BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF044G17

Length=642
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP01995.1|  unnamed protein product                                340   2e-114   Coffea canephora [robusta coffee]
ref|XP_009772840.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    335   1e-112   Nicotiana sylvestris
ref|XP_004233530.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    333   8e-112   
ref|XP_010102071.1|  hypothetical protein L484_009014                   333   1e-111   Morus notabilis
ref|XP_009588225.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    332   2e-111   Nicotiana tomentosiformis
ref|XP_010263617.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    332   2e-111   Nelumbo nucifera [Indian lotus]
ref|XP_008452092.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    332   2e-111   Cucumis melo [Oriental melon]
gb|KJB12032.1|  hypothetical protein B456_002G126800                    332   2e-111   Gossypium raimondii
ref|XP_006346962.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    332   2e-111   Solanum tuberosum [potatoes]
ref|XP_010265678.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    332   2e-111   Nelumbo nucifera [Indian lotus]
ref|NP_001275071.1|  transcription factor APFI-like                     332   3e-111   Solanum tuberosum [potatoes]
gb|KJB12033.1|  hypothetical protein B456_002G126800                    328   4e-111   Gossypium raimondii
gb|KDP38522.1|  hypothetical protein JCGZ_04447                         331   5e-111   Jatropha curcas
gb|KJB17752.1|  hypothetical protein B456_003G013500                    330   9e-111   Gossypium raimondii
ref|XP_004146498.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    330   1e-110   Cucumis sativus [cucumbers]
ref|XP_002510412.1|  Protein yrdA, putative                             330   1e-110   Ricinus communis
gb|KJB43468.1|  hypothetical protein B456_007G201900                    330   1e-110   Gossypium raimondii
ref|XP_006435021.1|  hypothetical protein CICLE_v10002155mg             330   2e-110   Citrus clementina [clementine]
ref|XP_010061298.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    330   2e-110   Eucalyptus grandis [rose gum]
ref|XP_007046882.1|  Gamma carbonic anhydrase 1, CA1                    329   3e-110   Theobroma cacao [chocolate]
gb|KDP38527.1|  hypothetical protein JCGZ_04452                         329   3e-110   Jatropha curcas
ref|XP_008444737.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    329   3e-110   Cucumis melo [Oriental melon]
ref|XP_011074556.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    328   6e-110   Sesamum indicum [beniseed]
gb|KHG23300.1|  hypothetical protein F383_08437                         328   6e-110   Gossypium arboreum [tree cotton]
ref|XP_004160973.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    328   6e-110   
gb|KHG00707.1|  hypothetical protein F383_22748                         328   7e-110   Gossypium arboreum [tree cotton]
ref|XP_006878532.1|  hypothetical protein AMTR_s00011p00224870          328   7e-110   Amborella trichopoda
ref|XP_004152688.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    328   7e-110   Cucumis sativus [cucumbers]
ref|XP_002282021.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    327   1e-109   Vitis vinifera
ref|XP_002302024.1|  transcription factor APFI family protein           327   2e-109   Populus trichocarpa [western balsam poplar]
emb|CDP07494.1|  unnamed protein product                                327   3e-109   Coffea canephora [robusta coffee]
ref|XP_002306878.1|  transcription factor APFI family protein           327   3e-109   Populus trichocarpa [western balsam poplar]
ref|XP_006466826.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    326   3e-109   Citrus sinensis [apfelsine]
ref|XP_010113421.1|  hypothetical protein L484_026755                   326   4e-109   Morus notabilis
ref|XP_006386210.1|  hypothetical protein POPTR_0002s03550g             327   4e-109   
ref|XP_008338081.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    326   4e-109   
ref|XP_006425642.1|  hypothetical protein CICLE_v10026267mg             326   5e-109   Citrus clementina [clementine]
ref|XP_011083204.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    325   6e-109   Sesamum indicum [beniseed]
ref|NP_001042763.1|  Os01g0283100                                       325   7e-109   
ref|XP_009391607.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    325   8e-109   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC70424.1|  hypothetical protein OsI_01428                          325   8e-109   Oryza sativa Indica Group [Indian rice]
ref|XP_008338249.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    325   9e-109   Malus domestica [apple tree]
ref|XP_009340721.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    325   1e-108   Pyrus x bretschneideri [bai li]
ref|XP_002510411.1|  Protein yrdA, putative                             325   2e-108   Ricinus communis
ref|XP_011007461.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    324   2e-108   Populus euphratica
ref|XP_009371625.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    324   3e-108   Pyrus x bretschneideri [bai li]
ref|XP_007017577.1|  Gamma carbonic anhydrase 1, CA1                    323   4e-108   
ref|XP_007136608.1|  hypothetical protein PHAVU_009G0592001g            320   4e-108   Phaseolus vulgaris [French bean]
ref|XP_010922032.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    323   5e-108   Elaeis guineensis
ref|XP_008241708.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    323   7e-108   Prunus mume [ume]
ref|XP_007204711.1|  hypothetical protein PRUPE_ppa009928mg             323   9e-108   Prunus persica
ref|XP_007204710.1|  hypothetical protein PRUPE_ppa009928mg             320   9e-108   
ref|XP_006644073.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    322   1e-107   Oryza brachyantha
ref|XP_010029770.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    322   1e-107   Eucalyptus grandis [rose gum]
ref|XP_003537599.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    322   2e-107   Glycine max [soybeans]
ref|XP_004287879.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    322   2e-107   Fragaria vesca subsp. vesca
ref|XP_009799511.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    322   2e-107   Nicotiana sylvestris
ref|XP_006383176.1|  hypothetical protein POPTR_0005s12280g             322   2e-107   Populus trichocarpa [western balsam poplar]
gb|ACU19296.1|  unknown                                                 322   2e-107   Glycine max [soybeans]
ref|XP_004232424.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    321   3e-107   Solanum lycopersicum
gb|EPS71345.1|  hypothetical protein M569_03414                         320   3e-107   Genlisea aurea
ref|XP_006340643.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    321   5e-107   Solanum tuberosum [potatoes]
ref|XP_004291863.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    321   6e-107   Fragaria vesca subsp. vesca
gb|AFK45344.1|  unknown                                                 321   6e-107   Medicago truncatula
ref|XP_003517218.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    320   9e-107   Glycine max [soybeans]
ref|XP_008786862.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    320   1e-106   Phoenix dactylifera
ref|XP_010679758.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    320   2e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008788543.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    319   3e-106   Phoenix dactylifera
ref|XP_009110271.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    318   4e-106   Brassica rapa
ref|XP_010538097.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    319   4e-106   Tarenaya hassleriana [spider flower]
emb|CDX96658.1|  BnaA08g22010D                                          318   4e-106   
ref|XP_009590737.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    318   4e-106   Nicotiana tomentosiformis
ref|XP_004512067.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    318   4e-106   Cicer arietinum [garbanzo]
ref|XP_010679759.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    318   5e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010931534.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    320   5e-106   Elaeis guineensis
