = 8/170 (5%)
 Frame = +2

Query  95   NSASKVFDFASDDILCSYE-DYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsA  271
            N  S  FD  S DILCSYE D  N + S  +H DPA  S      H SRM R+S++P +A
Sbjct  10   NGGSNGFDLGSGDILCSYEEDNTNHDSSDGTHIDPAKGS------HASRMARTSVVPATA  63

Query  272  YIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  451
            Y   EDS  +QDVI  VEKSMK +ADNLMRFLEGLS+RLSQLELYCYNLDKSIG M+SDL
Sbjct  64   YSSSEDS-LSQDVIAIVEKSMKTHADNLMRFLEGLSTRLSQLELYCYNLDKSIGAMQSDL  122

Query  452  VHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
              DH ETDSKLKSL+KHLQEVHRSV ILRDKQELA+ +KELAKL+  + E
Sbjct  123  TCDHEETDSKLKSLDKHLQEVHRSVLILRDKQELAETRKELAKLKHVRKE  172



>emb|CBI21851.3| unnamed protein product [Vitis vinifera]
Length=151

 Score =   181 bits (458),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 5/135 (4%)
 Frame = +2

Query  113  FDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmm-ptsAYIPPED  289
            FDFASDDILCSY+++ NQE S  +HSDPA    S K+FHK+RM+RSS+   ++ Y   E+
Sbjct  16   FDFASDDILCSYDEFSNQESSNGTHSDPA----SGKDFHKARMSRSSLFPASNVYGQQEE  71

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            SS NQ++I  VEK++KKYADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSDLV DHGE
Sbjct  72   SSLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDHGE  131

Query  470  TDSKLKSLEKHLQEV  514
             DSKLKSL+KH+QEV
Sbjct  132  ADSKLKSLDKHIQEV  146



>gb|KHN36637.1| hypothetical protein glysoja_001368 [Glycine soja]
Length=537

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 132/181 (73%), Gaps = 10/181 (6%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSY--EDYGNQEKSARSHSDPAVASNSAKEFHKsr  238
            MAS  SG  +N  S  FD  S DIL SY  EDY N + S  +H DP       K+ H SR
Sbjct  1    MASLPSGR-SNGGSNGFDLGSGDILYSYDEEDYTNHDSSNGTHIDPT------KDSHASR  53

Query  239  mtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNL  418
            M R+S++P +AY P EDS  +QDVI  VEKSMK +ADNLM+FLEGL +RLSQLELYCYNL
Sbjct  54   MGRTSIVPATAYSPSEDS-LSQDVIATVEKSMKTHADNLMQFLEGLGTRLSQLELYCYNL  112

Query  419  DKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQX  598
            DKSIG MRSDL  DH ETDSKL SL+KHLQEVHRSV IL+D+QELA+ +KELA L+ AQ 
Sbjct  113  DKSIGAMRSDLTCDHEETDSKLNSLDKHLQEVHRSVLILKDRQELAETRKELAMLKHAQK  172

Query  599  E  601
            E
Sbjct  173  E  173



>ref|XP_003543336.1| PREDICTED: RNA polymerase II degradation factor 1-like [Glycine 
max]
Length=537

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 132/181 (73%), Gaps = 10/181 (6%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSY--EDYGNQEKSARSHSDPAVASNSAKEFHKsr  238
            MAS  SG  +N  S  FD  S DIL SY  EDY N + S  +H DP       K+ H SR
Sbjct  1    MASLPSGR-SNGGSNGFDLGSGDILYSYDEEDYTNHDSSNGTHIDPT------KDSHASR  53

Query  239  mtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNL  418
            M R+S++P +AY P EDS  +QDVI  VEKSMK +ADNLM+FLEGL +RLSQLELYCYNL
Sbjct  54   MGRTSIVPATAYSPSEDS-LSQDVIATVEKSMKTHADNLMQFLEGLGTRLSQLELYCYNL  112

Query  419  DKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQX  598
            DKSIG MRSDL  DH ETDSKL SL+KHLQEVHRSV IL+D+QELA+ +KELA L+ AQ 
Sbjct  113  DKSIGAMRSDLTCDHEETDSKLNSLDKHLQEVHRSVLILKDRQELAETRKELAMLKHAQK  172

Query  599  E  601
            E
Sbjct  173  E  173



>ref|XP_008810225.1| PREDICTED: ataxin-2 homolog isoform X1 [Phoenix dactylifera]
Length=516

 Score =   189 bits (481),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 121/168 (72%), Gaps = 10/168 (6%)
 Frame = +2

Query  113  FDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPPEDS  292
            +DF SDD+LCSY+DY  Q+ S    SDP     S K+FH+SRM R  +         ED 
Sbjct  17   YDFGSDDVLCSYDDYAAQDNSNGKRSDP-----SGKDFHESRMGRPLVNIYEQ----EDY  67

Query  293  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  472
            S  + VI AVEK MKKYADNL+R+LEG+S RLSQLELYCY +++SIGE RSD++ D  E 
Sbjct  68   S-KEKVICAVEKCMKKYADNLLRYLEGISGRLSQLELYCYKIERSIGEFRSDIIRDQSEG  126

Query  473  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSAN  616
            + K KS+EKHLQEVHRSVQILRDKQEL +AQKELAKLQL Q ES   N
Sbjct  127  ELKFKSIEKHLQEVHRSVQILRDKQELVEAQKELAKLQLVQKESTQKN  174



>ref|XP_009395702.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Musa acuminata subsp. malaccensis]
Length=581

 Score =   190 bits (483),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 130/185 (70%), Gaps = 11/185 (6%)
 Frame = +2

Query  65   MASG-SSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrm  241
            MASG S+G    S+S+ FDF SDD+LCSY+DY  Q+ S    SDP       ++ H+SR+
Sbjct  1    MASGGSAGRAGASSSRSFDFGSDDVLCSYDDYAAQDTSIGKRSDPP-----GRDLHESRI  55

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             R  +         ED S  +D+I AVEK MKKYADNL+R L+G+S RLSQLE++CY L+
Sbjct  56   GRPLVNIYEQ----EDYS-REDIISAVEKCMKKYADNLLRSLDGISGRLSQLEIFCYKLE  110

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            +S+GE+R+D + D  E D K KSLEKHLQEVHRSVQILRDKQELA+ QKELAKLQL Q E
Sbjct  111  RSLGELRADFLQDQSEKDLKFKSLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKE  170

Query  602  SGSAN  616
            S   N
Sbjct  171  SVEKN  175



>emb|CAN71577.1| hypothetical protein VITISV_043279 [Vitis vinifera]
Length=292

 Score =   182 bits (462),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 5/135 (4%)
 Frame = +2

Query  113  FDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmm-ptsAYIPPED  289
            FDFASDDILCSY+++ NQE S  +HSDPA    S K+FHK+RM+RSS+   ++ Y   E+
Sbjct  16   FDFASDDILCSYDEFSNQESSNGTHSDPA----SGKDFHKARMSRSSLFPASNVYGQQEE  71

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            SS NQ++I  VEK++KKYADNLMRFLEG+SSRLSQLELYCYNLDKSIGEMRSDLV DHGE
Sbjct  72   SSLNQEMISTVEKTVKKYADNLMRFLEGISSRLSQLELYCYNLDKSIGEMRSDLVRDHGE  131

Query  470  TDSKLKSLEKHLQEV  514
             DSKLKSL+KH+QEV
Sbjct  132  ADSKLKSLDKHIQEV  146



>gb|KEH39131.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=500

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 122/157 (78%), Gaps = 8/157 (5%)
 Frame = +2

Query  128  DDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPPEDSSFNQD  307
            DDI CSY+DY N++ S  +H D      S K+FH SRM ++S  P +AY  PE  S +Q+
Sbjct  18   DDIFCSYDDYTNEDSSCGTHID------SNKDFHISRMVKTSTFPATAYNSPE-VSLSQE  70

Query  308  VI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKL  484
            VI   VEKSMK   D+LMRFLEG+SSRLSQLELYCYN+DKSIGE++S+L  DH E DSKL
Sbjct  71   VIATTVEKSMKTCTDDLMRFLEGISSRLSQLELYCYNIDKSIGELKSELTSDHEEADSKL  130

Query  485  KSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            KSL+KHLQEVHRSVQILRDKQEL + QKELAKLQLA+
Sbjct  131  KSLDKHLQEVHRSVQILRDKQELVETQKELAKLQLAR  167



>ref|XP_007149849.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
 gb|ESW21843.1| hypothetical protein PHAVU_005G103700g [Phaseolus vulgaris]
Length=513

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 129/179 (72%), Gaps = 6/179 (3%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MAS  S L  N  SK FDF S DILCS+ED    + S+       +  + AK+FH SRMT
Sbjct  1    MASLPSCL-ANGVSKGFDFTSGDILCSHEDDNTNDCSSN-----GIYIDPAKDFHTSRMT  54

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
            R+S++P +A     + S  QDVI  VEKSMK + DNLM+FLEG+SSRLS+LELYCYNLDK
Sbjct  55   RTSIVPAAAAYGSSEDSLGQDVIATVEKSMKTHTDNLMQFLEGISSRLSKLELYCYNLDK  114

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            SIG MRSDL  DH E DSKL SL+KHLQEV RSVQILRDKQ+LA  QKELAKLQL + E
Sbjct  115  SIGAMRSDLNSDHEEADSKLHSLDKHLQEVRRSVQILRDKQDLAKTQKELAKLQLIRKE  173



>ref|XP_008798248.1| PREDICTED: putative cyclin-dependent serine/threonine-protein 
kinase DDB_G0272797/DDB_G0274007 [Phoenix dactylifera]
Length=514

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 124/184 (67%), Gaps = 12/184 (7%)
 Frame = +2

Query  65   MASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmt  244
            MASG S       S+ FDF SDD+LCSY+DY  Q+ S    SDP       K+FH+    
Sbjct  1    MASGGSSGRAGLGSQSFDFGSDDVLCSYDDYAAQDNSNGKRSDPP-----RKDFHEMGRP  55

Query  245  rssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDK  424
              ++         ED S  +++I AVEK MKKYADN++RFLEG+S RLSQL+L+CY +++
Sbjct  56   LVNIYEQ------EDYS-KEEMIAAVEKCMKKYADNVLRFLEGISGRLSQLDLHCYKIER  108

Query  425  SIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            SIGE RSD++ D  E + K KSLEKHLQEV RSVQI+RDKQELA+AQKELAKLQL   ES
Sbjct  109  SIGEFRSDVIRDQNEAEMKFKSLEKHLQEVQRSVQIMRDKQELAEAQKELAKLQLGHKES  168

Query  605  GSAN  616
               N
Sbjct  169  TQKN  172



>ref|XP_008655245.1| PREDICTED: uncharacterized protein LOC100383096 isoform X1 [Zea 
mays]
 gb|AFW85062.1| putative DUF1421 domain family protein [Zea mays]
Length=584

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 127/176 (72%), Gaps = 16/176 (9%)
 Frame = +2

Query  83   GLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmp  262
            G P    S+ FDF +DD+LCSY+D+    +  R   DPA   +SA +FH SR+ R     
Sbjct  5    GAPAGGGSRSFDFGADDVLCSYDDFAASSEPKRP--DPA---DSAPDFHDSRLGR-----  54

Query  263  tsAYIPP--EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGE  436
               ++ P  ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE
Sbjct  55   --PFVKPYEQESYGKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGE  112

Query  437  MRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            +RSD++ D  ETD +LKSLEKHL EVHRS+QILRDKQELA+AQKELAK QL Q  S
Sbjct  113  LRSDVLRD--ETDHRLKSLEKHLNEVHRSIQILRDKQELAEAQKELAKFQLTQDTS  166



>ref|NP_974630.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE85467.1| uncharacterized protein AT4G28300 [Arabidopsis thaliana]
Length=438

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 97/111 (87%), Gaps = 1/111 (1%)
 Frame = +2

Query  269  AYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSD  448
            +Y PPEDS  +QD+ D VE++MK YADN+MRFLEGLSSRLSQLELYCYNLDK+IGEMRS+
Sbjct  11   SYSPPEDS-LSQDITDTVERTMKMYADNMMRFLEGLSSRLSQLELYCYNLDKTIGEMRSE  69

Query  449  LVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            L H H + D KL+SL+KHLQEVHRSVQILRDKQELAD QKELAKLQL Q E
Sbjct  70   LTHAHEDADVKLRSLDKHLQEVHRSVQILRDKQELADTQKELAKLQLVQKE  120



>ref|XP_010924425.1| PREDICTED: hepatocyte growth factor-regulated tyrosine kinase 
substrate-like isoform X1 [Elaeis guineensis]
Length=517

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 126/183 (69%), Gaps = 14/183 (8%)
 Frame = +2

Query  68   ASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtr  247
            +SG +GL     S+ FDF +DD+L SY+DY  Q+ S    SDP       K+FH+SR  R
Sbjct  6    SSGRAGL----GSRSFDFGTDDVLRSYDDYAAQDNSNGKRSDPP-----RKDFHESRRGR  56

Query  248  ssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKS  427
              +         ED S  +++I AVEK MKKYADNL++FLEG+S RLSQLELYCY +++S
Sbjct  57   PLVNIYEQ----EDYS-KEEMISAVEKCMKKYADNLLQFLEGISGRLSQLELYCYKIERS  111

Query  428  IGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESG  607
            +GE RSD++ D  E + K KSLEKHLQEV RSVQILRDKQELA+AQKEL KLQL Q ES 
Sbjct  112  LGEFRSDVIRDQNEAEMKFKSLEKHLQEVQRSVQILRDKQELAEAQKELTKLQLGQKEST  171

Query  608  SAN  616
              N
Sbjct  172  QKN  174



>ref|XP_006644725.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X2 [Oryza brachyantha]
Length=586

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 124/172 (72%), Gaps = 16/172 (9%)
 Frame = +2

Query  77   SSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssm  256
             SG+P+   S+ FDF +DD+LCSY+D+    +  R   DPA      K+FH SR+ R   
Sbjct  3    GSGVPSGRGSRSFDFGADDVLCSYDDFAAPSEPKRP--DPA-----DKDFHDSRLGRPLG  55

Query  257  mptsAYIPPEDSSFN-QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIG  433
                AY   E  S+  +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++S+G
Sbjct  56   K---AY---EQESYGKEDVLFAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSMG  109

Query  434  EMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQL  589
            E+RSD++ D  ETD +LKSLEKHL EVHRS+QILRDKQELA+ QKELAK QL
Sbjct  110  ELRSDVLRD--ETDQRLKSLEKHLHEVHRSIQILRDKQELAETQKELAKFQL  159



>ref|NP_001044280.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAD87289.1| putative calcium-binding protein [Oryza sativa Japonica Group]
 dbj|BAF06194.1| Os01g0754500 [Oryza sativa Japonica Group]
 dbj|BAG93651.1| unnamed protein product [Oryza sativa Japonica Group]
Length=594