ref|NP_564091.1|  gamma carbonic anhydrase 1                            318   5e-106   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD43151.1|  unknown protein                                        318   5e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222873.1|  hypothetical protein PRUPE_ppa009923mg             318   5e-106   Prunus persica
ref|NP_001185039.1|  gamma carbonic anhydrase 1                         316   5e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220827.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    318   7e-106   Prunus mume [ume]
ref|XP_008810436.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    318   7e-106   Phoenix dactylifera
gb|KFK44104.1|  hypothetical protein AALP_AA1G216400                    318   7e-106   Arabis alpina [alpine rockcress]
ref|XP_004967660.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    317   9e-106   Setaria italica
ref|XP_009399949.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    318   9e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003612060.1|  Transcription factor APFI-like protein             317   1e-105   Medicago truncatula
ref|XP_009386943.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    317   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009365039.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    317   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_003612061.1|  Transcription factor APFI-like protein             314   2e-105   
ref|XP_011011740.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    317   2e-105   Populus euphratica
gb|KHN36089.1|  Hypothetical protein glysoja_003212                     317   2e-105   Glycine soja [wild soybean]
ref|XP_010550419.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    317   2e-105   Tarenaya hassleriana [spider flower]
gb|AAM61583.1|  unknown                                                 317   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009336133.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    317   3e-105   Pyrus x bretschneideri [bai li]
ref|XP_008364986.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    317   3e-105   
ref|XP_002455477.1|  hypothetical protein SORBIDRAFT_03g011540          316   3e-105   Sorghum bicolor [broomcorn]
ref|XP_007156970.1|  hypothetical protein PHAVU_002G032600g             316   4e-105   Phaseolus vulgaris [French bean]
gb|KCW68228.1|  hypothetical protein EUGRSUZ_F01883                     316   4e-105   Eucalyptus grandis [rose gum]
ref|XP_009365536.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    316   5e-105   Pyrus x bretschneideri [bai li]
emb|CDM82924.1|  unnamed protein product                                315   5e-105   Triticum aestivum [Canadian hard winter wheat]
gb|ACU23675.1|  unknown                                                 316   5e-105   Glycine max [soybeans]
gb|EYU31197.1|  hypothetical protein MIMGU_mgv1a012119mg                315   7e-105   Erythranthe guttata [common monkey flower]
ref|XP_003567426.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    315   7e-105   Brachypodium distachyon [annual false brome]
emb|CDX83758.1|  BnaC08g18870D                                          315   1e-104   
ref|XP_010477178.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    315   1e-104   
ref|XP_010459631.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    314   2e-104   Camelina sativa [gold-of-pleasure]
gb|AFK48594.1|  unknown                                                 313   4e-104   Lotus japonicus
dbj|BAD44607.1|  unknown protein                                        313   7e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008655471.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    312   8e-104   
ref|XP_003523810.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    313   8e-104   Glycine max [soybeans]
ref|XP_006305516.1|  hypothetical protein CARUB_v10009987mg             313   1e-103   Capsella rubella
ref|XP_009799510.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    313   1e-103   Nicotiana sylvestris
ref|XP_010498381.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    311   2e-103   Camelina sativa [gold-of-pleasure]
dbj|BAK01732.1|  predicted protein                                      311   2e-103   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008388037.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    311   3e-103   Malus domestica [apple tree]
ref|XP_008672300.1|  PREDICTED: uncharacterized protein LOC100217...    311   4e-103   Zea mays [maize]
ref|XP_010523601.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    311   5e-103   Tarenaya hassleriana [spider flower]
tpg|DAA54233.1|  TPA: hypothetical protein ZEAMMB73_935334              308   6e-103   
ref|NP_001137016.1|  uncharacterized protein LOC100217184               308   6e-103   Zea mays [maize]
gb|ACU22925.1|  unknown                                                 308   7e-103   Glycine max [soybeans]
gb|AFK46651.1|  unknown                                                 310   8e-103   Lotus japonicus
dbj|BAB39954.1|  OSJNBa0004B13.8                                        308   2e-102   Oryza sativa Japonica Group [Japonica rice]
gb|ACG35255.1|  transcription factor APFI                               307   7e-102   Zea mays [maize]
ref|XP_010484635.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    307   8e-102   Camelina sativa [gold-of-pleasure]
ref|XP_006393845.1|  hypothetical protein EUTSA_v10004794mg             306   2e-101   Eutrema salsugineum [saltwater cress]
ref|XP_010444788.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    305   4e-101   Camelina sativa [gold-of-pleasure]
ref|XP_002890347.1|  F18O14.34                                          306   8e-101   
ref|NP_001241093.1|  uncharacterized protein LOC100805278               304   2e-100   Glycine max [soybeans]
gb|AAF79435.1|AC025808_17  F18O14.34                                    304   5e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083663.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    303   5e-100   Sesamum indicum [beniseed]
ref|XP_010465384.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    300   3e-99    Camelina sativa [gold-of-pleasure]
ref|XP_006393603.1|  hypothetical protein EUTSA_v10011707mg             300   9e-99    Eutrema salsugineum [saltwater cress]
ref|NP_569036.1|  gamma carbonic anhydrase 3                            299   9e-99    Arabidopsis thaliana [mouse-ear cress]
gb|ABK26184.1|  unknown                                                 296   2e-97    Picea sitchensis
ref|XP_009103523.1|  PREDICTED: gamma carbonic anhydrase 3, mitoc...    294   8e-97    Brassica rapa
gb|KFK28325.1|  hypothetical protein AALP_AA8G501300                    293   2e-96    Arabis alpina [alpine rockcress]
emb|CDY45234.1|  BnaA07g12560D                                          293   2e-96    Brassica napus [oilseed rape]
ref|XP_002894036.1|  hypothetical protein ARALYDRAFT_891497             293   4e-96    
ref|XP_002865062.1|  gamma CA3                                          293   4e-96    
gb|AFK09615.1|  gamma carbonic anhydrase 3                              292   8e-96    Arabidopsis kamchatica
gb|ADQ43216.1|  GAMMA CA3/carbonate dehydratase                         291   1e-95    Schrenkiella parvula
ref|XP_009612501.1|  PREDICTED: gamma carbonic anhydrase 1, mitoc...    291   2e-95    Nicotiana tomentosiformis
ref|XP_010463232.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    288   2e-95    
ref|NP_001078808.1|  gamma carbonic anhydrase 3                         291   3e-95    Arabidopsis thaliana [mouse-ear cress]
ref|NP_175159.1|  gamma carbonic anhydrase 2                            291   3e-95    Arabidopsis thaliana [mouse-ear cress]
emb|CDY30772.1|  BnaC07g16720D                                          288   2e-94    Brassica napus [oilseed rape]
gb|AAK28403.1|AF249876_1  transcription factor APFI                     288   3e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CDY47592.1|  BnaC08g04620D                                          288   3e-94    Brassica napus [oilseed rape]
gb|EYU45182.1|  hypothetical protein MIMGU_mgv1a011728mg                288   4e-94    Erythranthe guttata [common monkey flower]