 Score =   179 bits (454),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 123/172 (72%), Gaps = 16/172 (9%)
 Frame = +2

Query  77   SSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssm  256
             SG+P    S+ FDF +DD+LCSY+D+    +  R   DPA      K+FH SR+ R   
Sbjct  3    GSGVPAGRGSRSFDFGADDVLCSYDDFAAPSEPKRP--DPA-----DKDFHDSRLGRPFG  55

Query  257  mptsAYIPPEDSSFN-QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIG  433
                AY   E  S+  +DV+ AVEK MKKYADNL+R LEG+++RLSQLE+YCY L++S+G
Sbjct  56   K---AY---EQESYGKEDVLFAVEKCMKKYADNLLRSLEGITNRLSQLEIYCYKLERSMG  109

Query  434  EMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQL  589
            E+RSD++ D  ETD +LKSLEKHL EVHRS+QILRDKQELA+ QKELAK QL
Sbjct  110  ELRSDVLRD--ETDQRLKSLEKHLHEVHRSIQILRDKQELAETQKELAKFQL  159



>ref|XP_006644724.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Oryza brachyantha]
Length=587

 Score =   179 bits (453),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 124/172 (72%), Gaps = 15/172 (9%)
 Frame = +2

Query  77   SSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssm  256
             SG+P+   S+ FDF +DD+LCSY+D+    +  R   DPA      ++FH SR+ R   
Sbjct  3    GSGVPSGRGSRSFDFGADDVLCSYDDFAAPSEPKRP--DPA----DKQDFHDSRLGRPLG  56

Query  257  mptsAYIPPEDSSFN-QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIG  433
                AY   E  S+  +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++S+G
Sbjct  57   K---AY---EQESYGKEDVLFAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSMG  110

Query  434  EMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQL  589
            E+RSD++ D  ETD +LKSLEKHL EVHRS+QILRDKQELA+ QKELAK QL
Sbjct  111  ELRSDVLRD--ETDQRLKSLEKHLHEVHRSIQILRDKQELAETQKELAKFQL  160



>ref|XP_002458505.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
 gb|EES03625.1| hypothetical protein SORBIDRAFT_03g034890 [Sorghum bicolor]
Length=587

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 121/166 (73%), Gaps = 18/166 (11%)
 Frame = +2

Query  113  FDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPP--E  286
            FDF +DD+LCSY+D+    +  R   DPA      K+FH SR+ R        ++ P  +
Sbjct  21   FDFGADDVLCSYDDFAAPSEPKRP--DPA-----DKDFHDSRLGR-------PFVKPYEQ  66

Query  287  DSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHG  466
            +S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+RSD++ D  
Sbjct  67   ESYGKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRSDVLRD--  124

Query  467  ETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            ETD +LKSLEKHL EVHRS+QILRDKQELA+AQKELAK QL Q  S
Sbjct  125  ETDHRLKSLEKHLHEVHRSIQILRDKQELAEAQKELAKFQLTQDTS  170



>dbj|BAK01177.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=603

 Score =   179 bits (453),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 120/167 (72%), Gaps = 14/167 (8%)
 Frame = +2

Query  104  SKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPP  283
            ++ FDF +DD+LCSY+D+    +  R   DP       K+FH+SR  R ++         
Sbjct  16   TRSFDFGTDDVLCSYDDFAAPSEPKRP--DPV-----DKDFHESRFGRPAVKVYE-----  63

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            +DS   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+R+D++ D 
Sbjct  64   QDSYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRADVLRD-  122

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
             ETD +LKSLEKHL EVHRS+QILRDKQELAD QKELAK QL   ES
Sbjct  123  -ETDLRLKSLEKHLHEVHRSIQILRDKQELADTQKELAKFQLTHDES  168



>gb|EEC71500.1| hypothetical protein OsI_03777 [Oryza sativa Indica Group]
Length=595

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 123/172 (72%), Gaps = 15/172 (9%)
 Frame = +2

Query  77   SSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssm  256
             SG+P    S+ FDF +DD+LCSY+D+    +  R   DPA      ++FH SR+ R   
Sbjct  3    GSGVPAGRGSRSFDFGADDVLCSYDDFAAPSEPKRP--DPA----DKQDFHDSRLGRPFG  56

Query  257  mptsAYIPPEDSSFN-QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIG  433
                AY   E  S+  +DV+ AVEK MKKYADNL+R LEG+++RLSQLE+YCY L++S+G
Sbjct  57   K---AY---EQESYGKEDVLFAVEKCMKKYADNLLRSLEGITNRLSQLEIYCYKLERSMG  110

Query  434  EMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQL  589
            E+RSD++ D  ETD +LKSLEKHL EVHRS+QILRDKQELA+ QKELAK QL
Sbjct  111  ELRSDVLRD--ETDQRLKSLEKHLHEVHRSIQILRDKQELAETQKELAKFQL  160



>gb|EMS50510.1| hypothetical protein TRIUR3_23019 [Triticum urartu]
Length=606

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 120/167 (72%), Gaps = 14/167 (8%)
 Frame = +2

Query  104  SKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPP  283
            ++ FDF +DD+LCSY+D+        + S+P       K+FH+SR  R S+         
Sbjct  16   TRSFDFGTDDVLCSYDDFA-------APSEPKRPDPVDKDFHESRFGRPSVKVYE-----  63

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            +DS   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+R+D++ D 
Sbjct  64   QDSYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRADVLRD-  122

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
             ETD +LKSLEKHL EVHRS+QILRDKQELAD QKELAK QL   ES
Sbjct  123  -ETDLRLKSLEKHLHEVHRSIQILRDKQELADTQKELAKFQLTHDES  168



>emb|CDM84126.1| unnamed protein product [Triticum aestivum]
Length=603

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 120/167 (72%), Gaps = 14/167 (8%)
 Frame = +2

Query  104  SKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPP  283
            ++ FDF +DD+LCSY+D+    +  R   DP       K+FH+SR  R S+         
Sbjct  16   TRSFDFGTDDVLCSYDDFAAPSEPKRP--DPV-----DKDFHESRFGRPSVKVYE-----  63

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+R+D++ D 
Sbjct  64   QESYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRADVLRD-  122

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
             ETD +LKSLEKHL EVHRS+QILRDKQELAD QKELAK QL   ES
Sbjct  123  -ETDLRLKSLEKHLHEVHRSIQILRDKQELADTQKELAKFQLTHDES  168



>gb|EMT05386.1| hypothetical protein F775_26441 [Aegilops tauschii]
Length=606

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 120/167 (72%), Gaps = 14/167 (8%)
 Frame = +2

Query  104  SKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPP  283
            ++ FDF +DD+LCSY+D+    +  R   DP       K+FH+SR  R S+         
Sbjct  16   TRSFDFGTDDVLCSYDDFAAPSEPKRP--DPV-----DKDFHESRFGRPSVKVYE-----  63

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            ++S   +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+R+D++ D 
Sbjct  64   QESYAKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRADVLRD-  122

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
             ETD +LKSLEKHL EVHRS+QILRDKQELAD QKELAK QL   ES
Sbjct  123  -ETDLRLKSLEKHLHEVHRSIQILRDKQELADTQKELAKFQLTHDES  168



>ref|XP_004969990.1| PREDICTED: trithorax group protein osa-like [Setaria italica]
Length=590

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 122/165 (74%), Gaps = 16/165 (10%)
 Frame = +2

Query  113  FDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrmtrssmmptsAYIPPEDS  292
            FDF +DD+LCSY+D+    +  R   DPA      K+FH+SR+ R  +    AY   E  
Sbjct  21   FDFGADDVLCSYDDFAATSEPKRP--DPA-----DKDFHESRLGRPFVK---AY---EQE  67

Query  293  SFN-QDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S++ +DV+ AVEK MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+RSD++ D   
Sbjct  68   SYSKEDVLSAVEKCMKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRSDVLRD--V  125

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            TD +LKSLEKHL EVHRSVQILRDKQELA+AQKELAK QL Q  S
Sbjct  126  TDHRLKSLEKHLHEVHRSVQILRDKQELAEAQKELAKFQLTQDTS  170



>ref|XP_010051997.1| PREDICTED: LOW QUALITY PROTEIN: bromodomain-containing protein 
4 [Eucalyptus grandis]
Length=513

 Score =   167 bits (423),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = +2

Query  218  KEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  397
            ++FHK+R+ R       +   PEDS  N D++  VEKSMK+  D++MRFLEG+SSRLSQL
Sbjct  6    QDFHKNRLVRPVTYAPPSSTQPEDSX-NSDLVSTVEKSMKRNTDSIMRFLEGISSRLSQL  64

Query  398  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  577
            ELYCYNLDKSIGEMRS+L  DH E D KLKSLEKH+QEVHRSVQILRDKQELA+ QKELA
Sbjct  65   ELYCYNLDKSIGEMRSELTRDHDEADVKLKSLEKHVQEVHRSVQILRDKQELAETQKELA  124

Query  578  KLQLAQ  595
            KL   +
Sbjct  125  KLHFVR  130



>gb|KJB77274.1| hypothetical protein B456_012G128800 [Gossypium raimondii]
Length=461

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/90 (87%), Positives = 84/90 (93%), Gaps = 0/90 (0%)
 Frame = +2

Query  332  MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE  511
            MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEM+SDL+ D+ + DSKL S+EKHLQE
Sbjct  1    MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMQSDLIRDNEDADSKLNSIEKHLQE  60

Query  512  VHRSVQILRDKQELADAQKELAKLQLAQXE  601
            VHRSVQILRDKQELA+ QKELAKLQLAQ E
Sbjct  61   VHRSVQILRDKQELAETQKELAKLQLAQKE  90



>gb|KEH39132.1| structural constituent of cell wall protein, putative [Medicago 
truncatula]
Length=480

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 105/127 (83%), Gaps = 2/127 (2%)
 Frame = +2

Query  218  KEFHKsrmtrssmmptsAYIPPEDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQ  394
            ++FH SRM ++S  P +AY  PE  S +Q+VI   VEKSMK   D+LMRFLEG+SSRLSQ
Sbjct  22   QDFHISRMVKTSTFPATAYNSPE-VSLSQEVIATTVEKSMKTCTDDLMRFLEGISSRLSQ  80

Query  395  LELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKEL  574
            LELYCYN+DKSIGE++S+L  DH E DSKLKSL+KHLQEVHRSVQILRDKQEL + QKEL
Sbjct  81   LELYCYNIDKSIGELKSELTSDHEEADSKLKSLDKHLQEVHRSVQILRDKQELVETQKEL  140

Query  575  AKLQLAQ  595
            AKLQLA+
Sbjct  141  AKLQLAR  147



>ref|XP_010919602.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 23-like 
isoform X2 [Elaeis guineensis]
Length=488

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            ED S  + VI AVEK MKKYADNL+R LEG+S RLSQLELYC+ +++SIGE RSD++ D 
Sbjct  38   EDYS-KEKVIPAVEKCMKKYADNLLRSLEGISGRLSQLELYCFKIERSIGEFRSDIIRDQ  96

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSAN  616
             ET+ K K+LEKHLQEVHRSVQILRDKQELA+ QKELAKLQL Q ES   N
Sbjct  97   SETELKFKTLEKHLQEVHRSVQILRDKQELAETQKELAKLQLVQKESPQKN  147



>ref|XP_008810226.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
 ref|XP_008810227.1| PREDICTED: ataxin-2 homolog isoform X2 [Phoenix dactylifera]
Length=493

 Score =   160 bits (406),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            VI AVEK MKKYADNL+R+LEG+S RLSQLELYCY +++SIGE RSD++ D  E + K K
Sbjct  49   VICAVEKCMKKYADNLLRYLEGISGRLSQLELYCYKIERSIGEFRSDIIRDQSEGELKFK  108

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSAN  616
            S+EKHLQEVHRSVQILRDKQEL +AQKELAKLQL Q ES   N
Sbjct  109  SIEKHLQEVHRSVQILRDKQELVEAQKELAKLQLVQKESTQKN  151



>ref|XP_006844887.1| hypothetical protein AMTR_s00058p00125550 [Amborella trichopoda]
 gb|ERN06562.1| hypothetical protein AMTR_s00058p00125550 [Amborella trichopoda]
Length=532

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 87/106 (82%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            ++  FN +VI  VEK+MKK  D L+ F+EG+S R+SQ+E YC N+++SIGE+RSD VHDH
Sbjct  24   QNEDFNVEVITTVEKTMKKCMDTLLCFIEGISGRMSQMESYCCNIERSIGELRSDFVHDH  83

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            GE++SKL SLEKHLQEVHRS+QI+RDKQELA+ Q+EL KLQ+   E
Sbjct  84   GESNSKLTSLEKHLQEVHRSIQIIRDKQELAETQRELVKLQIVPKE  129



>gb|KCW89535.1| hypothetical protein EUGRSUZ_A01820 [Eucalyptus grandis]
Length=471

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  332  MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE  511
            MK+  D++MRFLEG+SSRLSQLELYCYNLDKSIGEMRS+L  DH E D KLKSLEKH+QE
Sbjct  1    MKRNTDSIMRFLEGISSRLSQLELYCYNLDKSIGEMRSELTRDHDEADVKLKSLEKHVQE  60

Query  512  VHRSVQILRDKQELADAQKELAKLQLAQ  595
            VHRSVQILRDKQELA+ QKELAKL   +
Sbjct  61   VHRSVQILRDKQELAETQKELAKLHFVR  88



>ref|XP_009396506.1| PREDICTED: pinin-like [Musa acuminata subsp. malaccensis]
Length=512

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/181 (49%), Positives = 112/181 (62%), Gaps = 11/181 (6%)
 Frame = +2

Query  65   MASG-SSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSAKEFHKsrm  241
            MASG SSG    S S  FDF SDD+LC Y DY  Q        DP++   S       + 
Sbjct  1    MASGESSGRAAASDSNSFDFGSDDVLCPYGDYAAQ--------DPSIGKRSNLPGTDIQE  52

Query  242  trssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLD  421
             R      SAY   + S ++  V  +VEK MKKYAD L++ LE +S RLSQ+E++ + L+
Sbjct  53   CRMGRSLVSAYEKEDCSKYS--VTSSVEKCMKKYADTLLQSLEAISGRLSQMEIHFHKLE  110

Query  422  KSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            +S+ E+R D + D  + D   KSLEKHLQEVHRSVQI+RDKQELA+  KELAKLQ+ Q E
Sbjct  111  QSLCELRGDFIQDQSDKDLNFKSLEKHLQEVHRSVQIMRDKQELAETHKELAKLQMVQKE  170

Query  602  S  604
            S
Sbjct  171  S  171



>ref|NP_001169238.1| uncharacterized protein LOC100383096 [Zea mays]
 gb|ACN32051.1| unknown [Zea mays]
Length=507

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 80/91 (88%), Gaps = 2/91 (2%)
 Frame = +2

Query  332  MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE  511
            MKKYADNL+R LEG++SRLSQLE+YCY L++SIGE+RSD++ D  ETD +LKSLEKHL E
Sbjct  1    MKKYADNLLRSLEGITSRLSQLEIYCYKLERSIGELRSDVLRD--ETDHRLKSLEKHLNE  58

Query  512  VHRSVQILRDKQELADAQKELAKLQLAQXES  604
            VHRS+QILRDKQELA+AQKELAK QL Q  S
Sbjct  59   VHRSIQILRDKQELAEAQKELAKFQLTQDTS  89



>gb|EEE55398.1| hypothetical protein OsJ_03493 [Oryza sativa Japonica Group]
Length=371

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 77/87 (89%), Gaps = 2/87 (2%)
 Frame = +2

Query  332  MKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQE  511
            MKKYADNL+R LEG+++RLSQLE+YCY L++S+GE+RSD++ D  ETD +LKSLEKHL E
Sbjct  1    MKKYADNLLRSLEGITNRLSQLEIYCYKLERSMGELRSDVLRD--ETDQRLKSLEKHLHE  58

Query  512  VHRSVQILRDKQELADAQKELAKLQLA  592
            VHRS+QILRDKQELA+ QKELAK QL 
Sbjct  59   VHRSIQILRDKQELAETQKELAKFQLT  85



>gb|EAY99014.1| hypothetical protein OsI_20972 [Oryza sativa Indica Group]
Length=518

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = +2

Query  284  EDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  460
            E  ++++++I +A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SIGE+RSD++  
Sbjct  50   EQETYSREIITEAIESCMKKQADNLVNTLDVISGRLSQLELYCYKLERSIGELRSDVMDY  109

Query  461  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESG  607
            HGE +   + LEKH++EV  SVQ+L+DKQELA+ QKEL KLQ+   ES 
Sbjct  110  HGEANINFRCLEKHVKEVQNSVQVLQDKQELAETQKELTKLQILHEESA  158



>gb|AAU10648.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH00945.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64682.1| hypothetical protein OsJ_19537 [Oryza sativa Japonica Group]
Length=518

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 83/109 (76%), Gaps = 1/109 (1%)
 Frame = +2

Query  284  EDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  460
            E  ++++++I +A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SIGE+RSD++  
Sbjct  50   EQETYSREIITEAIESCMKKQADNLVNTLDVISGRLSQLELYCYKLERSIGELRSDVMDY  109

Query  461  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESG  607
            HGE +   + LEKH++EV  SVQ+L+DKQELA+ QKEL KLQ+   ES 
Sbjct  110  HGEANINFRCLEKHVKEVQNSVQVLQDKQELAETQKELTKLQILHEESA  158



>ref|XP_006655586.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like, 
partial [Oryza brachyantha]
Length=512

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 84/109 (77%), Gaps = 1/109 (1%)
 Frame = +2

Query  284  EDSSFNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  460
            E  ++++++I +A+E  MKK A+NL+  L+ +S RLSQLELYCY L++SIGE+RSD++  
Sbjct  45   EQETYSREIITEAIENCMKKQAENLVNTLDVISGRLSQLELYCYKLERSIGELRSDVMDY  104

Query  461  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESG  607
            HGE +   + LEKH++EV +SVQ+L+DKQ+LA+ QKEL KLQ+   ES 
Sbjct  105  HGEANVNFRCLEKHVKEVQKSVQVLQDKQDLAETQKELNKLQILHEESA  153



>ref|XP_002440244.1| hypothetical protein SORBIDRAFT_09g028390 [Sorghum bicolor]
 gb|EES18674.1| hypothetical protein SORBIDRAFT_09g028390 [Sorghum bicolor]
Length=519

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V DA+E  MKK ADNL+  LE +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  59   VTDAIESCMKKQADNLLNSLEVISGRLSQLELYCYKLERSIGELRSDVMDYHNEANLNFQ  118

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESG  607
             LEK ++EV +SVQ++++KQELA+ QKE++KLQ+   +S 
Sbjct  119  CLEKQVKEVQKSVQVVQEKQELAETQKEMSKLQVVHEDSA  158



>ref|XP_004961233.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
isoform X2 [Setaria italica]
 ref|XP_004961234.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
isoform X3 [Setaria italica]
Length=484

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 5/107 (5%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V +A+E  MKK ADNL+  LE +S RLSQLELYCY L++SIGE+RSD++  H E     +
Sbjct  17   VTEAIENCMKKQADNLLNSLEVISGRLSQLELYCYKLERSIGELRSDVMDYHSEASLNYR  76

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQXESGSA  613
             LEKH++EV +SVQ+L++KQELA+  KE++KLQ+     AQ   G+A
Sbjct  77   CLEKHVKEVQQSVQVLQEKQELAETPKEMSKLQIVHEDSAQKSEGTA  123



>ref|XP_004961232.1| PREDICTED: adenylate cyclase, terminal-differentiation specific-like 
isoform X1 [Setaria italica]
Length=526

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 5/107 (5%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V +A+E  MKK ADNL+  LE +S RLSQLELYCY L++SIGE+RSD++  H E     +
Sbjct  59   VTEAIENCMKKQADNLLNSLEVISGRLSQLELYCYKLERSIGELRSDVMDYHSEASLNYR  118

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQXESGSA  613
             LEKH++EV +SVQ+L++KQELA+  KE++KLQ+     AQ   G+A
Sbjct  119  CLEKHVKEVQQSVQVLQEKQELAETPKEMSKLQIVHEDSAQKSEGTA  165



>gb|AFW79145.1| putative DUF1421 domain family protein [Zea mays]
Length=521

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V DA+E  MKK ADNL+  LE +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  56   VTDAIESCMKKQADNLLNSLEVISGRLSQLELYCYKLERSIGELRSDVMDYHNEANLNFQ  115

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESG  607
             L+K L+EV +SVQ+++++QELA+ QKE+ KLQ+   +S 
Sbjct  116  CLDKQLKEVQKSVQVVQERQELAETQKEMTKLQIVHEDSA  155



>ref|XP_006644504.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like [Oryza brachyantha]
Length=477

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +2

Query  311  IDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKS  490
            + AVE+ MKK A+ L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H E     + 
Sbjct  1    MAAVEECMKKQAEGLLHLLEGIGGRLSQLELYCYKLERSIGELRSDVMDYHSEGTVNFRC  60

Query  491  LEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            LEK+L++V +SVQ+L+DK ELA+  KEL+KLQ+A
Sbjct  61   LEKNLRQVQKSVQVLQDKHELAETPKELSKLQIA  94



>ref|NP_001266367.1| uncharacterized protein LOC101202710 [Zea mays]
 gb|ACN35148.1| unknown [Zea mays]
Length=531

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 81/110 (74%), Gaps = 2/110 (2%)
 Frame = +2

Query  269  AYIPPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMR  442
            A  PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+R
Sbjct  46   AQPPPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELR  105

Query  443  SDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            SD++  H E+ +  + ++K+L +VH+S+Q+L+D+Q+LA+  KEL+KLQ+A
Sbjct  106  SDVMDYHSESTTNFRCIDKNLGQVHKSLQVLQDRQDLAETPKELSKLQIA  155



>tpg|DAA58178.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=495

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 81/110 (74%), Gaps = 2/110 (2%)
 Frame = +2

Query  269  AYIPPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMR  442
            A  PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+R
Sbjct  10   AQPPPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELR  69

Query  443  SDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            SD++  H E+ +  + ++K+L +VH+S+Q+L+D+Q+LA+  KEL+KLQ+A
Sbjct  70   SDVMDYHSESTTNFRCIDKNLGQVHKSLQVLQDRQDLAETPKELSKLQIA  119



>ref|NP_001143126.1| uncharacterized protein LOC100275604 [Zea mays]
 gb|ACG29188.1| hypothetical protein [Zea mays]
Length=521

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V DA+E  MKK ADNL+  LE +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  56   VTDAIESCMKKQADNLLNSLEVISGRLSQLELYCYKLERSIGELRSDVMDYHNEANLNFQ  115

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESG  607
             L+K ++EV +SVQ+++++QELA+ QKE+ KLQ+   +S 
Sbjct  116  CLDKQVKEVQKSVQVVQERQELAETQKEMTKLQIVHEDSA  155



>gb|ACN33301.1| unknown [Zea mays]
 tpg|DAA58175.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=534

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 81/110 (74%), Gaps = 2/110 (2%)
 Frame = +2

Query  269  AYIPPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMR  442
            A  PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+R
Sbjct  49   AQPPPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELR  108

Query  443  SDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            SD++  H E+ +  + ++K+L +VH+S+Q+L+D+Q+LA+  KEL+KLQ+A
Sbjct  109  SDVMDYHSESTTNFRCIDKNLGQVHKSLQVLQDRQDLAETPKELSKLQIA  158



>ref|XP_002458299.1| hypothetical protein SORBIDRAFT_03g030820 [Sorghum bicolor]
 gb|EES03419.1| hypothetical protein SORBIDRAFT_03g030820 [Sorghum bicolor]
Length=538

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 78/95 (82%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD++  HG++ +  +
Sbjct  67   VMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDVMDYHGDSTANFR  126

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             ++K+L++VH+S+Q+L+D+Q+LA+  +EL+KLQ+A
Sbjct  127  CIDKNLRQVHKSLQVLQDRQDLAETPRELSKLQIA  161



>ref|XP_010232129.1| PREDICTED: uncharacterized protein LOC100831431 [Brachypodium 
distachyon]
Length=538

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V+ AVE+ MKK AD L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H E     +
Sbjct  61   VMAAVEECMKKQADGLLHSLEGIGGRLSQLELYCYKLERSIGELRSDVMDYHSEATVNFR  120

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
             L+K++++V ++VQ+L+DK E AD  ++LAKLQ+A       N +
Sbjct  121  CLDKNIRQVQKAVQMLQDKHEFADTAQQLAKLQMAHEFPARTNGA  165



>gb|EAY75332.1| hypothetical protein OsI_03225 [Oryza sativa Indica Group]
Length=540

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            ++S   + V+ AVE+ MKK A+ L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H
Sbjct  56   QESYTKEAVMAAVEECMKKQAEGLLHSLEGIGGRLSQLELYCYKLERSIGELRSDVMDYH  115

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSAN  616
             E     + LEK+L++V +SVQIL+DK E+++   E +KLQ+A      AN
Sbjct  116  SEGTVNFRCLEKNLRQVQKSVQILQDKHEISETPNEFSKLQIAHEFPARAN  166



>ref|XP_004960805.1| PREDICTED: protein diaphanous homolog 1-like [Setaria italica]
Length=568

 Score =   112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+F+   I  ++++MKKYADNL+  LEG+SSRLSQLE   Y+L+ S+GE++  + +++
Sbjct  118  ERSNFSAVTIVDIDRTMKKYADNLLHALEGVSSRLSQLEDRTYHLENSVGELKLTIGNNN  177

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +LAKLQ+ + E
Sbjct  178  GSTDGKLRQFENTLREVQAGVQILRDKQEIVETQIQLAKLQVPKAE  223



>gb|EAZ13051.1| hypothetical protein OsJ_02970 [Oryza sativa Japonica Group]
Length=540

 Score =   111 bits (278),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V+ AVE+ MKK A+ L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H E     +
Sbjct  64   VMAAVEECMKKQAEGLLHSLEGIGGRLSQLELYCYKLERSIGELRSDVMDYHSEGTVNFR  123

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSAN  616
             LEK+L++V +SVQIL+DK E+++   E +KLQ+A      AN
Sbjct  124  CLEKNLRQVQKSVQILQDKHEISETPNEFSKLQIAHEFPARAN  166



>ref|NP_001142422.1| putative DUF1421 domain family protein [Zea mays]
 gb|ACF88458.1| unknown [Zea mays]
 gb|ACN25356.1| unknown [Zea mays]
 gb|AFW81113.1| putative DUF1421 domain family protein [Zea mays]
Length=518

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V  A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  59   VTHAIESCMKKQADNLLNSLDVISGRLSQLELYCYRLERSIGELRSDVMDYHNEANLNFR  118

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESG  607
             +EK ++EV +SVQ +++KQELA+ QKE+ KLQ+   +S 
Sbjct  119  CVEKQVKEVQKSVQAVQEKQELAETQKEMTKLQIVHEDSA  158



>ref|XP_003567907.1| PREDICTED: transcriptional regulator DEF1-like [Brachypodium 
distachyon]
Length=536

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 77/107 (72%), Gaps = 5/107 (5%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            + +A+E  MKK A+NL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H E +    
Sbjct  57   ITEAIEDCMKKQAENLVNSLDVISGRLSQLELYCYKLERSIGELRSDVMDYHSEANLNFN  116

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQXESGSA  613
             LEK+++EV  SVQ+L+DKQELA+ Q +LA+LQ+     AQ   G+A
Sbjct  117  CLEKNMKEVQTSVQVLQDKQELAETQNKLARLQMVYEEPAQKSEGTA  163



>ref|XP_008654665.1| PREDICTED: putative DUF1421 domain family protein isoform X2 
[Zea mays]
Length=495

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V  A+E  MKK ADNL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  36   VTHAIESCMKKQADNLLNSLDVISGRLSQLELYCYRLERSIGELRSDVMDYHNEANLNFR  95

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESG  607
             +EK ++EV +SVQ +++KQELA+ QKE+ KLQ+   +S 
Sbjct  96   CVEKQVKEVQKSVQAVQEKQELAETQKEMTKLQIVHEDSA  135



>ref|XP_008654664.1| PREDICTED: putative DUF1421 domain family protein isoform X1 
[Zea mays]
Length=539

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 99/190 (52%), Gaps = 45/190 (24%)
 Frame = +2

Query  38   QKPVASRFAMASGSSGLPNNSASKVFDFASDDILCSYEDYGNQEKSARSHSDPAVASNSA  217
            ++PV  R  + +G  G P      V DF  + +L S+ ++  QEK ++            
Sbjct  35   ERPV--RSLLVAGDGGAP---CCLVLDFQENRLLMSFVNFHEQEKISK------------  77

Query  218  KEFHKsrmtrssmmptsAYIPPEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQL  397
                                        + V  A+E  MKK ADNL+  L+ +S RLSQL
Sbjct  78   ----------------------------EIVTHAIESCMKKQADNLLNSLDVISGRLSQL  109

Query  398  ELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELA  577
            ELYCY L++SIGE+RSD++  H E +   + +EK ++EV +SVQ +++KQELA+ QKE+ 
Sbjct  110  ELYCYRLERSIGELRSDVMDYHNEANLNFRCVEKQVKEVQKSVQAVQEKQELAETQKEMT  169

Query  578  KLQLAQXESG  607
            KLQ+   +S 
Sbjct  170  KLQIVHEDSA  179



>ref|XP_003568842.1| PREDICTED: zyxin-like [Brachypodium distachyon]
Length=573

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+FN   I  ++++MKKYADNL+  LEG+SSRLSQLE   ++L+ S+GE++  + + +
Sbjct  132  ERSNFNAVTIADIDRTMKKYADNLLNALEGVSSRLSQLEGRTHHLEDSVGELKLTIGNSN  191