emb|CDY17034.1|  BnaA08g03980D                                          288   4e-94    Brassica napus [oilseed rape]
ref|XP_010500247.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    288   4e-94    Camelina sativa [gold-of-pleasure]
ref|XP_009771198.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    288   6e-94    Nicotiana sylvestris
emb|CDY67628.1|  BnaCnng55730D                                          288   7e-94    Brassica napus [oilseed rape]
ref|XP_006304043.1|  hypothetical protein CARUB_v10009842mg             288   7e-94    
gb|ACJ85087.1|  unknown                                                 286   8e-94    Medicago truncatula
gb|KEH36170.1|  gamma carbonic anhydrase-like protein                   287   1e-93    Medicago truncatula
gb|AFK09616.1|  gamma carbonic anhydrase 3                              286   1e-93    Arabidopsis halleri subsp. gemmifera
ref|XP_004238283.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    286   3e-93    Solanum lycopersicum
gb|AFK09618.1|  gamma carbonic anhydrase 3                              285   4e-93    Arabidopsis lyrata subsp. lyrata
ref|NP_001066265.1|  Os12g0169700                                       285   5e-93    
emb|CDY50984.1|  BnaC02g48920D                                          285   5e-93    Brassica napus [oilseed rape]
ref|XP_009145039.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    284   1e-92    Brassica rapa
ref|XP_006341958.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    284   1e-92    Solanum tuberosum [potatoes]
gb|AFK41197.1|  unknown                                                 283   3e-92    Medicago truncatula
ref|XP_006663861.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    282   7e-92    Oryza brachyantha
ref|XP_009107430.1|  PREDICTED: LOW QUALITY PROTEIN: gamma carbon...    282   1e-91    
ref|XP_002463275.1|  hypothetical protein SORBIDRAFT_02g041030          282   1e-91    Sorghum bicolor [broomcorn]
ref|NP_001169012.1|  uncharacterized protein LOC100382844               281   2e-91    Zea mays [maize]
gb|KFK36155.1|  hypothetical protein AALP_AA4G085200                    281   3e-91    Arabis alpina [alpine rockcress]
gb|AFK40628.1|  unknown                                                 277   4e-91    Lotus japonicus
emb|CDY23649.1|  BnaA05g17800D                                          280   9e-91    Brassica napus [oilseed rape]
gb|EAZ04886.1|  hypothetical protein OsI_27068                          280   1e-90    Oryza sativa Indica Group [Indian rice]
ref|XP_004958498.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    278   2e-90    Setaria italica
ref|NP_001060439.1|  Os07g0642900                                       276   3e-89    
ref|XP_002968991.1|  hypothetical protein SELMODRAFT_145865             274   1e-88    Selaginella moellendorffii
gb|EPS62312.1|  hypothetical protein M569_12479                         273   3e-88    Genlisea aurea
ref|XP_003562574.1|  PREDICTED: gamma carbonic anhydrase 2, mitoc...    272   6e-88    Brachypodium distachyon [annual false brome]
emb|CDY55089.1|  BnaA02g34770D                                          271   7e-88    Brassica napus [oilseed rape]
ref|XP_001754319.1|  predicted protein                                  263   8e-85    
gb|ACG33606.1|  transcription factor APFI                               256   5e-82    Zea mays [maize]
ref|XP_006416491.1|  hypothetical protein EUTSA_v10008724mg             253   4e-81    
gb|KCW68230.1|  hypothetical protein EUGRSUZ_F01883                     252   2e-80    Eucalyptus grandis [rose gum]
gb|KJB43471.1|  hypothetical protein B456_007G201900                    243   6e-77    Gossypium raimondii
ref|XP_007136607.1|  hypothetical protein PHAVU_009G0592001g            239   7e-77    Phaseolus vulgaris [French bean]
ref|XP_001776500.1|  predicted protein                                  242   4e-76    
gb|AFK37757.1|  unknown                                                 233   2e-74    Medicago truncatula
gb|ACV52585.1|  transcription factor APFI-like protein                  233   4e-74    Nicotiana benthamiana
ref|XP_001758123.1|  predicted protein                                  236   9e-74    
gb|KJB17751.1|  hypothetical protein B456_003G013500                    234   2e-73    Gossypium raimondii
ref|XP_002504597.1|  predicted protein                                  232   2e-72    Micromonas commoda
gb|AFW79497.1|  hypothetical protein ZEAMMB73_562884                    230   3e-72    
tpg|DAA63887.1|  TPA: hypothetical protein ZEAMMB73_753225              231   4e-72    
ref|XP_006305517.1|  hypothetical protein CARUB_v10009987mg             226   2e-70    
ref|XP_003059787.1|  predicted protein                                  225   1e-69    Micromonas pusilla CCMP1545
gb|EMT05784.1|  hypothetical protein F775_31542                         218   3e-67    
dbj|BAB10927.1|  ferripyochelin-binding protein-like                    217   5e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CBI17490.3|  unnamed protein product                                208   2e-63    Vitis vinifera
ref|XP_011398885.1|  Uncharacterized protein F751_3627                  197   7e-59    Auxenochlorella protothecoides
ref|XP_005649920.1|  trimeric LpxA-like protein                         195   2e-58    Coccomyxa subellipsoidea C-169
ref|XP_008672301.1|  PREDICTED: uncharacterized protein LOC100217...    191   4e-57    Zea mays [maize]
ref|XP_008871299.1|  hypothetical protein H310_07655                    190   3e-56    Aphanomyces invadans
ref|XP_005644680.1|  gamma-carbonic anhydrase                           189   1e-55    Coccomyxa subellipsoidea C-169
ref|XP_009831264.1|  hypothetical protein H257_07436                    187   4e-55    Aphanomyces astaci
gb|KDO22056.1|  hypothetical protein SPRG_12043                         185   2e-54    Saprolegnia parasitica CBS 223.65
ref|XP_008608997.1|  hypothetical protein SDRG_05080                    185   2e-54    Saprolegnia diclina VS20
ref|XP_005536976.1|  transcription factor APFI                          186   4e-54    Cyanidioschyzon merolae strain 10D
emb|CCI47075.1|  unnamed protein product                                184   8e-54    Albugo candida
emb|CCA20868.1|  conserved hypothetical protein                         177   2e-51    Albugo laibachii Nc14
ref|XP_002673591.1|  gamma carbonic dehydratase                         177   4e-51    Naegleria gruberi strain NEG-M
ref|XP_011398930.1|  Uncharacterized protein F751_3672                  176   1e-50    Auxenochlorella protothecoides
dbj|GAM24838.1|  hypothetical protein SAMD00019534_080130               175   3e-50    Acytostelium subglobosum LB1
gb|KHG18626.1|  Protein YrdA                                            171   2e-49    Gossypium arboreum [tree cotton]
gb|KJB43469.1|  hypothetical protein B456_007G201900                    170   5e-49    Gossypium raimondii
ref|XP_009523979.1|  hypothetical protein PHYSODRAFT_285582             171   6e-49    Phytophthora sojae
gb|KDO84602.1|  hypothetical protein CISIN_1g0242242mg                  165   2e-48    Citrus sinensis [apfelsine]
ref|XP_005847553.1|  hypothetical protein CHLNCDRAFT_35390              171   2e-48    Chlorella variabilis
ref|XP_008890951.1|  hypothetical protein PPTG_01107                    170   2e-48    Phytophthora parasitica INRA-310
ref|XP_002908534.1|  conserved hypothetical protein                     170   2e-48    Phytophthora infestans T30-4
gb|KCW68231.1|  hypothetical protein EUGRSUZ_F01883                     168   3e-48    Eucalyptus grandis [rose gum]
gb|AAU93943.1|  gamma-carbonic anhydrase                                166   6e-47    Helicosporidium sp. ex Simulium jonesi
gb|KDO84603.1|  hypothetical protein CISIN_1g0242241mg                  164   9e-47    Citrus sinensis [apfelsine]
gb|EMT05905.1|  hypothetical protein F775_31227                         159   6e-46    
gb|KDD73982.1|  hypothetical protein H632_c1679p0                       162   1e-45    Helicosporidium sp. ATCC 50920
ref|XP_005703463.1|  hypothetical protein Gasu_55130                    163   2e-45    Galdieria sulphuraria
ref|XP_005850191.1|  hypothetical protein CHLNCDRAFT_20587              160   6e-45    Chlorella variabilis
ref|XP_001703237.1|  gamma carbonic anhydrase                           157   7e-44    Chlamydomonas reinhardtii
gb|AAS48195.1|  mitochondrial NADH:ubiquinone oxidoreductase 27 k...    157   8e-44    Chlamydomonas reinhardtii