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +L+KLQ+ + E+  + N+
Sbjct  192  GSTDGKLRQFENTLREVQAGVQILRDKQEIVETQIQLSKLQVFKEENVQSENA  244



>gb|EMS64546.1| hypothetical protein TRIUR3_27252 [Triticum urartu]
Length=656

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 81/115 (70%), Gaps = 5/115 (4%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            +D+   + + +A+E  M K A+NL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H
Sbjct  176  QDNHSKEIITEAIESCMNKQAENLVNSLDVISGRLSQLELYCYKLERSIGELRSDVMDYH  235

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQXESGSA  613
             E +    SL+K+++EV + VQ+L+DKQELA+ Q ELAKLQ+     AQ   G+A
Sbjct  236  SEANLNFHSLDKNVKEVQKCVQVLQDKQELAETQNELAKLQIVYEDPAQKSEGTA  290



>ref|XP_002440684.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
 gb|EES19114.1| hypothetical protein SORBIDRAFT_09g005090 [Sorghum bicolor]
Length=582

 Score =   109 bits (273),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+F+   I  ++++MKKYADNL+  LE +SSRLSQLE   Y+L+ S+GE++  + +++
Sbjct  133  ERSNFSAVTIADIDRTMKKYADNLLHALESVSSRLSQLEDRTYHLENSVGELKLTIGNNN  192

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +LAKLQ+ + E
Sbjct  193  GSTDGKLRQFENTLREVQAGVQILRDKQEIVETQIQLAKLQMPKAE  238



>dbj|BAJ85240.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=575

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            + +A+E  M K A+NL+  L+ +S RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  102  ITEAIESCMNKQAENLVNSLDVISGRLSQLELYCYKLERSIGELRSDVMDYHSEANLNFR  161

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             L+K+++EV + VQ+L+DKQELA+ Q +LAKLQ+A
Sbjct  162  GLDKNVKEVQKCVQVLQDKQELAETQNDLAKLQIA  196



>gb|EMT01630.1| hypothetical protein F775_09697 [Aegilops tauschii]
Length=574

 Score =   109 bits (272),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+FN   I  ++++MKKYADNL+  +EG+SSRL+QLE   ++L+ S+GE++  + + +
Sbjct  125  ERSNFNAVTIADIDRTMKKYADNLLHAMEGVSSRLAQLEGRTHHLEDSVGELKLTVGNYN  184

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            G TD KL+  E  L+EV   VQILRDKQE+ +AQ +L KLQ+++ E
Sbjct  185  GSTDGKLRQFENTLREVQAGVQILRDKQEIVEAQVQLTKLQVSKAE  230



>ref|XP_008666394.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26 [Zea mays]
Length=340

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 5/107 (5%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V  A+E  MKK ADNL+  L+ ++ RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  45   VTHAIESCMKKQADNLLNSLDVINGRLSQLELYCYILERSIGELRSDVMDYHNEANLNFR  104

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQL-----AQXESGSA  613
             +EK ++EV +SVQ +++KQELA+ QKEL KLQ+     AQ   G+A
Sbjct  105  CVEKQVKEVQKSVQAVQEKQELAETQKELTKLQIVHEDSAQKSEGTA  151



>dbj|BAK01901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=571

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+FN   I  ++++MKKYADNL+  LEG+SSRL+QLE   ++L+ S+GE++  + + +
Sbjct  123  ERSNFNAVTIADIDRTMKKYADNLLHALEGVSSRLAQLEGRTHHLEDSVGELKLTVGNYN  182

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            G TD KL+  E  L+EV   VQILRDKQE+ +AQ +L KLQ+++ E
Sbjct  183  GSTDGKLRQFENTLREVQAGVQILRDKQEIVEAQVQLTKLQVSKAE  228



>dbj|BAJ94416.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=536

 Score =   108 bits (269),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V+ AVE+ M+K A+ L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H E     +
Sbjct  61   VMAAVEECMRKQAEGLLHSLEGIGGRLSQLELYCYKLERSIGELRSDVMDYHSEGTVNFR  120

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             L+K+L++V ++VQ+L+DK E AD  ++LAKLQ+A
Sbjct  121  CLDKNLRQVQKAVQMLQDKHEPADTAQQLAKLQIA  155



>tpg|DAA47389.1| TPA: hypothetical protein ZEAMMB73_495059 [Zea mays]
Length=274

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 74/104 (71%), Gaps = 4/104 (4%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V  A+E  MKK ADNL+  L+ ++ RLSQLELYCY L++SIGE+RSD++  H E +   +
Sbjct  127  VTHAIESCMKKQADNLLNSLDVINGRLSQLELYCYILERSIGELRSDVMDYHNEANLNFR  186

Query  488  SLEKHLQEVH----RSVQILRDKQELADAQKELAKLQLAQXESG  607
             +EK ++E+H    +SVQ +++KQELA+ QKEL KLQ+   +S 
Sbjct  187  CVEKQVKEIHGQVQKSVQAVQEKQELAETQKELTKLQIVHEDSA  230



>emb|CDM83294.1| unnamed protein product [Triticum aestivum]
Length=475

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +2

Query  311  IDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKS  490
            + AVE+ M+K A+ L+  LEG+  RLSQLELYCY L++SIGE+RSD++  H E     + 
Sbjct  1    MAAVEECMRKQAEGLLHSLEGIGGRLSQLELYCYKLERSIGELRSDVMDYHSEGTVNFRC  60

Query  491  LEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            L+K+L++V ++VQ+L+DK E AD  ++LAKLQ+A
Sbjct  61   LDKNLRQVQKAVQMLQDKHEPADTAQQLAKLQIA  94



>gb|EMS54596.1| Tryptophan aminotransferase 1 [Triticum urartu]
Length=891

 Score =   108 bits (269),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+FN   I  ++++MKKYADNL+  +EG+SSRL+QLE   ++L+ S+GE++  + + +
Sbjct  89   ERSNFNAVTIADIDRTMKKYADNLLHAMEGVSSRLAQLEGRTHHLEDSVGELKLTVGNYN  148

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            G TD KL+  E  L+EV   VQILRDKQE+ +AQ +L KLQ+++ E
Sbjct  149  GSTDGKLRQFENTLREVQAGVQILRDKQEIVEAQVQLTKLQVSKAE  194



>gb|ADE75761.1| unknown [Picea sitchensis]
Length=534

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
             ++AVE+ MK+Y DNL+  LEG+S RLS LE    +L+ S+GE++  + ++HG TD KL+
Sbjct  101  TVEAVERIMKQYIDNLLHALEGISRRLSHLESTTRHLETSLGELKMTVDNNHGATDGKLR  160

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
             LE H +EV   VQILRDKQE+A+A  +L KLQL++  S
Sbjct  161  LLENHTREVQTGVQILRDKQEIAEAHSQLMKLQLSKSNS  199



>ref|XP_008656735.1| PREDICTED: chromatin modification-related protein eaf-1-like 
isoform X2 [Zea mays]
Length=682

 Score =   107 bits (267),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V+ AVE+  +K AD L+  L  +  RLSQLELYCY L++SIGE+RSD++  H ++++  K
Sbjct  184  VVAAVEECTRKQADALLHSLGAIGGRLSQLELYCYKLERSIGELRSDVMDYHSDSNANFK  243

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             ++++L++VH+S+Q+L+D+Q+LA+  KEL+KLQ+A
Sbjct  244  CIDRNLRQVHKSLQLLQDRQDLAETAKELSKLQIA  278



>ref|XP_006655038.1| PREDICTED: vegetative cell wall protein gp1-like, partial [Oryza 
brachyantha]
Length=495

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+ +   I  ++++MKKYADNL+  LEG+SSRLSQLE   ++L+ S+GE++  + + +
Sbjct  47   ERSNLSAVSIADIDRTMKKYADNLLHALEGVSSRLSQLEGRTHHLENSVGELKLTIGNYN  106

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +L+KLQ+++ E   + N+
Sbjct  107  GSTDGKLRQFENTLREVQAGVQILRDKQEIMETQVQLSKLQVSKAEDAQSENA  159



>ref|XP_008801947.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Phoenix 
dactylifera]
Length=539

 Score =   103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 77/108 (71%), Gaps = 0/108 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E  +++   +  +++++KKYADNL+  LEG+SSRLSQLE     L+ S+ E++  + ++H
Sbjct  99   ERDAYDVAAVAEIDRTVKKYADNLLHALEGVSSRLSQLESRTRYLESSVDELKVSVGNNH  158

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESG  607
            G TD KL+ LE  L+EV   VQ+LRDKQ++A+AQ +LAKLQ ++ E G
Sbjct  159  GSTDGKLRQLENILREVQTGVQVLRDKQDIAEAQLQLAKLQASKSEQG  206



>ref|NP_001140648.1| uncharacterized protein LOC100272723 [Zea mays]
 gb|ACF84264.1| unknown [Zea mays]
 tpg|DAA53270.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=568

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQ+E   + L+ S+ E++  + + +G 
Sbjct  133  SNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVDELKLTIGNYNGS  192

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            TD KL+ LE  L+EV   VQILRDKQE+ +AQ  LAKLQ  + ++ S+ NS
Sbjct  193  TDGKLRHLENMLREVQAGVQILRDKQEIVEAQLHLAKLQTTKTDAHSSENS  243



>dbj|BAK07367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+ E +  + + +G 
Sbjct  123  SNFGLVTIADIDRTMKKYSDNLLYALEGVSSRLSQLEGRTHHLESSVDEFKLTIGNYNGS  182

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            TD KL+ LE  L+EV   VQI+RDKQE+ + Q  LAKLQ+ + E+ S+ NS
Sbjct  183  TDGKLRQLENMLREVQAGVQIMRDKQEIVETQLHLAKLQIPKNETQSSENS  233



>emb|CDM81418.1| unnamed protein product [Triticum aestivum]
Length=603

 Score =   103 bits (256),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+ E +  + + +G 
Sbjct  131  SNFGLVTIADIDRTMKKYSDNLLYALEGVSSRLSQLEGRTHHLESSVDEFKLTIGNYNGS  190

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            TD KL+ LE  L+E+   VQI+RDKQE+ + Q  LAKLQ+ + E+ S+ NS
Sbjct  191  TDGKLRQLENMLREIQAGVQIMRDKQEIVEMQLHLAKLQIPKTETQSSENS  241



>gb|EMS67668.1| hypothetical protein TRIUR3_30524 [Triticum urartu]
Length=566

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 77/111 (69%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+ + +  + + +G 
Sbjct  94   SNFGLVTIADIDRTMKKYSDNLLYALEGVSSRLSQLEGRTHHLESSVDDFKLTIGNFNGS  153

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            TD KL+ LE  L+EV   VQI+RDKQE+ + Q  LAKLQ+ + E+ S+ NS
Sbjct  154  TDGKLRQLENMLREVQAGVQIMRDKQEIVETQLHLAKLQIPKTETQSSENS  204



>ref|NP_001054762.2| Os05g0169400 [Oryza sativa Japonica Group]
 dbj|BAF16676.2| Os05g0169400, partial [Oryza sativa Japonica Group]
Length=536

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E  +F+   I  ++++MKKYADNL+  LE +SSRLSQLE   ++L+ S+GE++  + + +
Sbjct  90   ERGNFSAVSIADIDRTMKKYADNLLHALESVSSRLSQLEGRTHHLENSVGELKLIIGNYN  149

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +L+KLQL++ E
Sbjct  150  GSTDGKLRQFENTLREVQAGVQILRDKQEIVETQVQLSKLQLSKAE  195



>gb|AFW80147.1| putative DUF1421 domain family protein [Zea mays]
Length=563

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQ+E   + L+ S+ E++  + + +G 
Sbjct  125  SNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVDELKLTIGNYNGS  184

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            TD KL++LE  L+EV   VQILRDKQE+ + Q  LAKLQ  + +  S+ NS
Sbjct  185  TDGKLRNLENMLREVQAGVQILRDKQEIVETQLHLAKLQTNKTDGQSSENS  235



>gb|EAY96697.1| hypothetical protein OsI_18619 [Oryza sativa Indica Group]
 gb|EEE62479.1| hypothetical protein OsJ_17276 [Oryza sativa Japonica Group]
Length=574

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E  +F+   I  ++++MKKYADNL+  LE +SSRLSQLE   ++L+ S+GE++  + + +
Sbjct  128  ERGNFSAVSIADIDRTMKKYADNLLHALESVSSRLSQLEGRTHHLENSVGELKLIIGNYN  187

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            G TD KL+  E  L+EV   VQILRDKQE+ + Q +L+KLQL++ E
Sbjct  188  GSTDGKLRQFENTLREVQAGVQILRDKQEIVETQVQLSKLQLSKAE  233



>emb|CBI34879.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            +D + +  ++  ++++MKK+ADNL+  LEGLS+RL+QLE    NL+ S+ +++  + ++H
Sbjct  112  KDRNIDAAIVSEIDRTMKKHADNLLHVLEGLSARLTQLESRTRNLENSVDDLKVSVGNNH  171

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGS  610
            G  D K++ LE  L+EV   VQ+LRDKQE+ +A  +LAKLQ+++ +  S
Sbjct  172  GSADGKMRQLENILREVQTGVQVLRDKQEIVEAHLQLAKLQVSKADQQS  220



>ref|XP_002275607.1| PREDICTED: protein enabled [Vitis vinifera]
Length=563

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            +D + +  ++  ++++MKK+ADNL+  LEGLS+RL+QLE    NL+ S+ +++  + ++H
Sbjct  112  KDRNIDAAIVSEIDRTMKKHADNLLHVLEGLSARLTQLESRTRNLENSVDDLKVSVGNNH  171

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            G  D K++ LE  L+EV   VQ+LRDKQE+ +A  +LAKLQ+++ +
Sbjct  172  GSADGKMRQLENILREVQTGVQVLRDKQEIVEAHLQLAKLQVSKAD  217



>ref|XP_011097415.1| PREDICTED: protein enabled-like [Sesamum indicum]
Length=543

 Score =   100 bits (250),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = +2

Query  281  PEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  460
            P ++S +  ++  ++++MKKYADNLM  L+G+S+RLSQLE    NL+ S+ +++  + ++
Sbjct  120  PVNASLDVSLVSEIDRTMKKYADNLMHTLDGVSARLSQLETRSRNLENSMDDLKESIDNN  179

Query  461  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             G TD K++ LE  L+EV   VQ++RDKQE+ +AQ  +AKL + + E
Sbjct  180  QGSTDGKIRQLEDILREVQAGVQVIRDKQEVVEAQLHIAKLPIPKVE  226



>ref|XP_010108811.1| hypothetical protein L484_020546 [Morus notabilis]
 gb|EXC20326.1| hypothetical protein L484_020546 [Morus notabilis]
Length=591