ref|XP_002948065.1|  hypothetical protein VOLCADRAFT_73531              156   2e-43    Volvox carteri f. nagariensis
dbj|BAF32946.1|  putative gamma-type carbonic anhydrase                 156   4e-43    Pleurochrysis haptonemofera
ref|XP_001696746.1|  gamma carbonic anhydrase                           157   6e-43    Chlamydomonas reinhardtii
gb|ETI49161.1|  hypothetical protein F443_06919                         154   2e-42    Phytophthora parasitica P1569
ref|XP_008903478.1|  hypothetical protein PPTG_09984                    153   6e-42    Phytophthora parasitica INRA-310
ref|XP_005766975.1|  gamma carbonic anhydrase                           152   1e-41    Emiliania huxleyi CCMP1516
ref|WP_025898515.1|  carbonic anhydrase                                 150   1e-41    Sneathiella glossodoripedis
ref|WP_002727628.1|  carbonic anhydrase                                 150   1e-41    Phaeospirillum molischianum
ref|XP_002997211.1|  conserved hypothetical protein                     152   1e-41    Phytophthora infestans T30-4
ref|WP_021802336.1|  hexapeptide repeat-containing transferase          150   1e-41    Clostridium intestinale
ref|XP_004351419.1|  trimeric LpxA-like domain-containing protein       152   1e-41    Cavenderia fasciculata
ref|WP_021132357.1|  carbonic anhydrase/acetyltransferase               150   2e-41    Phaeospirillum fulvum
gb|EWM27773.1|  Trimeric LpxA                                           151   6e-41    Nannochloropsis gaditana
ref|XP_009516211.1|  hypothetical protein PHYSODRAFT_537494             150   6e-41    Phytophthora sojae
ref|XP_636871.1|  trimeric LpxA-like domain-containing protein          150   9e-41    Dictyostelium discoideum AX4
ref|WP_007091625.1|  MULTISPECIES: carbonic anhydrase                   148   9e-41    Thalassospira
dbj|GAM26691.1|  hypothetical protein SAMD00019534_098660               149   2e-40    Acytostelium subglobosum LB1
ref|XP_002956125.1|  hypothetical protein VOLCADRAFT_83469              150   3e-40    Volvox carteri f. nagariensis
ref|WP_014804134.1|  acetyltransferase                                  147   3e-40    Turneriella parva
ref|WP_044828700.1|  carbonic anhydrase                                 146   4e-40    Thalassospira sp. HJ
emb|CBN79571.1|  gamma carbonic anhydrase                               149   6e-40    Ectocarpus siliculosus
gb|EKF07893.1|  carbonic anhydrase/acetyltransferase                    145   7e-40    Thalassospira profundimaris WP0211
ref|WP_013779035.1|  hypothetical protein                               145   9e-40    Tepidanaerobacter acetatoxydans
ref|XP_008862851.1|  hypothetical protein H310_01513                    147   9e-40    Aphanomyces invadans
ref|WP_033067257.1|  carbonic anhydrase                                 145   1e-39    Thalassospira australica
ref|XP_008610617.1|  hypothetical protein SDRG_06605                    147   1e-39    Saprolegnia diclina VS20
gb|EFA76939.1|  trimeric LpxA-like domain-containing protein            146   1e-39    Heterostelium album PN500
ref|WP_040823796.1|  carbonic anhydrase                                 145   1e-39    
emb|CCA17668.1|  conserved hypothetical protein                         147   2e-39    Albugo laibachii Nc14
ref|WP_028791231.1|  carbonic anhydrase                                 144   2e-39    Thalassospira lucentensis
ref|XP_009821153.1|  hypothetical protein, variant                      145   3e-39    Aphanomyces astaci
ref|XP_004333657.1|  GAMMA CA3 (GAMMA CARBONIC ANHYDRASE 3), puta...    147   3e-39    Acanthamoeba castellanii str. Neff
ref|XP_009821152.1|  hypothetical protein H257_00264                    146   3e-39    Aphanomyces astaci
ref|XP_005713311.1|  carbonic anhydrase, gamma type                     146   4e-39    Chondrus crispus [carageen]
ref|WP_041391656.1|  carbonic anhydrase                                 144   5e-39    
ref|WP_028096230.1|  carbonic anhydrase                                 144   5e-39    Dongia sp. URHE0060
gb|KIY95938.1|  transferase                                             146   5e-39    Monoraphidium neglectum
ref|WP_013275402.1|  hypothetical protein                               143   7e-39    Thermosediminibacter oceani
ref|WP_034842867.1|  carbonic anhydrase                                 142   8e-39    
ref|WP_014857207.1|  acetyltransferase                                  143   1e-38    Melioribacter roseus
ref|WP_042083557.1|  carbonic anhydrase                                 143   1e-38    alpha proteobacterium Q-1
ref|WP_038012874.1|  carbonic anhydrase                                 142   2e-38    
emb|CCI50078.1|  unnamed protein product                                144   2e-38    Albugo candida
emb|CBK21456.2|  unnamed protein product                                143   2e-38    Blastocystis hominis
dbj|BAK64770.1|  conserved hypothetical protein                         142   3e-38    Sphingobium sp. SYK-6
ref|WP_015718917.1|  acetyltransferase                                  142   4e-38    Geobacter sp. M18
ref|WP_014415395.1|  carbonic anhydrase                                 141   4e-38    Pararhodospirillum photometricum
emb|CCQ74394.1|  Conserved hypothetical protein yrdA                    140   6e-38    Magnetospira sp. QH-2
ref|WP_020593264.1|  hypothetical protein                               141   6e-38    Kiloniella laminariae
ref|WP_012531949.1|  acetyltransferase                                  140   8e-38    Geobacter bemidjiensis
ref|WP_026842119.1|  transferase                                        140   9e-38    Geobacter bremensis
ref|WP_015838795.1|  acetyltransferase                                  140   1e-37    Geobacter sp. M21
ref|WP_008102791.1|  carbonic anhydrase                                 140   2e-37    Verrucomicrobiae bacterium DG1235
ref|XP_003289169.1|  hypothetical protein DICPUDRAFT_48414              141   2e-37    
ref|WP_006961722.1|  carbonic anhydrase, family 3                       139   2e-37    
ref|WP_024080899.1|  putative hexapeptide repeat acetyltransferase      139   3e-37    
ref|WP_017184183.1|  hypothetical protein                               139   3e-37    
ref|WP_019052663.1|  hypothetical protein                               139   4e-37    
ref|WP_028794944.1|  carbonic anhydrase                                 138   4e-37    
gb|KJF43448.1|  acetyltransferase                                       138   4e-37    
ref|WP_038563256.1|  acetyltransferase                                  138   6e-37    
ref|WP_011390173.1|  carbonic anhydrase                                 139   6e-37    
ref|WP_008944647.1|  carbonic anhydrase                                 138   6e-37    
ref|WP_034964099.1|  acetyltransferase                                  138   6e-37    
ref|WP_008518447.1|  anhydrase                                          137   1e-36    
ref|WP_035291537.1|  hypothetical protein                               137   1e-36    
ref|WP_039673101.1|  acetyltransferase                                  137   1e-36    
ref|WP_041963596.1|  acetyltransferase                                  137   1e-36    
ref|WP_005007542.1|  putative Transferase, hexapeptide repeat pro...    137   1e-36    
ref|WP_012675364.1|  acetyltransferase                                  137   1e-36    
ref|WP_008069326.1|  carbonic anhydrase                                 137   2e-36    
ref|WP_014387513.1|  acetyltransferase                                  137   2e-36    
ref|WP_026873762.1|  carbonic anhydrase                                 137   2e-36    
ref|WP_011443735.1|  carbonic anhydrase                                 137   2e-36    
ref|WP_041958185.1|  acetyltransferase                                  137   2e-36    
ref|WP_043837486.1|  carbonic anhydrase                                 136   2e-36    
ref|WP_044578399.1|  hypothetical protein                               136   3e-36    
ref|WP_019014984.1|  hypothetical protein                               137   3e-36    
ref|WP_007673447.1|  carbonic anhydrase                                 136   3e-36    
ref|WP_013638500.1|  acetyltransferase                                  136   3e-36    
gb|EWM28838.1|  Trimeric LpxA                                           139   3e-36    
ref|WP_028167811.1|  carbonic anhydrase                                 136   3e-36    