 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +2

Query  284  EDSSFNQDVIDA-VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  460
            + SSF+   I A ++K+MKK+ADNL+  L+G+S+RL+QLE    NL+ S+ +++  + ++
Sbjct  125  DQSSFDSSTIMAEIDKTMKKHADNLLHVLDGVSARLTQLESRTRNLENSVDDLKVSVGNN  184

Query  461  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            HG TD K++ LE  L+EV   VQ+L+DKQE+ +AQ +LAK+QL+
Sbjct  185  HGSTDGKMRQLENILREVQSGVQVLKDKQEIVEAQLQLAKVQLS  228



>ref|XP_006643803.1| PREDICTED: vegetative cell wall protein gp1-like [Oryza brachyantha]
Length=573

 Score =   100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 75/110 (68%), Gaps = 0/110 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F    +  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+ E++  + + +G 
Sbjct  125  SNFGAVTMADIDRTMKKYSDNLLHALEGVSSRLSQLEGQTHHLENSVDELKLTIGNYNGS  184

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANN  619
            TD KL+ LE  L+EV   VQILRDKQE+ + Q  LAKLQ  + ++ S  N
Sbjct  185  TDGKLRQLENMLREVQAGVQILRDKQEIVETQLHLAKLQPPKSDTPSLEN  234



>ref|NP_001147786.1| LOC100281396 [Zea mays]
 gb|ACG28711.1| proline-rich protein [Zea mays]
Length=563

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQ+E   + L+  + E++  + + +G 
Sbjct  125  SNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENCVDELKLTIGNYNGS  184

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            TD KL++LE  L+EV   VQILRDKQE+ + Q  LAKLQ  + +  S+ NS
Sbjct  185  TDGKLRNLENMLREVQAGVQILRDKQEIVETQLHLAKLQTNKTDGQSSENS  235



>ref|XP_008656734.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15-like isoform X1 [Zea mays]
Length=689

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 75/102 (74%), Gaps = 7/102 (7%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V+ AVE+  +K AD L+  L  +  RLSQLELYCY L++SIGE+RSD++  H ++++  K
Sbjct  184  VVAAVEECTRKQADALLHSLGAIGGRLSQLELYCYKLERSIGELRSDVMDYHSDSNANFK  243

Query  488  SLEKHLQ-------EVHRSVQILRDKQELADAQKELAKLQLA  592
             ++++L+       +VH+S+Q+L+D+Q+LA+  KEL+KLQ+A
Sbjct  244  CIDRNLRQIYILGCQVHKSLQLLQDRQDLAETAKELSKLQIA  285



>gb|AFW83522.1| putative DUF1421 domain family protein [Zea mays]
Length=578

 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 75/102 (74%), Gaps = 7/102 (7%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V+ AVE+  +K AD L+  L  +  RLSQLELYCY L++SIGE+RSD++  H ++++  K
Sbjct  73   VVAAVEECTRKQADALLHSLGAIGGRLSQLELYCYKLERSIGELRSDVMDYHSDSNANFK  132

Query  488  SLEKHLQ-------EVHRSVQILRDKQELADAQKELAKLQLA  592
             ++++L+       +VH+S+Q+L+D+Q+LA+  KEL+KLQ+A
Sbjct  133  CIDRNLRQIYILGCQVHKSLQLLQDRQDLAETAKELSKLQIA  174



>ref|XP_008784980.1| PREDICTED: uncharacterized protein LOC103703781 [Phoenix dactylifera]
Length=875

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+++   +  +++++KKYADNL+R LEG+SSRL QLE   ++L+ S+ E++  + +  
Sbjct  104  EKSAYDAATVAEIDRTVKKYADNLLRTLEGVSSRLMQLESRTHHLESSVDELKVTIGNSS  163

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            G TD KL+ LE  L EV   VQ+LRDKQE+ +AQ +LA LQ ++ +S
Sbjct  164  GTTDGKLRQLENILTEVQTGVQVLRDKQEIVEAQLQLANLQASKGDS  210



>emb|CAN60421.1| hypothetical protein VITISV_021069 [Vitis vinifera]
Length=604

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            +D + +  ++  ++++MKK ADNL+  LEGLS+RL+QLE    NL+ S+ +++  + ++H
Sbjct  101  KDRNIDAAIVSEIDRTMKKXADNLLHXLEGLSARLTQLESRTRNLENSVDDLKVSVGNNH  160

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            G  D K++ LE  L+EV   VQ+LRDKQE+ +A  +LAKLQ+++ +
Sbjct  161  GSADGKMRQLENILREVQTGVQVLRDKQEIVEAHLQLAKLQVSKAD  206



>ref|XP_002985569.1| hypothetical protein SELMODRAFT_446314 [Selaginella moellendorffii]
 gb|EFJ13443.1| hypothetical protein SELMODRAFT_446314 [Selaginella moellendorffii]
Length=538

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 6/108 (6%)
 Frame = +2

Query  296  FNQDVID-----AVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  460
            F++D  D     AVE++MKKYADNL+R LEG+  RLSQLE     L+ +  + +S   ++
Sbjct  113  FDKDAYDSATAAAVERTMKKYADNLLRVLEGMGGRLSQLEAATQRLEVAFEKSKSANANN  172

Query  461  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            HGETD +L+ LE  L+EV R VQ++RDKQE+ +AQ +L KLQ  + E+
Sbjct  173  HGETDGRLRMLENMLREVQRGVQVVRDKQEINEAQFQL-KLQQDKTEA  219



>ref|XP_002455112.1| hypothetical protein SORBIDRAFT_03g004550 [Sorghum bicolor]
 gb|EES00232.1| hypothetical protein SORBIDRAFT_03g004550 [Sorghum bicolor]
Length=571

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 75/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F    I  ++++MKKY+DNL+  LEG+SSRLSQ+E   + L+ S+ E++  + + +G 
Sbjct  132  SNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVDELKLTIGNYNGS  191

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            TD KL+ LE  L+EV   VQI+RDKQE+ + Q  LAKLQ  + ++  + NS
Sbjct  192  TDGKLRHLENMLREVQAGVQIMRDKQEIVETQLHLAKLQTTKADAQLSENS  242



>ref|XP_002987005.1| hypothetical protein SELMODRAFT_425866 [Selaginella moellendorffii]
 gb|EFJ11848.1| hypothetical protein SELMODRAFT_425866 [Selaginella moellendorffii]
Length=548

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 6/108 (6%)
 Frame = +2

Query  296  FNQDVID-----AVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  460
            F++D  D     AVE++MKKYADNL+R LEG+  RLSQLE     L+ +  + +S   ++
Sbjct  113  FDKDAYDSATAAAVERTMKKYADNLLRVLEGMGGRLSQLEAATQRLEVAFEKSKSANANN  172

Query  461  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            HGETD +L+ LE  L+EV R VQ++RDKQE+ +AQ +L KLQ  + E+
Sbjct  173  HGETDGRLRMLENMLREVQRGVQVVRDKQEINEAQFQL-KLQQDKTEA  219



>ref|XP_004968338.1| PREDICTED: class E vacuolar protein-sorting machinery protein 
HSE1-like [Setaria italica]
Length=570

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 76/111 (68%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F    +  ++++MKKY+DN++  LEG+SSRLSQ+E   + L+ S+ E++  + + +G 
Sbjct  129  SNFTAVTMADIDRTMKKYSDNILHALEGVSSRLSQMESRTHQLENSVDELKLTIGNYNGG  188

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            TD KL+ LE  L+EV   VQILRDKQ++ + Q  LAKLQ  + ++ S+ NS
Sbjct  189  TDGKLRHLENMLREVQAGVQILRDKQDIVETQLHLAKLQTPKTDTQSSENS  239



>ref|XP_006833453.1| hypothetical protein AMTR_s00082p00053170 [Amborella trichopoda]
 gb|ERM98731.1| hypothetical protein AMTR_s00082p00053170 [Amborella trichopoda]
Length=695

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  +++++KK+ DNL+  LEG+S+RLSQLE     L+ S+ E++  + + HG TD KL+
Sbjct  94   IVSEIDRTVKKHVDNLLHSLEGVSARLSQLESRTRRLENSVDELKVSVGNSHGSTDGKLR  153

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             LE  L+EV  SVQ+LRDKQE+A+A  +L KLQL++ E
Sbjct  154  QLENILREVQASVQVLRDKQEIAEAHSQLMKLQLSKSE  191



>ref|XP_010940140.1| PREDICTED: protein diaphanous homolog 1-like [Elaeis guineensis]
Length=549

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 73/101 (72%), Gaps = 0/101 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+++   +  V++++KKYADNL+  LEG+SSRL++LE   + L+ S+  ++  + +++
Sbjct  103  EKSAYDAATVAEVDRTVKKYADNLLHALEGVSSRLTELESRAHQLESSVDGLKMMIGNNN  162

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
            G TD KL+ LE  L+EV   VQ+LRDKQE+ +AQ +LAKLQ
Sbjct  163  GTTDGKLRQLENVLREVQTGVQVLRDKQEIVEAQLQLAKLQ  203



>gb|KFK25694.1| hypothetical protein AALP_AA8G147000 [Arabis alpina]
Length=530

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            +I A++++MKK+ADNL+  +EG+S+RL+QLE    NL+  + +++  + + HG TD KL+
Sbjct  107  IISAIDRTMKKHADNLLHVMEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGNTDGKLR  166

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
             LE  L EV   VQ+L+DKQE+ +AQ +L+KLQ
Sbjct  167  QLENILLEVQSGVQLLKDKQEIVEAQLQLSKLQ  199



>ref|XP_008795992.1| PREDICTED: protein transport protein SEC31-like [Phoenix dactylifera]
Length=553

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+++   +  V++++KKYADNL+  LEG+SSRL++LE   + L+ S+  ++  + +++
Sbjct  104  EKSAYDAATVAEVDRTVKKYADNLLHALEGVSSRLTELENRTHQLESSVDGLKVMIGNNN  163

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
            G TD KLK LE  L+EV   VQ+LRDKQE+  AQ +LAKLQ
Sbjct  164  GTTDGKLKQLENILREVQTGVQVLRDKQEIVQAQLQLAKLQ  204



>ref|NP_001042136.2| Os01g0169900 [Oryza sativa Japonica Group]
 dbj|BAD68319.1| vegetative cell wall protein gp1 -like [Oryza sativa Japonica 
Group]
 gb|EAY72703.1| hypothetical protein OsI_00570 [Oryza sativa Indica Group]
 gb|EAZ10703.1| hypothetical protein OsJ_00537 [Oryza sativa Japonica Group]
 dbj|BAH00414.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04050.2| Os01g0169900 [Oryza sativa Japonica Group]
Length=580

 Score = 97.4 bits (241),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F    +  ++++MKKY+DNL+  LEG+SSRLSQLE   ++L+ S+ +++  + + +G 
Sbjct  127  SNFGTVTMADIDRTMKKYSDNLLHALEGVSSRLSQLEGRTHHLENSVDDLKITIGNYNGS  186

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANN  619
            TD KL+ LE  L+EV   VQILRDKQE+ + Q  LAKLQ  + ++ +++N
Sbjct  187  TDGKLRQLENMLREVQAGVQILRDKQEIVETQLHLAKLQPPKSDALASDN  236



>ref|XP_010230500.1| PREDICTED: uncharacterized protein LOC100838076 [Brachypodium 
distachyon]
Length=961

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F Q  +  ++++MKKY+DNL   LEG+SSRL QLE   ++L+ S+ E    + + +G 
Sbjct  122  SNFGQVTVADIDRTMKKYSDNLFHALEGVSSRLLQLERRTHHLENSVDEFNLTIGNYNGS  181

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
            TD KL+ LE  L+EV   VQI+RDKQE+ +    LAKLQ  + E+ S+ NS
Sbjct  182  TDGKLRQLENMLREVQVGVQIMRDKQEIVETLVNLAKLQAPKTETHSSENS  232



>ref|XP_010033310.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 1 [Eucalyptus grandis]
 gb|KCW52919.1| hypothetical protein EUGRSUZ_J02234 [Eucalyptus grandis]
Length=576

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +2

Query  293  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  472
            +F+  ++  ++++MKK+AD+L+  LEG+S+RL+QLE    NL+ S+ +++  + +++G T
Sbjct  143  AFDASMVSEIDRTMKKHADSLLHVLEGVSARLTQLESRTRNLENSVDDLKVSVDNNYGTT  202

Query  473  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            D K++ LE  L++V   VQ+L+DKQE+ +AQ +LAKLQL++ E
Sbjct  203  DGKMRQLENILRDVQGGVQVLKDKQEIMEAQYQLAKLQLSKAE  245



>ref|XP_010551915.1| PREDICTED: actin cytoskeleton-regulatory complex protein PAN1 
[Tarenaya hassleriana]
Length=550

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+ N  ++  ++++MKK+ADNL+  +EGLS+RL+QLE    NL+  + +++  + + HG 
Sbjct  126  SAPNTSILSEIDRTMKKHADNLLHAMEGLSARLTQLETRTRNLENLVDDLKVSVGNSHGS  185

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            TD K++ LE  L EV   VQ+L+DKQE+ +AQ +L+K Q+++ +
Sbjct  186  TDGKMRQLENILLEVQSGVQLLKDKQEIVEAQLQLSKFQISKVD  229



>ref|XP_002873675.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49934.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            +I A++++MK +AD+L+  +EG+S+RL+QLE    NL+  + +++  + + HG+TD KL+
Sbjct  120  IISAIDRTMKAHADSLLHVMEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGKTDGKLR  179

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQL++
Sbjct  180  QLENIMLEVQSGVQLLKDKQEIVEAQLQLSKLQLSK  215



>ref|XP_010248593.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 3 [Nelumbo nucifera]
Length=554

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = +2

Query  293  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  472
            +++   +  +++++KKYADNL+  LEG+S+RL+QLE    +L+ S+ +++  + ++HG T
Sbjct  104  AYDAATVSEIDRTVKKYADNLLHALEGVSARLTQLESRTRHLESSVDDLKLSVGNNHGST  163

Query  473  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA---QXESGSANNSQ  625
            D KL+ LE  L+EV   VQ+LR+KQE+ + Q + AK Q++   Q   G  N SQ
Sbjct  164  DGKLRQLENSLREVQTGVQVLREKQEIVETQLQFAKFQVSKGDQQSEGQNNASQ  217



>ref|XP_003525675.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein-like 
[Glycine max]
Length=573

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F+  ++  ++++MKK+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + ++HG 
Sbjct  131  SAFDATMLSEIDRTMKKHMENMLHVLEGVSARLTQLETRTHHLENSVDDLKVSVGNNHGS  190

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGS  610
            TD KL+ LE  L+EV   VQ ++DKQ++  AQ +LAKLQ+++ +  S
Sbjct  191  TDGKLRQLENILREVQSGVQTIKDKQDIVQAQLQLAKLQVSKTDQQS  237