ref|WP_018571149.1|  MULTISPECIES: anhydrase                            136   4e-36    
ref|WP_014102582.1|  carbonic anhydrase                                 136   4e-36    
ref|WP_011480697.1|  hypothetical protein                               136   4e-36    
ref|WP_038538794.1|  hypothetical protein                               135   5e-36    
ref|WP_040475708.1|  carbonic anhydrase                                 136   5e-36    
ref|WP_011384197.1|  carbonic anhydrase                                 135   5e-36    
gb|EME71085.1|  carbonic anhydrase/acetyltransferase                    135   5e-36    
dbj|BAI74729.1|  carbonic anhydrase/acetyltransferase                   136   6e-36    
ref|WP_020152866.1|  hypothetical protein                               135   6e-36    
ref|WP_028283426.1|  acetyltransferase                                  135   7e-36    
ref|WP_042445259.1|  carbonic anhydrase                                 135   7e-36    
ref|WP_037959567.1|  acetyltransferase                                  135   7e-36    
ref|XP_005787770.1|  hexapeptide repeat-containing transferas-lik...    136   7e-36    
ref|WP_004212025.1|  hypothetical protein                               136   7e-36    
ref|WP_029522898.1|  transferase                                        135   7e-36    
ref|WP_004505474.1|  transferase hexapeptide repeat protein             135   8e-36    
ref|WP_027289020.1|  carbonic anhydrase                                 135   8e-36    
ref|WP_013459351.1|  acetyltransferase                                  135   9e-36    
ref|WP_017502329.1|  carbonic anhydrase                                 135   9e-36    
ref|WP_026986265.1|  carbonic anhydrase                                 135   1e-35    
ref|WP_024021755.1|  carbonic anhydrase                                 135   1e-35    
ref|WP_007473220.1|  acetyltransferase                                  135   1e-35    
ref|WP_022726936.1|  carbonic anhydrase                                 135   1e-35    
ref|WP_037466843.1|  carbonic anhydrase                                 135   1e-35    
ref|WP_028584954.1|  acetyltransferase                                  135   1e-35    
ref|WP_014745465.1|  carbonic anhydrase                                 136   1e-35    
ref|XP_009149442.1|  PREDICTED: LOW QUALITY PROTEIN: gamma carbon...    135   1e-35    
ref|WP_028290211.1|  acetyltransferase                                  134   1e-35    
ref|WP_028607315.1|  acetyltransferase                                  134   1e-35    
ref|WP_007547159.1|  acetyltransferase                                  134   1e-35    
ref|WP_012459916.1|  acetyltransferase                                  134   1e-35    
ref|WP_029013145.1|  carbonic anhydrase                                 134   2e-35    
ref|WP_043151366.1|  carbonic anhydrase                                 135   2e-35    
ref|WP_022813053.1|  acetyltransferase                                  134   2e-35    
ref|WP_015027264.1|  acetyltransferase                                  134   2e-35    
ref|WP_007706893.1|  carbonic anhydrase                                 135   2e-35    
ref|WP_015467349.1|  carbonic anhydrase, family 3                       134   2e-35    
ref|WP_019644631.1|  hypothetical protein                               134   2e-35    
ref|WP_044400015.1|  acetyltransferase                                  134   2e-35    
gb|ABD46435.1|  hexapeptide transferase family protein                  134   2e-35    
ref|WP_020532944.1|  hypothetical protein                               134   2e-35    
ref|WP_031556442.1|  carbonic anhydrase                                 134   2e-35    
ref|WP_037507860.1|  carbonic anhydrase                                 134   3e-35    
ref|WP_029665451.1|  MULTISPECIES: hypothetical protein                 134   3e-35    
ref|WP_028071120.1|  acetyltransferase                                  134   3e-35    
ref|WP_022678453.1|  carbonic anhydrase                                 134   3e-35    
ref|WP_034327444.1|  acetyltransferase                                  134   3e-35    
ref|WP_009542213.1|  carbonic anhydrase, family 3                       134   3e-35    
ref|WP_024980426.1|  acetyltransferase                                  134   3e-35    
ref|WP_040106621.1|  transferase                                        134   3e-35    
ref|WP_029520498.1|  transferase                                        134   3e-35    
ref|WP_003449781.1|  hypothetical protein                               133   3e-35    
ref|WP_026711728.1|  acetyltransferase                                  134   3e-35    
ref|WP_019979444.1|  hypothetical protein                               134   3e-35    
ref|WP_043825309.1|  anhydrase                                          134   3e-35    
ref|WP_041294435.1|  acetyltransferase                                  134   3e-35    
ref|WP_028262838.1|  hypothetical protein                               134   3e-35    
ref|WP_039455831.1|  hypothetical protein                               133   3e-35    
ref|WP_010337969.1|  carbonic anhydrase                                 134   4e-35    
ref|WP_028970913.1|  carbonic anhydrase                                 134   4e-35    
ref|WP_009256300.1|  MULTISPECIES: acetyltransferase                    133   4e-35    
ref|XP_005850061.1|  hypothetical protein CHLNCDRAFT_34352              135   4e-35    
ref|WP_041148764.1|  acetyltransferase                                  134   4e-35    
dbj|BAH53384.1|  hypothetical protein                                   133   5e-35    
ref|WP_008286511.1|  acetyltransferase                                  133   5e-35    
ref|WP_035657000.1|  acetyltransferase                                  133   5e-35    
ref|WP_014187883.1|  carbonic anhydrase                                 133   5e-35    
ref|WP_041141369.1|  acetyltransferase                                  133   6e-35    
ref|WP_023839484.1|  carbonic anhydrase                                 134   6e-35    
ref|WP_040095463.1|  hypothetical protein                               133   6e-35    
ref|WP_018023585.1|  hypothetical protein                               133   6e-35    
ref|WP_015652928.1|  hypothetical protein                               133   6e-35    
ref|WP_043288165.1|  carbonic anhydrase                                 133   7e-35    
gb|ACT69043.1|  hexapeptide transferase family protein                  133   7e-35    
gb|KDD72217.1|  hypothetical protein H632_c3683p0                       134   7e-35    
ref|WP_042698554.1|  carbonic anhydrase                                 133   7e-35    
ref|WP_043363635.1|  carbonic anhydrase                                 132   8e-35    
ref|WP_008289121.1|  acetyltransferase                                  132   8e-35    
ref|WP_043506307.1|  anhydrase                                          132   8e-35    
ref|WP_041917455.1|  carbonic anhydrase                                 132   8e-35    
ref|WP_037475946.1|  carbonic anhydrase                                 133   9e-35    
ref|WP_017549187.1|  hypothetical protein                               132   9e-35    
ref|WP_010881079.1|  acetyltransferase                                  132   9e-35    
ref|WP_025648232.1|  hypothetical protein                               132   9e-35    
ref|WP_003478224.1|  hypothetical protein                               132   9e-35    
ref|WP_012674376.1|  acetyltransferase                                  132   9e-35    
ref|WP_012663737.1|  acetyltransferase                                  132   9e-35    
ref|WP_012991920.1|  acetyltransferase                                  132   9e-35    
ref|WP_009392430.1|  acetyltransferase                                  132   9e-35    
ref|WP_043334892.1|  carbonic anhydrase                                 132   1e-34    
ref|WP_026775661.1|  acetyltransferase                                  132   1e-34    
ref|WP_034061227.1|  acetyltransferase                                  132   1e-34    
ref|WP_039333376.1|  carbonic anhydrase                                 132   1e-34    
ref|WP_030358647.1|  MULTISPECIES: anhydrase                            132   1e-34    
ref|WP_037263136.1|  carbonic anhydrase                                 132   1e-34    
ref|WP_020147311.1|  hypothetical protein                               132   1e-34    
ref|WP_009867839.1|  COG0663: Carbonic anhydrases/acetyltransfera...    132   1e-34    
ref|WP_042241483.1|  acetyltransferase                                  132   1e-34    
ref|WP_034974065.1|  acetyltransferase                                  132   1e-34    
emb|CBW27843.1|  putative siderophore binding protein                   132   1e-34    
ref|WP_003009958.1|  transferase hexapeptide repeat protein             132   1e-34    
ref|WP_021343479.1|  anhydrase                                          132   1e-34    
ref|WP_007548882.1|  MULTISPECIES: carbonic anhydrase                   132   1e-34    
ref|WP_009440851.1|  bacterial transferase hexapeptide repeat pro...    132   1e-34    
ref|WP_020766837.1|  MULTISPECIES: transferase hexapeptide repeat...    132   1e-34    
emb|CDR78889.1|  hexapeptide transferase family protein,hypotheti...    132   1e-34    
ref|WP_010962614.1|  MULTISPECIES: carbonic anhydrase                   132   1e-34    
ref|WP_036086731.1|  acetyltransferase                                  132   1e-34    
ref|WP_016753520.1|  acetyltransferase                                  132   1e-34    
ref|WP_016758765.1|  MULTISPECIES: acetyltransferase                    132   1e-34    
gb|EHL03964.1|  bacterial transferase hexapeptide repeat protein        132   1e-34    
ref|WP_020403893.1|  hypothetical protein                               132   1e-34    
ref|WP_009655637.1|  carbonic anhydrase                                 132   1e-34    
ref|WP_009603885.1|  carbonic anhydrase                                 132   2e-34    
ref|WP_026766426.1|  carbonic anhydrase                                 132   2e-34    
ref|WP_044557677.1|  transferase                                        132   2e-34    
ref|WP_004753596.1|  acetyltransferase                                  132   2e-34    
ref|WP_004761571.1|  transferase hexapeptide repeat protein             132   2e-34    
ref|WP_013452907.1|  acetyltransferase                                  132   2e-34    
ref|WP_041517651.1|  acetyltransferase                                  132   2e-34    
ref|WP_011951931.1|  MULTISPECIES: carbonic anhydrase                   132   2e-34    
ref|WP_012063476.1|  hypothetical protein                               131   2e-34    
ref|WP_041629030.1|  acetyltransferase                                  132   2e-34    
ref|XP_005706870.1|  hypothetical protein Gasu_22590                    134   2e-34    
ref|WP_017670191.1|  hypothetical protein                               132   2e-34    
ref|WP_027969071.1|  hypothetical protein [                             131   2e-34    
ref|WP_028055860.1|  carbonic anhydrase                                 132   2e-34    
ref|WP_033926467.1|  carbonic anhydrase                                 132   2e-34    
ref|WP_041351328.1|  carbonic anhydrase                                 131   2e-34    
ref|WP_012023754.1|  acetyltransferase                                  131   2e-34    
ref|WP_014425386.1|  carbonic anhydrase                                 132   2e-34    
ref|WP_012525566.1|  acetyltransferase                                  131   2e-34    
ref|WP_010572107.1|  acetyltransferase                                  131   2e-34    
ref|WP_009821934.1|  carbonic anhydrase                                 132   2e-34    
ref|WP_021689862.1|  hypothetical protein                               132   3e-34    
ref|WP_033917060.1|  acetyltransferase                                  131   3e-34    
emb|CBN75766.1|  putative carbonic anhydrase                            132   3e-34    
ref|WP_039118375.1|  acetyltransferase                                  131   3e-34    
ref|WP_039934603.1|  acetyltransferase                                  132   3e-34    
gb|EMO74775.1|  transferase hexapeptide repeat protein                  131   3e-34    
ref|WP_028129386.1|  carbonic anhydrase                                 131   3e-34    
ref|WP_033236431.1|  anhydrase                                          131   3e-34    
ref|WP_025345345.1|  acetyltransferase                                  131   3e-34    
gb|EQA36598.1|  transferase hexapeptide repeat protein                  131   3e-34    
ref|WP_037672466.1|  anhydrase                                          131   3e-34    
gb|ACR17001.1|  gamma-type carbonic anhydratase-like protein            132   3e-34    
ref|WP_004786007.1|  acetyltransferase                                  131   3e-34    
ref|WP_011421405.1|  acetyltransferase                                  131   3e-34    
gb|EKR64009.1|  transferase hexapeptide repeat protein                  131   3e-34    
ref|WP_010578283.1|  acetyltransferase                                  131   3e-34    
ref|WP_015681936.1|  transferase hexapeptide repeat protein             131   3e-34    
ref|WP_012632885.1|  acetyltransferase                                  131   3e-34    
gb|EMN00863.1|  transferase hexapeptide repeat protein                  132   3e-34    
gb|EMJ59687.1|  transferase hexapeptide repeat protein                  131   3e-34    
ref|WP_028121618.1|  acetyltransferase                                  131   3e-34    
ref|WP_012501562.1|  acetyltransferase                                  131   3e-34    
ref|WP_028066175.1|  hypothetical protein                               130   3e-34    
ref|WP_008907439.1|  hypothetical protein                               130   3e-34    
ref|WP_037331584.1|  anhydrase                                          131   3e-34    
ref|WP_020968974.1|  MULTISPECIES: hypothetical protein                 131   3e-34    
ref|WP_039927404.1|  acetyltransferase                                  131   3e-34    
ref|WP_004766655.1|  transferase hexapeptide repeat protein             131   3e-34    
ref|WP_026718181.1|  acetyltransferase                                  131   3e-34    
gb|KEI43879.1|  anhydrase                                               130   4e-34    
ref|WP_035214734.1|  transferase                                        131   4e-34    
ref|WP_004280603.1|  transferase hexapeptide repeat protein             131   4e-34    
gb|EMO43159.1|  transferase hexapeptide repeat protein                  131   4e-34    
ref|WP_020980387.1|  transferase hexapeptide repeat protein             131   4e-34    
ref|WP_008256152.1|  acetyltransferase                                  130   4e-34    
ref|WP_005570724.1|  carbonic anhydrase                                 131   4e-34    
ref|WP_007278575.1|  anhydrase                                          130   4e-34    
ref|WP_011592563.1|  hypothetical protein                               130   4e-34    
ref|WP_027308041.1|  hypothetical protein                               130   4e-34    
gb|EMY68298.1|  transferase hexapeptide repeat protein                  131   4e-34    
gb|EKR74225.1|  transferase hexapeptide repeat protein                  131   4e-34    
ref|WP_040848085.1|  hypothetical protein                               130   4e-34    
ref|WP_026985545.1|  acetyltransferase                                  130   4e-34    
ref|WP_028465013.1|  carbonic anhydrase                                 130   4e-34    
ref|WP_004455912.1|  transferase hexapeptide repeat protein             131   4e-34    
ref|WP_026991210.1|  acetyltransferase                                  130   4e-34    
ref|WP_039114849.1|  acetyltransferase                                  130   4e-34    
ref|WP_011713109.1|  anhydrase                                          131   5e-34    
ref|WP_028848556.1|  carbonic anhydrase                                 130   5e-34    
ref|WP_011461525.1|  acetyltransferase                                  130   5e-34    
ref|WP_021224722.1|  carbonic anhydrase                                 131   5e-34    
gb|AHC16236.1|  carbonic anhydrase, family 3                            130   5e-34    
ref|WP_015943371.1|  acetyltransferase                                  130   5e-34    
ref|WP_012081704.1|  acetyltransferase                                  130   5e-34    
ref|WP_036063898.1|  acetyltransferase                                  130   5e-34    
ref|WP_036026483.1|  acetyltransferase                                  130   5e-34    
ref|WP_035617865.1|  acetyltransferase                                  130   5e-34    
ref|WP_015588968.1|  Hexapeptide transferase family protein             130   5e-34    