>gb|KHN27460.1| hypothetical protein glysoja_022169 [Glycine soja]
Length=573

 Score = 95.1 bits (235),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F+  ++  ++++MKK+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + ++HG 
Sbjct  131  SAFDATMLSEIDRTMKKHMENMLHVLEGVSARLTQLETRTHHLENSVDDLKVSVGNNHGS  190

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGS  610
            TD KL+ LE  L+EV   VQ ++DKQ++  AQ +LAKLQ+++ +  S
Sbjct  191  TDGKLRQLENILREVQSGVQTIKDKQDIVQAQLQLAKLQVSKTDQQS  237



>ref|XP_010906083.1| PREDICTED: protein transport protein SEC31 [Elaeis guineensis]
Length=541

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%), Gaps = 3/97 (3%)
 Frame = +2

Query  311  IDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKS  490
            ID +   +KKYADNL+  LEG+ SRLSQLE     L+  + E++  + ++HG TD KL+ 
Sbjct  111  IDCI---VKKYADNLLHALEGVGSRLSQLESRTRYLEGCVDELKVSVGNNHGSTDGKLRQ  167

Query  491  LEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            LE  L+EV   VQ+LRDKQ++A+AQ +LAKLQ ++ E
Sbjct  168  LENILREVQTGVQVLRDKQDIAEAQLQLAKLQASKRE  204



>ref|XP_004232320.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Solanum lycopersicum]
Length=545

 Score = 94.4 bits (233),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +2

Query  320  VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEK  499
            ++ ++KKYADNL+  +EG+S+RLSQLE     +D SI E++  + ++HG TD KL+ LE 
Sbjct  124  IDHTVKKYADNLLHAVEGVSARLSQLETRNRQIDNSIDELKLSVGNNHGVTDGKLRQLEN  183

Query  500  HLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             L+EV   VQ++RDKQE+ DAQ +L K Q  + E
Sbjct  184  ILREVQDGVQVIRDKQEIMDAQLQLMKSQAPKIE  217



>gb|KDP45326.1| hypothetical protein JCGZ_09575 [Jatropha curcas]
Length=579

 Score = 94.4 bits (233),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 75/98 (77%), Gaps = 0/98 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++K+MKK+AD+L+  +EG+S+RL+QLE    NL+ S+ +++  + +++G TD K++
Sbjct  136  IVMEIDKTMKKHADSLLHIMEGVSARLTQLESRTRNLENSVDDLKLSVGNNNGSTDGKMR  195

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             LE  L+EVH  VQ+L++KQE+ +A+ +LAKLQ+++ +
Sbjct  196  QLENILREVHSGVQVLKEKQEVVEAELQLAKLQVSKAD  233



>emb|CDP02078.1| unnamed protein product [Coffea canephora]
Length=551

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 74/106 (70%), Gaps = 5/106 (5%)
 Frame = +2

Query  299  NQDVIDA-----VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            +Q+V+D      ++++MKKYADNLM  L+ +S+RL+QLE    +L+ S+ E++  +  +H
Sbjct  106  DQNVVDPKLVSEIDRTMKKYADNLMHGLDSVSARLTQLESRTRHLENSLDELKVSVGTNH  165

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            G +D +++ LE  L+EV   VQ +RDKQE+ DAQ  LAKL++++ E
Sbjct  166  GSSDGRMRQLENILREVQNGVQFIRDKQEILDAQLHLAKLEVSKAE  211



>ref|XP_009782100.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Nicotiana sylvestris]
Length=545

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = +2

Query  320  VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEK  499
            ++ ++KKYADNL+  +EG+S+RLSQLE     +D S+ E++  + ++HG TD KL+ LE 
Sbjct  116  IDHTVKKYADNLLHAMEGVSARLSQLETRSRQIDNSVDELKLSVGNNHGVTDGKLRQLEN  175

Query  500  HLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             L++V   VQ++RDKQE+ DAQ +L K Q  + E
Sbjct  176  ILRQVQDGVQVIRDKQEIMDAQLQLMKSQAPKVE  209



>ref|XP_010908580.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Elaeis guineensis]
Length=523

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 69/101 (68%), Gaps = 0/101 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+++   +  ++ ++KKYADNL+  LEG+SSRL+QLE   ++L+ S+ E++    +  
Sbjct  104  EKSAYDAATVAEIDHTVKKYADNLLHTLEGVSSRLTQLESRTHHLESSVDELKVTTGNSS  163

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
            G TD KL+ LE  L+ V   VQ+LRDKQE+ +AQ +LA LQ
Sbjct  164  GTTDGKLRQLENILRGVQTCVQVLRDKQEIVEAQLQLANLQ  204



>ref|XP_010492262.1| PREDICTED: basic salivary proline-rich protein 2-like [Camelina 
sativa]
Length=547

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++ A++++MK +ADNL+  +EG+S+RL+QLE    NL+  + +++  + + HG TD KL+
Sbjct  127  ILSAIDRTMKAHADNLIHVIEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGTTDGKLR  186

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
             LE  + EV   VQ+L+DKQ++ +AQ +L+KLQL++
Sbjct  187  QLENIMLEVQSGVQMLKDKQDIVEAQLQLSKLQLSK  222



>ref|XP_006338590.1| PREDICTED: AT-rich interactive domain-containing protein 1A-like 
[Solanum tuberosum]
Length=549

 Score = 92.8 bits (229),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 67/98 (68%), Gaps = 0/98 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++ ++KKYADNL+  +EG+S+RLSQLE     +D S+ E++  + + HG TD KL+
Sbjct  120  LLSEIDHTVKKYADNLLHAVEGVSARLSQLETRNRQIDNSVDELKLSVGNSHGVTDGKLR  179

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             LE  L+EV   VQ++RDKQE+ DAQ +L K Q  + E
Sbjct  180  QLENILREVQDGVQVIRDKQEIMDAQLQLMKSQAPKIE  217



>gb|EYU44780.1| hypothetical protein MIMGU_mgv1a004985mg [Erythranthe guttata]
Length=501

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 70/101 (69%), Gaps = 0/101 (0%)
 Frame = +2

Query  281  PEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  460
            P ++S +  ++  ++K+MKKY DNL   ++ +S+RLSQLE    NL+ SI +++  + ++
Sbjct  66   PSNASLDASLVSEIDKTMKKYMDNLTHAVDNMSARLSQLETRTRNLEHSIDDLKVSVGNN  125

Query  461  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKL  583
            HG TD K++ LE  L EV   V+++RDKQE+ +AQ ++AK+
Sbjct  126  HGITDGKMRLLENILNEVQAGVELIRDKQEVVEAQVQIAKM  166



>emb|CAB87621.1| putative protein [Arabidopsis thaliana]
Length=530

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            +I A++++MK +AD L+  +EG+S+RL+QLE    +L+  + +++  + + HG+TD KL+
Sbjct  109  IISAIDRTMKAHADKLLHVMEGVSARLTQLETRTRDLENLVDDVKVSVGNSHGKTDGKLR  168

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQL++
Sbjct  169  QLENIMLEVQNGVQLLKDKQEIVEAQLQLSKLQLSK  204



>ref|XP_009388841.1| PREDICTED: bromodomain-containing protein 4 [Musa acuminata subsp. 
malaccensis]
Length=538

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+ +   +  ++ ++K+YADNLM  LEGLSSRLS++E   ++++ S+ E++  + +++
Sbjct  122  EKSAHDIAFVAEIDHTVKRYADNLMNALEGLSSRLSKIESRTHHMENSVDELKVAIENNN  181

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKL  583
            G T+ KLK +E  L+EVH SVQIL+DKQ++ +AQ  LA+L
Sbjct  182  GSTNGKLKQIENVLKEVHSSVQILQDKQQVTEAQLHLAQL  221



>ref|XP_011464066.1| PREDICTED: formin-like protein 3 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=550

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            VI  ++++MKKYADNL++ +EG+S+RL+QLE    +L+ S+ +++  + ++HG  D K++
Sbjct  112  VISEIDQTMKKYADNLLQVMEGISARLTQLESRTCHLENSVDDLKVSVGNNHGNADGKMR  171

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             LE  L++V   VQ L+DKQ + +AQ +L K+Q++
Sbjct  172  QLENILRDVQTGVQDLKDKQSIVEAQLQLGKIQIS  206



>ref|XP_004299014.1| PREDICTED: formin-like protein 3 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=561

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            VI  ++++MKKYADNL++ +EG+S+RL+QLE    +L+ S+ +++  + ++HG  D K++
Sbjct  123  VISEIDQTMKKYADNLLQVMEGISARLTQLESRTCHLENSVDDLKVSVGNNHGNADGKMR  182

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             LE  L++V   VQ L+DKQ + +AQ +L K+Q++
Sbjct  183  QLENILRDVQTGVQDLKDKQSIVEAQLQLGKIQIS  217



>ref|XP_009611188.1| PREDICTED: transcriptional regulator DEF1 isoform X2 [Nicotiana 
tomentosiformis]
Length=545

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +2

Query  320  VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEK  499
            ++ ++KKYADNL+  +EG+S+RLSQLE     +D S+ E++  + ++HG TD KL+ LE 
Sbjct  116  IDHTVKKYADNLLHAMEGVSARLSQLETRSRQIDNSVDELKLSVGNNHGVTDGKLRQLEN  175

Query  500  HLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             L++V   VQ++RDKQE+ D Q +L K Q  + E
Sbjct  176  ILRQVQDGVQVIRDKQEIMDVQLQLMKSQAPKVE  209



>ref|NP_196958.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAH20220.1| AT5G14540 [Arabidopsis thaliana]
 gb|AED92045.1| uncharacterized protein AT5G14540 [Arabidopsis thaliana]
Length=547

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            +I A++++MK +AD L+  +EG+S+RL+QLE    +L+  + +++  + + HG+TD KL+
Sbjct  126  IISAIDRTMKAHADKLLHVMEGVSARLTQLETRTRDLENLVDDVKVSVGNSHGKTDGKLR  185

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQL++
Sbjct  186  QLENIMLEVQNGVQLLKDKQEIVEAQLQLSKLQLSK  221



>ref|XP_009611187.1| PREDICTED: transcriptional regulator DEF1 isoform X1 [Nicotiana 
tomentosiformis]
Length=551

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +2

Query  320  VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEK  499
            ++ ++KKYADNL+  +EG+S+RLSQLE     +D S+ E++  + ++HG TD KL+ LE 
Sbjct  122  IDHTVKKYADNLLHAMEGVSARLSQLETRSRQIDNSVDELKLSVGNNHGVTDGKLRQLEN  181

Query  500  HLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             L++V   VQ++RDKQE+ D Q +L K Q  + E
Sbjct  182  ILRQVQDGVQVIRDKQEIMDVQLQLMKSQAPKVE  215



>ref|XP_009403230.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 [Musa acuminata subsp. malaccensis]
Length=550

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/114 (39%), Positives = 78/114 (68%), Gaps = 0/114 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E S+++  ++  ++ ++K+YADNLM  LEG++SRL QLE   ++L+ S+ E++  + +++
Sbjct  122  EKSTYDVAMVAEIDTTVKRYADNLMNALEGVNSRLLQLENRTHHLENSVDELKVAIGNNN  181

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNSQ  625
            G TD +L+  +  L+EV   VQILRDKQ++ +AQ  LA+L+ ++ E     NS+
Sbjct  182  GSTDGRLRQFDNILREVQSGVQILRDKQDIVEAQLHLAQLKASKGEQQQQQNSK  235



>ref|XP_006603779.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
isoform X2 [Glycine max]
Length=466

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            + S+F+  ++  +++++KK+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + + H
Sbjct  22   DQSAFDATMLSEIDRTVKKHMENMLHVLEGVSARLTQLETRTHHLENSVDDLKVSVGNSH  81

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGS  610
            G TD KL+ +E  L+EV   VQ ++DKQ++  AQ +LAKL++++ +  S
Sbjct  82   GSTDGKLRQMENSLREVQSGVQTIKDKQDIVQAQLQLAKLEVSKTDPQS  130



>gb|KJB75894.1| hypothetical protein B456_012G063600 [Gossypium raimondii]
Length=622

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 75/109 (69%), Gaps = 0/109 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            + S+F+  ++  ++++MKK+ DNLM  +E +S RL+QLE    +L+ S+ +++  +V++H
Sbjct  193  DQSAFDTSILAEIDQTMKKHTDNLMHMMEKVSDRLTQLESRTRHLENSLDDLKVSVVNNH  252

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGS  610
            G TD K+K LE  L EV   V  L++KQE+ +AQ +LAKLQ+++ +  S
Sbjct  253  GSTDRKMKQLENILTEVQTGVHDLKEKQEIMEAQLQLAKLQVSKVDQPS  301



>ref|XP_010910341.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 isoform X1 [Elaeis guineensis]
Length=535

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 73/102 (72%), Gaps = 4/102 (4%)
 Frame = +2

Query  305  DVIDAVE--KSMKKYADNLMRFLEGLSSRLSQLE-LYCYNLDKSIGEMRSDLVHDHGETD  475
            DV   VE  +++KKYADNL+  LEG+SSRLSQLE   CY L  S+ E++  + ++H  T+
Sbjct  105  DVARVVEIDRAVKKYADNLLHALEGVSSRLSQLESRTCY-LGSSVDELKVSVGNNHRSTN  163

Query  476  SKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             +L+ +E  L+EV   VQ+LRD+Q++A+AQ +LAKLQ ++ E
Sbjct  164  GRLRQIENILREVQTGVQVLRDEQDIAEAQLQLAKLQASKGE  205



>ref|XP_003554822.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
isoform X1 [Glycine max]
 gb|KHN19672.1| hypothetical protein glysoja_037174 [Glycine soja]
Length=578

 Score = 91.3 bits (225),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 77/109 (71%), Gaps = 0/109 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            + S+F+  ++  +++++KK+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + + H
Sbjct  134  DQSAFDATMLSEIDRTVKKHMENMLHVLEGVSARLTQLETRTHHLENSVDDLKVSVGNSH  193

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGS  610
            G TD KL+ +E  L+EV   VQ ++DKQ++  AQ +LAKL++++ +  S
Sbjct  194  GSTDGKLRQMENSLREVQSGVQTIKDKQDIVQAQLQLAKLEVSKTDPQS  242



>ref|XP_010910342.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like 
protein 2 isoform X2 [Elaeis guineensis]
Length=533

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 73/102 (72%), Gaps = 4/102 (4%)
 Frame = +2

Query  305  DVIDAVE--KSMKKYADNLMRFLEGLSSRLSQLE-LYCYNLDKSIGEMRSDLVHDHGETD  475
            DV   VE  +++KKYADNL+  LEG+SSRLSQLE   CY L  S+ E++  + ++H  T+
Sbjct  103  DVARVVEIDRAVKKYADNLLHALEGVSSRLSQLESRTCY-LGSSVDELKVSVGNNHRSTN  161

Query  476  SKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             +L+ +E  L+EV   VQ+LRD+Q++A+AQ +LAKLQ ++ E
Sbjct  162  GRLRQIENILREVQTGVQVLRDEQDIAEAQLQLAKLQASKGE  203



>ref|XP_008379205.1| PREDICTED: protein enabled [Malus domestica]
Length=583

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +2

Query  299  NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDS  478
            N  ++  ++++MKK+ADNL+  LEG+S+RL+QLE    NL+ S+ +++  + ++HG TD 
Sbjct  142  NAAIVSEIDQTMKKHADNLLHMLEGVSARLTQLESRTRNLENSVDDLKISVGNNHGNTDG  201

Query  479  KLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             ++ LE  L++V   V+ ++DKQE+ +AQ  LA++Q++
Sbjct  202  TMRQLEGILRDVQTGVKDMKDKQEIVEAQLNLARIQMS  239



>ref|XP_006289230.1| hypothetical protein CARUB_v10002686mg [Capsella rubella]
 gb|EOA22128.1| hypothetical protein CARUB_v10002686mg [Capsella rubella]
Length=541

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++ A++++MK +ADNL+  +E +S+RL+QLE    NL+  + +++  + + HG TD KL+
Sbjct  123  ILSAIDRTMKAHADNLIHVIECVSARLTQLETRTRNLENLVDDVKVSVGNSHGTTDGKLR  182

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQL++
Sbjct  183  QLENIMLEVQSGVQLLKDKQEIVEAQLQLSKLQLSK  218



>ref|XP_007031556.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
 gb|EOY02482.1| Uncharacterized protein TCM_016944 [Theobroma cacao]
Length=541

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 71/102 (70%), Gaps = 0/102 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            ++F+  ++  ++++MKK+ DNL+  LE +S+RL+QLE    NL+ S+ +++  + ++HG 
Sbjct  110  NAFDTSIVAEIDRTMKKHTDNLIHMLEVVSARLTQLESRTRNLENSVDDLKVSVGNNHGS  169

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            T+ K++ LE  L EV   V +L++KQE+ +AQ  LAKLQ+ +
Sbjct  170  TEGKMRQLENILNEVQTGVHVLKEKQEIMEAQLHLAKLQVTK  211



>ref|XP_008365379.1| PREDICTED: protein enabled-like [Malus domestica]
Length=583

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +2

Query  299  NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDS  478
            N  ++  ++++MKK+ADNL+  LEG+S+RL+QLE    NL+ S+ +++  + ++HG TD 
Sbjct  142  NAAIVSEIDQTMKKHADNLLHMLEGVSARLTQLESRTRNLENSVDDLKISVGNNHGNTDG  201

Query  479  KLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             ++ LE  L++V   V+ ++DKQE+ +AQ  LA++Q++
Sbjct  202  TMRQLEGILRDVQTGVKDMKDKQEIVEAQLNLARIQMS  239



>ref|XP_011098435.1| PREDICTED: protein diaphanous homolog 1-like [Sesamum indicum]
Length=564

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 74/114 (65%), Gaps = 0/114 (0%)
 Frame = +2

Query  281  PEDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHD  460
            P +   +  ++  ++K+MKKY +NLM  ++ +S+RLSQLE    +L+ SI +++  +  +
Sbjct  123  PSNVPLDVSLVSEIDKTMKKYMENLMHEVDKMSARLSQLETRTRSLENSIDDLKVSVGSN  182

Query  461  HGETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
             G TD K++ LE  L+EV   VQ++RDKQE+ +AQ  +AKLQ+ + E   + N+
Sbjct  183  CGSTDGKMRLLENILREVQTGVQVIRDKQEIVEAQLHIAKLQVPKVEQVDSKNT  236



>ref|XP_010037529.1| PREDICTED: vegetative cell wall protein gp1-like [Eucalyptus 
grandis]
 gb|KCW49241.1| hypothetical protein EUGRSUZ_K02812 [Eucalyptus grandis]
Length=553

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 72/107 (67%), Gaps = 0/107 (0%)
 Frame = +2

Query  284  EDSSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            E  SFN+ +I  +E+ M ++ D ++  +EG+S+RLSQLE     L+ ++ +M+  L ++H
Sbjct  62   ERVSFNETLISLIERKMTEHNDTVLHAVEGVSARLSQLETRTRRLENAVDDMKESLEYNH  121

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXES  604
            G+TD KL+ LE  L+EV    + LRDK+++A AQ ++ KLQ+ + E+
Sbjct  122  GKTDGKLRELENLLREVQSCTRDLRDKEDIAQAQLQILKLQIRKNEA  168



>ref|XP_010420094.1| PREDICTED: protein transport protein sec31-like [Camelina sativa]
Length=545

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++ A++ +MK +ADNL+  +EG+S+RL+QLE    NL+  + +++  + + HG TD KL+
Sbjct  126  ILSAIDLTMKAHADNLIHVIEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGITDGKLR  185

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
             LE  + EV   VQ+L+DKQ++ +AQ +L+KLQL++
Sbjct  186  QLENIMLEVQSGVQMLKDKQDIVEAQLQLSKLQLSK  221



>ref|XP_009125983.1| PREDICTED: WW domain-binding protein 11 isoform X1 [Brassica 
rapa]
Length=537

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  +++ MKK+AD+LM  +EG+S+RL+QLE    NL+  + +++  + + HG TD K++
Sbjct  120  ILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKMR  179

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQ+++ +
Sbjct  180  QLENIMLEVQSGVQLLKDKQEILEAQLQLSKLQVSKVD  217



>ref|XP_002524656.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF37675.1| DNA binding protein, putative [Ricinus communis]
Length=568

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F+  ++  ++K+MKK+ DNL+  LEG+S+RL+QLE+    L+ S+ E++  + ++HG 
Sbjct  144  SAFDAAIVSEIDKTMKKHTDNLLHLLEGVSARLTQLEIRSRCLENSVDELKVSIGNNHGN  203

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQL  589
            TD K++ +EK L ++    ++L+DK E+ +AQ +LA LQ+
Sbjct  204  TDGKIEQVEKVLLKLQAGFEVLKDKHEIFEAQLKLAGLQV  243



>ref|XP_009125985.1| PREDICTED: WW domain-binding protein 11 isoform X2 [Brassica 
rapa]
Length=536

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  +++ MKK+AD+LM  +EG+S+RL+QLE    NL+  + +++  + + HG TD K++
Sbjct  119  ILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKMR  178

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQ+++ +
Sbjct  179  QLENIMLEVQSGVQLLKDKQEILEAQLQLSKLQVSKVD  216



>emb|CDX85594.1| BnaA02g02190D [Brassica napus]
Length=487

 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  +++ MKK+AD+LM  +EG+S+RL+QLE    NL+  + +++  + + HG TD K++
Sbjct  119  ILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKMR  178

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQ+++ +
Sbjct  179  QLENIMLEVQSGVQLLKDKQEILEAQLQLSKLQVSKVD  216



>ref|XP_009334114.1| PREDICTED: arginine-glutamic acid dipeptide repeats protein [Pyrus 
x bretschneideri]
Length=583

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +2

Query  299  NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDS  478
            N  ++  ++++MKK+ DNL+  LEG+S+RL+QLE    NL+ S+ +++  + ++HG  D 
Sbjct  142  NAAIVSEIDQTMKKHTDNLLHVLEGVSARLTQLESRTRNLENSVDDLKISVGNNHGNADG  201

Query  479  KLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            K++ LE  L++V   V+ ++DKQE+ +AQ  LA++QL+
Sbjct  202  KMRQLEGILRDVQTGVKDMKDKQEIVEAQLNLARIQLS  239



>emb|CDX91045.1| BnaC02g05520D [Brassica napus]
Length=486

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  +++ MKK+AD+LM  +EG+S+RL+QLE    NL+  + +++  + + HG TD K++
Sbjct  118  ILSEIDRVMKKHADDLMNVMEGVSARLTQLESRTRNLENLVDDVKVSVGNSHGNTDGKMR  177

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             LE  + EV   VQ+L+DKQE+ +AQ +L+KLQ+ + +
Sbjct  178  QLENIMLEVQSGVQLLKDKQEILEAQLQLSKLQVPKVD  215



>ref|XP_010453577.1| PREDICTED: basic salivary proline-rich protein 2-like [Camelina 
sativa]
Length=547

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 68/96 (71%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++ A++++MK +ADNL+  +EG+S+RL+QLE    NL+  + +++  + + HG TD KL+
Sbjct  127  ILSAIDRTMKAHADNLIHVIEGVSARLTQLETRTRNLENLVDDVKVSVGNSHGTTDGKLR  186

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
             LE  + EV   VQ+L+DKQ++ +AQ +L+KL  ++
Sbjct  187  QLENIMLEVESGVQMLKDKQDIVEAQLQLSKLHFSK  222



>gb|KHG02060.1| Myosin-2 [Gossypium arboreum]
Length=542

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+F+  ++  ++++MKK+ DNLM  +E +S RL+QLE    +L+ S+ +++  + ++HG 
Sbjct  116  SAFDTSILAEIDRTMKKHTDNLMHMMEKVSDRLTQLESRTRHLENSLDDLKVSVGNNHGS  175

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGS  610
            TD K+K LE  L EV   V  L++KQE+ +AQ +LAKL++++ E  S
Sbjct  176  TDRKMKQLENILTEVQTGVHDLKEKQEIMEAQLQLAKLEVSKVEQPS  222



>gb|KDO55180.1| hypothetical protein CISIN_1g0084162mg, partial [Citrus sinensis]
Length=462

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++++MKKYADNL+  LEG+S+RL+QL+    NL+ S+ +++  +  +H  TD K++
Sbjct  23   IVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTDGKMR  82

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
             +E  L+EV   V +L+DKQE+ +AQ +  KLQ
Sbjct  83   QVENILREVQSGVLVLKDKQEMLEAQMQHGKLQ  115



>ref|XP_004489226.1| PREDICTED: vacuolar protein sorting-associated protein 27-like 
[Cicer arietinum]
Length=550

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++++MK++ DNL   LEG+S+RL+QLE   ++L+ S+ +++  + ++HG TD KL+
Sbjct  113  ILLEIDRTMKRHMDNLHHVLEGVSARLTQLETRTHHLESSMDDLKVSVGNNHGITDGKLR  172

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGS  610
             LE  LQEV   VQ ++DKQ++  AQ +LAKLQ+++ +  S
Sbjct  173  LLENILQEVQTGVQDIKDKQDIVQAQLQLAKLQVSKTDQQS  213



>ref|XP_008393001.1| PREDICTED: putative uncharacterized protein DDB_G0291608 [Malus 
domestica]
Length=525

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 68/105 (65%), Gaps = 0/105 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            +I  +E+ M ++  NL+  +EGLS+R+SQLE     L+ S+G+++     +HG+ D KL+
Sbjct  91   LISVIERKMDEHFGNLLHGVEGLSARISQLETRLRRLENSVGDLKDSTEINHGKADGKLR  150

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
             LE  L+EV   +Q LRDKQE+ +AQ ELAKLQ+ +    S N +
Sbjct  151  QLENMLREVDXGMQDLRDKQEITEAQLELAKLQMLKGYQQSENQT  195



>gb|KDO55178.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=564

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++++MKKYADNL+  LEG+S+RL+QL+    NL+ S+ +++  +  +H  TD K++
Sbjct  125  IVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTDGKMR  184

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
             +E  L+EV   V +L+DKQE+ +AQ +  KLQ
Sbjct  185  QVENILREVQSGVLVLKDKQEMLEAQMQHGKLQ  217



>gb|KDO55179.1| hypothetical protein CISIN_1g0084162mg [Citrus sinensis]
Length=566

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++++MKKYADNL+  LEG+S+RL+QL+    NL+ S+ +++  +  +H  TD K++
Sbjct  127  IVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTDGKMR  186

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
             +E  L+EV   V +L+DKQE+ +AQ +  KLQ
Sbjct  187  QVENILREVQSGVLVLKDKQEMLEAQMQHGKLQ  219



>ref|XP_006470271.1| PREDICTED: COPII coat assembly protein sec16-like [Citrus sinensis]
Length=574

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++++MKKYADNL+  LEG+S+RL+QL+    NL+ S+ +++  +  +H  TD K++
Sbjct  127  IVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTDGKMR  186

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
             +E  L+EV   V +L+DKQE+ +AQ +  KLQ
Sbjct  187  QVENILREVQSGVLVLKDKQEMLEAQMQHGKLQ  219



>gb|KFK37621.1| hypothetical protein AALP_AA3G007100 [Arabis alpina]
Length=508

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            +I  +++++KK+ D L+  +EG+S+RL+QLE   +NL+  + +++  + + HG +D K++
Sbjct  117  IISEIDRTVKKHVDTLLHVMEGVSARLTQLETRTHNLENLVDDLKVSVENSHGSSDGKMR  176

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
             L+  L EV   VQ+L+DKQE+ +AQ +L+KLQ+++
Sbjct  177  RLQNILVEVQSGVQVLKDKQEIIEAQIQLSKLQVSK  212



>emb|CBI14977.3| unnamed protein product [Vitis vinifera]
Length=400

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            +S++  +I  V+K MK++ D  +  ++ L +RLSQLE    N++  + E+++   ++HG 
Sbjct  16   TSYDGALISVVDKKMKEHTDTFLHVVDALITRLSQLESRTRNIESYVDELKASTEYNHGR  75

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            T+ KLK LE  L+EV   +  LRDKQE+ +AQ +LAKLQ+++
Sbjct  76   TNGKLKQLENTLREVQGGIHDLRDKQEIVEAQLQLAKLQVSK  117



>ref|XP_006446566.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
 gb|ESR59806.1| hypothetical protein CICLE_v10014743mg [Citrus clementina]
Length=574

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++++MKKYADNL+  LEG+S+RL+QL+    NL+ S+ +++  +  +H  TD K++
Sbjct  127  IVSDIDQTMKKYADNLLHVLEGVSARLTQLDARTRNLESSVDDLKVSVGSNHASTDGKMR  186

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
             +E  L+EV   + +L+DKQE+ +AQ +  KLQ
Sbjct  187  QVENILREVQSGILVLKDKQEMLEAQMQHGKLQ  219



>ref|XP_010663116.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663117.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663118.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
 ref|XP_010663119.1| PREDICTED: vegetative cell wall protein gp1-like isoform X2 [Vitis 
vinifera]
Length=469

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            +S++  +I  V+K MK++ D  +  ++ L +RLSQLE    N++  + E+++   ++HG 
Sbjct  16   TSYDGALISVVDKKMKEHTDTFLHVVDALITRLSQLESRTRNIESYVDELKASTEYNHGR  75

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            T+ KLK LE  L+EV   +  LRDKQE+ +AQ +LAKLQ+++
Sbjct  76   TNGKLKQLENTLREVQGGIHDLRDKQEIVEAQLQLAKLQVSK  117