>emb|CDP01995.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   340 bits (871),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGSLGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGSLGRAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI+GDVQVGR SSIWYGCVLRGDVNS+SIGTGTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIVGDVQVGRSSSIWYGCVLRGDVNSISIGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIP  176



>ref|XP_009772840.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
sylvestris]
Length=268

 Score =   335 bits (858),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAMDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPMVAKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV VGR++SIWYGCVLRGDVNS+SIG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AAGALVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQNTRIP  176



>ref|XP_004233530.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Solanum 
lycopersicum]
Length=268

 Score =   333 bits (853),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P+V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKTPTVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV VGR++SIWYGCVLRGDVNS+SIG G+NIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AAGALVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQNTRIP  176



>ref|XP_010102071.1| hypothetical protein L484_009014 [Morus notabilis]
 gb|EXB91921.1| hypothetical protein L484_009014 [Morus notabilis]
Length=272

 Score =   333 bits (853),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVN +SIG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNGISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIP  176



>ref|XP_009588225.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=268

 Score =   332 bits (851),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAMDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPMVAKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV VGR++SIWYGCVLRGDVNS+SIG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AAGALVRQ TRIP
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQKTRIP  176



>ref|XP_010263617.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Nelumbo 
nucifera]
Length=271

 Score =   332 bits (851),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDGVVVEKN+M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNSMVAAGALVRQNTRIP  176



>ref|XP_008452092.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
melo]
Length=271

 Score =   332 bits (851),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P ++++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVINKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRMSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>gb|KJB12032.1| hypothetical protein B456_002G126800 [Gossypium raimondii]
Length=273

 Score =   332 bits (851),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGSLG+A YTVGFWIRETGQALDRLGCRLQGNY+F EQLSRHR LMNLFDK P V ++AF
Sbjct  1    MGSLGKAIYTVGFWIRETGQALDRLGCRLQGNYFFQEQLSRHRTLMNLFDKSPLVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  NIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|XP_006346962.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X1 [Solanum tuberosum]
 ref|XP_006346963.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X2 [Solanum tuberosum]
 ref|XP_006346964.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X3 [Solanum tuberosum]
Length=268

 Score =   332 bits (851),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKAPMVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV VGR++SIWYGCVLRGDVNS+SIG G+NIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG VVEKNAM+AAGALVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGAVVEKNAMVAAGALVRQNTRIP  176



>ref|XP_010265678.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Nelumbo 
nucifera]
Length=271

 Score =   332 bits (851),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDTF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|NP_001275071.1| transcription factor APFI-like [Solanum tuberosum]
 gb|ABB86281.1| transcription factor APFI-like [Solanum tuberosum]
Length=268

 Score =   332 bits (850),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYFHEQLSRHR LMNLF+K P V ++AF
Sbjct  1    MGTLGKASYTVGFWIRETGQAIDRLGCRLQGNYYFHEQLSRHRTLMNLFNKAPMVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV VGR++SIWYGCVLRGDVNS+SIG G+NIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVHVGRNASIWYGCVLRGDVNSISIGAGSNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAM+AAGALVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTRIP  176



>gb|KJB12033.1| hypothetical protein B456_002G126800 [Gossypium raimondii]
Length=194

 Score =   328 bits (842),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGSLG+A YTVGFWIRETGQALDRLGCRLQGNY+F EQLSRHR LMNLFDK P V ++AF
Sbjct  1    MGSLGKAIYTVGFWIRETGQALDRLGCRLQGNYFFQEQLSRHRTLMNLFDKSPLVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  NIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>gb|KDP38522.1| hypothetical protein JCGZ_04447 [Jatropha curcas]
Length=272

 Score =   331 bits (848),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQALDRLGCR QGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRFQGNYYFQEQLSRHRTLMNIFDKAPVVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SS+WYGCVLRGDVNS+S+G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSVWYGCVLRGDVNSISVGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVFVEKHAMVAAGALVRQNTRIP  176



>gb|KJB17752.1| hypothetical protein B456_003G013500 [Gossypium raimondii]
Length=271

 Score =   330 bits (847),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPFVDRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_004146498.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN53299.1| hypothetical protein Csa_4G046620 [Cucumis sativus]
Length=271

 Score =   330 bits (847),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTR+P
Sbjct  121  IIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRVP  176



>ref|XP_002510412.1| Protein yrdA, putative [Ricinus communis]
 gb|EEF52599.1| Protein yrdA, putative [Ricinus communis]
Length=271

 Score =   330 bits (846),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y++GFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSIGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR +SIWYGCVLRGDVNS+SIG+GTNIQDN+LVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGASIWYGCVLRGDVNSISIGSGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMG TLLDGVVVEKNAM+AAGALVRQNT+IP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGTTLLDGVVVEKNAMVAAGALVRQNTKIP  176



>gb|KJB43468.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
 gb|KJB43470.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=271

 Score =   330 bits (845),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A +TVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIHTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPIVDRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRSSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_006435021.1| hypothetical protein CICLE_v10002155mg [Citrus clementina]
 ref|XP_006473528.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Citrus 
sinensis]
 gb|ESR48261.1| hypothetical protein CICLE_v10002155mg [Citrus clementina]
Length=270

 Score =   330 bits (845),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTLGRAVYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPAVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVE++ M+AAG+LVRQNTRIP
Sbjct  121  TIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVERHGMVAAGSLVRQNTRIP  176



>ref|XP_010061298.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Eucalyptus 
grandis]
 gb|KCW68229.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=273

 Score =   330 bits (845),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+A GALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAGGALVRQNTRIP  176



>ref|XP_007046882.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
 gb|EOX91039.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
Length=271

 Score =   329 bits (844),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+F+K P V R+AF
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFNKAPVVDRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>gb|KDP38527.1| hypothetical protein JCGZ_04452 [Jatropha curcas]
Length=271

 Score =   329 bits (843),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+F+K P V +EAF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFNKAPVVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVN++SIG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            ++G+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  LVGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|XP_008444737.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Cucumis 
melo]
Length=273

 Score =   329 bits (843),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLGCRLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGRYFFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAV+HGCTVEDEAFVGMGATLLDGVVVEKNAM+AAGALVRQNT+IP
Sbjct  121  IIGDNVTIGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTKIP  176



>ref|XP_011074556.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Sesamum 
indicum]
Length=272

 Score =   328 bits (842),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGSLGRA YT+G W+RETGQA+DRLGCRLQGNYYF EQLSRHR LMNLFDK P V R+AF
Sbjct  1    MGSLGRAVYTLGLWVRETGQAMDRLGCRLQGNYYFQEQLSRHRTLMNLFDKSPVVDRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLIGDVQVGQGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAV+HGCT+EDEAFVGMGATLLDGVVVE+NAM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVIHGCTIEDEAFVGMGATLLDGVVVERNAMVAAGALVRQNTRIP  176



>gb|KHG23300.1| hypothetical protein F383_08437 [Gossypium arboreum]
Length=271

 Score =   328 bits (841),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQ LDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQTLDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVDRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVN++SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_004160973.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
Length=271

 Score =   328 bits (841),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V  +AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDMDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCT+EDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTR+P
Sbjct  121  IIGDNVTVGHSAVLHGCTIEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRVP  176



>gb|KHG00707.1| hypothetical protein F383_22748 [Gossypium arboreum]
Length=271

 Score =   328 bits (841),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPIVDRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV+VGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+ KVLPT
Sbjct  61   VAPSASVIGDVKVGRSSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSRKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_006878532.1| hypothetical protein AMTR_s00011p00224870 [Amborella trichopoda]
 gb|ERM94677.1| hypothetical protein AMTR_s00011p00224870 [Amborella trichopoda]
Length=273

 Score =   328 bits (841),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPHVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV+VG  SSIWYGCVLRGDVNS+S+GTGTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVKVGHGSSIWYGCVLRGDVNSISVGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNT+IP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTKIP  176



>ref|XP_004152688.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004167040.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cucumis 
sativus]
 gb|KGN62616.1| hypothetical protein Csa_2G361800 [Cucumis sativus]
Length=273

 Score =   328 bits (841),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGRYFFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAV+HGCTVEDEAFVGMGATLLDGVVVEKNAM+AAGALVRQNT+IP
Sbjct  121  IIGDNVTIGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKNAMVAAGALVRQNTKIP  176



>ref|XP_002282021.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Vitis vinifera]
 emb|CAN79636.1| hypothetical protein VITISV_014473 [Vitis vinifera]
 emb|CBI19719.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   327 bits (839),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQ+SRHR LMNLFDK P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFLEQISRHRTLMNLFDKAPIVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDG +VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGSIVEKHAMVAAGALVRQNTRIP  176