>ref|XP_010663115.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 isoform 
X1 [Vitis vinifera]
Length=524

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 68/102 (67%), Gaps = 0/102 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            +S++  +I  V+K MK++ D  +  ++ L +RLSQLE    N++  + E+++   ++HG 
Sbjct  71   TSYDGALISVVDKKMKEHTDTFLHVVDALITRLSQLESRTRNIESYVDELKASTEYNHGR  130

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            T+ KLK LE  L+EV   +  LRDKQE+ +AQ +LAKLQ+++
Sbjct  131  TNGKLKQLENTLREVQGGIHDLRDKQEIVEAQLQLAKLQVSK  172



>gb|KEH24794.1| DNA-binding protein, putative [Medicago truncatula]
Length=565

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 71/104 (68%), Gaps = 5/104 (5%)
 Frame = +2

Query  299  NQDVIDA-----VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDH  463
            NQ  +DA     ++++MKK+ DNL   LEG+S+RL+Q+E   ++L+ S+ +++  + ++H
Sbjct  118  NQSAVDASILLEIDRTMKKHMDNLHHVLEGVSARLTQVETRTHHLESSMDDLKVSVGNNH  177

Query  464  GETDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQ  595
            G TD KL+ LE  L EV   V  ++DKQ++  AQ +LAKLQ+++
Sbjct  178  GITDGKLRLLENILSEVQTGVHDIKDKQDIMQAQLQLAKLQVSK  221



>ref|XP_008230557.1| PREDICTED: protein transport protein SEC31 [Prunus mume]
Length=581

 Score = 86.3 bits (212),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V+  ++++MKK+ADNL+  LEG+S+RL+QLE    +L+ S+ +++  + ++HG  D K++
Sbjct  137  VVSEIDQAMKKHADNLLHVLEGVSARLTQLESRTRHLENSVDDLKVSVGNNHGNADGKMR  196

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             LE  L++V   V+ L+DKQ++ +AQ  LA++Q++
Sbjct  197  RLEDILRDVQTGVKDLKDKQDIVEAQLHLARIQVS  231



>ref|XP_006341319.1| PREDICTED: trithorax group protein osa-like [Solanum tuberosum]
Length=526

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 71/104 (68%), Gaps = 0/104 (0%)
 Frame = +2

Query  290  SSFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGE  469
            S+ +  ++  ++ ++KKYADNL+  +E +S+RLSQLE   + ++  + E++  + ++HG 
Sbjct  95   STIDASLLSEIDHTVKKYADNLLHAIESVSARLSQLETRSHQIEAFVVELKLSVDNNHGN  154

Query  470  TDSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            TD KL+ +E  L+EV   VQ++++KQ++ D Q +L KLQ+ + E
Sbjct  155  TDGKLRLVENILREVQDGVQVIKNKQDIMDTQLQLTKLQVPKFE  198



>gb|KJB40754.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=566

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +2

Query  293  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  472
             F+  ++ A++++MKK+ DNLM  LEG+  RL+QLE    NL+ S+ +++  + ++HG  
Sbjct  107  GFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLESRTSNLETSVDDLKMSVGNNHGSI  166

Query  473  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
            D K++ LE  L+EV   V ++++KQE  +A  + AKLQ
Sbjct  167  DGKMRQLENILKEVQTEVHVVKEKQESVEALLQHAKLQ  204



>gb|KJB40753.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=565

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +2

Query  293  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  472
             F+  ++ A++++MKK+ DNLM  LEG+  RL+QLE    NL+ S+ +++  + ++HG  
Sbjct  106  GFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLESRTSNLETSVDDLKMSVGNNHGSI  165

Query  473  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
            D K++ LE  L+EV   V ++++KQE  +A  + AKLQ
Sbjct  166  DGKMRQLENILKEVQTEVHVVKEKQESVEALLQHAKLQ  203



>gb|KJB40752.1| hypothetical protein B456_007G076000 [Gossypium raimondii]
Length=519

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 65/98 (66%), Gaps = 0/98 (0%)
 Frame = +2

Query  293  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  472
             F+  ++ A++++MKK+ DNLM  LEG+  RL+QLE    NL+ S+ +++  + ++HG  
Sbjct  60   GFDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLESRTSNLETSVDDLKMSVGNNHGSI  119

Query  473  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
            D K++ LE  L+EV   V ++++KQE  +A  + AKLQ
Sbjct  120  DGKMRQLENILKEVQTEVHVVKEKQESVEALLQHAKLQ  157



>tpg|DAA58177.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=154

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +2

Query  278  PPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  451
            PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD+
Sbjct  49   PPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDV  108

Query  452  VHDHGETDSKLKSLEKHLQEVHRSV  526
            +  H E+ +  + ++K+L +V   V
Sbjct  109  MDYHSESTTNFRCIDKNLGQVRPRV  133



>tpg|DAA58176.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=157

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +2

Query  278  PPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  451
            PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD+
Sbjct  52   PPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDV  111

Query  452  VHDHGETDSKLKSLEKHLQEVHRSV  526
            +  H E+ +  + ++K+L +V   V
Sbjct  112  MDYHSESTTNFRCIDKNLGQVRPRV  136



>gb|ACN28687.1| unknown [Zea mays]
 tpg|DAA58179.1| TPA: putative DUF1421 domain family protein [Zea mays]
Length=118

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
 Frame = +2

Query  278  PPEDSSF--NQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDL  451
            PP    F   + V+ AVE+ M+K AD L+  L+G+  RLSQLELYCY L++SIGE+RSD+
Sbjct  13   PPHQDGFYPKEAVMAAVEECMRKQADALLHSLDGIGGRLSQLELYCYKLERSIGELRSDV  72

Query  452  VHDHGETDSKLKSLEKHLQEVHRSV  526
            +  H E+ +  + ++K+L +V   V
Sbjct  73   MDYHSESTTNFRCIDKNLGQVRPRV  97



>ref|XP_007217219.1| hypothetical protein PRUPE_ppa003425mg [Prunus persica]
 gb|EMJ18418.1| hypothetical protein PRUPE_ppa003425mg [Prunus persica]
Length=575

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            V+  ++++MKK+ADNL+  LEG+S+RL+QLE    +L+ S+ +++  + ++HG  D K+ 
Sbjct  137  VVSEIDQAMKKHADNLLHVLEGVSARLTQLESRTRHLENSVDDLKVSVGNNHGNADGKMI  196

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             LE  L++V   V+ L+DKQ++ +AQ  LA++Q++
Sbjct  197  RLEDILRDVQTGVKDLKDKQDIVEAQLHLARIQVS  231



>ref|XP_007150938.1| hypothetical protein PHAVU_004G007500g [Phaseolus vulgaris]
 gb|ESW22932.1| hypothetical protein PHAVU_004G007500g [Phaseolus vulgaris]
Length=575

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  320  VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEK  499
            ++++M+K+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + ++HG TD KL+ LE 
Sbjct  137  IDRTMQKHMENMLNVLEGVSARLTQLETRTHHLENSVDDLKVSVGNNHGITDGKLRQLEN  196

Query  500  HLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             L+EV   V  ++DKQ++  AQ + AKLQ++
Sbjct  197  ILREVQSGVLTIKDKQDIMQAQLQFAKLQMS  227



>gb|ACZ74657.1| hypothetical protein [Phaseolus vulgaris]
Length=574

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +2

Query  320  VEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLKSLEK  499
            ++++M+K+ +N++  LEG+S+RL+QLE   ++L+ S+ +++  + ++HG TD KL+ LE 
Sbjct  136  IDRTMQKHMENMLNVLEGVSARLTQLETRTHHLENSVDDLKVSVGNNHGITDGKLRQLEN  195

Query  500  HLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             L+EV   V  ++DKQ++  AQ + AKLQ++
Sbjct  196  ILREVQSGVLTIKDKQDIMQAQLQFAKLQMS  226



>ref|XP_009362961.1| PREDICTED: histone acetyltransferase KAT6A-like isoform X2 [Pyrus 
x bretschneideri]
Length=356

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            +I  +E+ M  +  NL+  +EGLS+R+SQLE     L  S+ + +     +HG+ D KL+
Sbjct  80   LISVIERKMDDHFGNLLHAVEGLSARISQLETRLCRLQNSVDDFKDSTEINHGKADGKLR  139

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
             LE  L+EV   +Q LRDKQE+ +A+ ELAKLQ+ +    S N +
Sbjct  140  QLENMLREVDGGMQDLRDKQEITEARLELAKLQMLKGHQQSENQT  184



>ref|XP_008219121.1| PREDICTED: uncharacterized protein LOC103319367 [Prunus mume]
Length=1861

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 67/95 (71%), Gaps = 0/95 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++++MKK+ D+L+  LEG+S +L+QLE    +L+ S+ +++  + ++HG TD K++
Sbjct  128  IVSEIDRTMKKHVDSLLHVLEGVSEKLTQLESRTRHLENSVDDLKISVGNNHGNTDGKMR  187

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
             LE  L++V   +Q+L+DKQ + +AQ +L K Q++
Sbjct  188  QLENVLRDVQTGIQVLKDKQAIVEAQLQLGKTQVS  222



>ref|XP_009362960.1| PREDICTED: uncharacterized protein LOC103952977 isoform X1 [Pyrus 
x bretschneideri]
Length=440

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            +I  +E+ M  +  NL+  +EGLS+R+SQLE     L  S+ + +     +HG+ D KL+
Sbjct  164  LISVIERKMDDHFGNLLHAVEGLSARISQLETRLCRLQNSVDDFKDSTEINHGKADGKLR  223

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXESGSANNS  622
             LE  L+EV   +Q LRDKQE+ +A+ ELAKLQ+ +    S N +
Sbjct  224  QLENMLREVDGGMQDLRDKQEITEARLELAKLQMLKGHQQSENQT  268



>ref|NP_186805.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE73688.1| uncharacterized protein AT3G01560 [Arabidopsis thaliana]
Length=511

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = +2

Query  296  FNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  472
            FN  ++ + ++++MKK+ D L+  +EG+S+RLSQLE   +NL+  + +++  + + HG T
Sbjct  125  FNTTIMSEIIDRTMKKHTDTLLHVMEGVSARLSQLETRTHNLENLVDDLKVSVDNSHGST  184

Query  473  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            D K++ L+  L EV   VQ+L+DKQE+ +AQ  L+K Q++
Sbjct  185  DGKMRQLKNILVEVQSGVQLLKDKQEILEAQ--LSKHQVS  222



>gb|AAF01541.1|AC009325_11 unknown protein [Arabidopsis thaliana]
Length=493

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 69/100 (69%), Gaps = 3/100 (3%)
 Frame = +2

Query  296  FNQDVI-DAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  472
            FN  ++ + ++++MKK+ D L+  +EG+S+RLSQLE   +NL+  + +++  + + HG T
Sbjct  107  FNTTIMSEIIDRTMKKHTDTLLHVMEGVSARLSQLETRTHNLENLVDDLKVSVDNSHGST  166

Query  473  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLA  592
            D K++ L+  L EV   VQ+L+DKQE+ +AQ  L+K Q++
Sbjct  167  DGKMRQLKNILVEVQSGVQLLKDKQEILEAQ--LSKHQVS  204



>gb|KHG20812.1| Actin cytoskeleton-regulatory complex PAN1 [Gossypium arboreum]
Length=566

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = +2

Query  296  FNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETD  475
            F+  ++ A++++MKK+ DNLM  LEG+  RL+QLE     L+ S+ +++  + ++HG  D
Sbjct  108  FDTSLVAAIDRTMKKHTDNLMHMLEGVGDRLTQLESRTSKLETSVDDLKMSVGNNHGSID  167

Query  476  SKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQ  586
             K++ LE  L+EV   V ++++KQE  +A  + AKLQ
Sbjct  168  GKMRQLENILKEVQTEVHVVKEKQESVEALLQHAKLQ  204



>ref|XP_007222918.1| hypothetical protein PRUPE_ppa003684mg [Prunus persica]
 gb|EMJ24117.1| hypothetical protein PRUPE_ppa003684mg [Prunus persica]
Length=556

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 66/98 (67%), Gaps = 0/98 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++++MKK+ ++L+  LEG+S +L+QLE    +L+ S+ +++  + ++HG TD K++
Sbjct  128  IVSEIDRTMKKHVNSLLHVLEGVSEKLTQLESRTCHLENSVEDLKISVGNNHGNTDGKMR  187

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             LE  L++V   +Q+L+DKQ + + Q +L K Q+   E
Sbjct  188  QLENVLRDVQTGIQVLKDKQAIVETQLQLGKTQVLNSE  225



>ref|XP_011047322.1| PREDICTED: vacuolar protein sorting-associated protein 37C [Populus 
euphratica]
Length=552

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            +I  ++++M K++DNL+  LEG+S+RL+QLE    +L+ S+ +++  + ++H  T   ++
Sbjct  132  IISEIDRTMNKFSDNLVHALEGVSARLTQLESRTRHLENSVDDLKLSVGNNHESTQGSMR  191

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             L   L+EV   VQ+L+DKQE+ ++Q +L KLQ+++ +
Sbjct  192  HLHNILREVQTGVQVLKDKQEMLESQLQLTKLQVSKAD  229



>ref|XP_006408524.1| hypothetical protein EUTSA_v10020517mg [Eutrema salsugineum]
 gb|ESQ49977.1| hypothetical protein EUTSA_v10020517mg [Eutrema salsugineum]
Length=519

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +2

Query  308  VIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGETDSKLK  487
            ++  ++++MKK+ D L+  +EG+S+RL+QLE   +NL+  + +++  + + HG TD K++
Sbjct  133  ILSDIDRTMKKHVDTLLHVMEGVSARLTQLETRTHNLENLVDDLKVSVENSHGSTDGKMR  192

Query  488  SLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
             LE  L EV   V+++++K E+ + Q +L+KLQ+++ +
Sbjct  193  QLENILAEVQSGVKLVKEKHEIFEDQLQLSKLQVSKVD  230



>gb|KCW54142.1| hypothetical protein EUGRSUZ_I00119 [Eucalyptus grandis]
Length=435

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 73/103 (71%), Gaps = 2/103 (2%)
 Frame = +2

Query  293  SFNQDVIDAVEKSMKKYADNLMRFLEGLSSRLSQLELYCYNLDKSIGEMRSDLVHDHGET  472
            +F+  ++  ++++MKK+AD+L+  LEG+S+ L+QLE    NL+ S+ +++  + +++G T
Sbjct  111  AFDASMVSEIDRTMKKHADSLLHVLEGVSAGLTQLESRTRNLENSVDDLKVSVDNNYGTT  170

Query  473  DSKLKSLEKHLQEVHRSVQILRDKQELADAQKELAKLQLAQXE  601
            D K++ LE  L++     + L+DKQE+ ++Q +LAKLQL++ E
Sbjct  171  DGKMRQLENILRD--EGCRCLKDKQEIMESQYQLAKLQLSKSE  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250