>ref|XP_002302024.1| transcription factor APFI family protein [Populus trichocarpa]
 ref|XP_011028863.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Populus 
euphratica]
 gb|ABK95146.1| unknown [Populus trichocarpa]
 gb|EEE81297.1| transcription factor APFI family protein [Populus trichocarpa]
Length=271

 Score =   327 bits (838),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQALDRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQALDRLGGRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGKGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>emb|CDP07494.1| unnamed protein product [Coffea canephora]
Length=279

 Score =   327 bits (838),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPLVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+++G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSITVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDG V+EK+AM+AAGALVRQN RIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFVGMGAALLDGAVLEKHAMVAAGALVRQNMRIP  176



>ref|XP_002306878.1| transcription factor APFI family protein [Populus trichocarpa]
 gb|EEE93874.1| transcription factor APFI family protein [Populus trichocarpa]
Length=271

 Score =   327 bits (837),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y VGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYAVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP AS+IGDV VGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPGASVIGDVLVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|XP_006466826.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Citrus 
sinensis]
 gb|KDO70974.1| hypothetical protein CISIN_1g024153mg [Citrus sinensis]
Length=271

 Score =   326 bits (836),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V+++ F
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVNKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            +APSASIIGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   LAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNT+IP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIP  176



>ref|XP_010113421.1| hypothetical protein L484_026755 [Morus notabilis]
 gb|EXC35448.1| hypothetical protein L484_026755 [Morus notabilis]
Length=271

 Score =   326 bits (836),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 169/176 (96%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNY+F EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYHFQEQLSRHRTLMNVFDKAPAVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGH+AVLHGCTVEDEAFVGMGATLLDGV VE++AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHAAVLHGCTVEDEAFVGMGATLLDGVFVERHAMVAAGALVRQNTRIP  176



>ref|XP_006386210.1| hypothetical protein POPTR_0002s03550g [Populus trichocarpa]
 gb|ERP64007.1| hypothetical protein POPTR_0002s03550g [Populus trichocarpa]
Length=285

 Score =   327 bits (837),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQALDRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  15   MGTLGRAIYTVGFWIRETGQALDRLGGRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  74

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  75   VAPSASVIGDVQVGKGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  134

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  135  IIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  190



>ref|XP_008338081.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=268

 Score =   326 bits (835),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIG VQVGR SSIWYGCVLRGD NS+SIG+GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASIIGQVQVGRGSSIWYGCVLRGDANSISIGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_006425642.1| hypothetical protein CICLE_v10026267mg [Citrus clementina]
 gb|ESR38882.1| hypothetical protein CICLE_v10026267mg [Citrus clementina]
Length=271

 Score =   326 bits (836),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            +APSASIIGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   LAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLAGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNT+IP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTKIP  176



>ref|XP_011083204.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Sesamum 
indicum]
Length=265

 Score =   325 bits (834),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGS GRAFYTVGFWIRETGQALDRLG RLQGNY+F EQLSRHR LMN+FDKVP V ++AF
Sbjct  1    MGSFGRAFYTVGFWIRETGQALDRLGSRLQGNYFFQEQLSRHRTLMNVFDKVPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI+GDV VGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLP 
Sbjct  61   VAPSASIVGDVHVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPI  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAVLHGCTVEDE+FVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  LIGDNVTVGHSAVLHGCTVEDESFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|NP_001042763.1| Os01g0283100 [Oryza sativa Japonica Group]
 dbj|BAD82610.1| putative gamma-carbonic anhydrase [Oryza sativa Japonica Group]
 dbj|BAF04677.1| Os01g0283100 [Oryza sativa Japonica Group]
 dbj|BAG96503.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87611.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92644.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00769.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54348.1| hypothetical protein OsJ_01333 [Oryza sativa Japonica Group]
Length=263

 Score =   325 bits (833),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGD+QVG+ +SIWYGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDIQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_009391607.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=274

 Score =   325 bits (834),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKVPNVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVNS+ +G+GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASVIGDVQVGQGSSIWYGCVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGH+AVLHGCTVEDE FVGMG+ LLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHNAVLHGCTVEDETFVGMGSVLLDGVVVEKHGMVAAGALVRQNTRIP  176



>gb|EEC70424.1| hypothetical protein OsI_01428 [Oryza sativa Indica Group]
Length=263

 Score =   325 bits (833),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGD+QVG+ +SIWYGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDIQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_008338249.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=268

 Score =   325 bits (833),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIG VQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_009340721.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Pyrus x 
bretschneideri]
Length=268

 Score =   325 bits (833),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIG VQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_002510411.1| Protein yrdA, putative [Ricinus communis]
 gb|EEF52598.1| Protein yrdA, putative [Ricinus communis]
Length=271

 Score =   325 bits (832),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQALDRLGCR QG+YYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQALDRLGCRFQGSYYFQEQLSRHRTLMNIFDKAPMVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVG+ +SIWYGCVLRGDVNS+S+G GTNIQDNSLVHVAKSNL+GKV+PT
Sbjct  61   VAPSASIIGDVQVGKGASIWYGCVLRGDVNSISVGAGTNIQDNSLVHVAKSNLSGKVIPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNT+IP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTKIP  176



>ref|XP_011007461.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
Length=271

 Score =   324 bits (831),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y VGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYAVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP AS+IGDV VGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPGASVIGDVLVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|XP_009371625.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=268

 Score =   324 bits (830),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIG VQVGR SSIWYGCVLRGD NSVSIG+GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASIIGQVQVGRGSSIWYGCVLRGDANSVSIGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVG+ ATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGVAATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_007017577.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
 gb|EOY14802.1| Gamma carbonic anhydrase 1, CA1 [Theobroma cacao]
Length=273

 Score =   323 bits (829),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQALDRLGCRLQG+Y F EQ+SRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAVYTVGFWIRETGQALDRLGCRLQGSYLFQEQISRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYG VLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGSVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|XP_007136608.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 ref|XP_007136613.1| hypothetical protein PHAVU_009G0594000g, partial [Phaseolus vulgaris]
 gb|ESW08602.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 gb|ESW08607.1| hypothetical protein PHAVU_009G0594000g, partial [Phaseolus vulgaris]
Length=179

 Score =   320 bits (820),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+F EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+ +G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNTRIP
Sbjct  121  VIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNAMVAAGALVRQNTRIP  176



>ref|XP_010922032.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Elaeis 
guineensis]
Length=272

 Score =   323 bits (829),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR  MN++DKVP+V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTFMNIYDKVPNVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+ +G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AAGALVRQNT+IP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKHGMVAAGALVRQNTKIP  176



>ref|XP_008241708.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Prunus 
mume]
Length=271

 Score =   323 bits (828),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI+G VQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIVGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  VIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_007204711.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
 gb|EMJ05910.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
Length=271

 Score =   323 bits (827),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI+G VQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIVGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  VIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_007204710.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
 gb|EMJ05909.1| hypothetical protein PRUPE_ppa009928mg [Prunus persica]
Length=190

 Score =   320 bits (819),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI+G VQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIVGQVQVGRGSSIWYGCVLRGDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  VIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_006644073.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Oryza 
brachyantha]
Length=263

 Score =   322 bits (826),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNY+FHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYFFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ +SIWYGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAG+LVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGSLVRQNTRIP  176



>ref|XP_010029770.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Eucalyptus 
grandis]
 gb|KCW56730.1| hypothetical protein EUGRSUZ_I02417 [Eucalyptus grandis]
Length=271

 Score =   322 bits (826),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A Y+VGFWIRETGQALDRLGCRLQG+YYF EQLSRHR LMN+FDK P + ++ F
Sbjct  1    MGTLGKAIYSVGFWIRETGQALDRLGCRLQGSYYFQEQLSRHRTLMNVFDKAPVIDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGD+Q+GR SSIWYGCVLRGDVN++SIG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDIQIGRGSSIWYGCVLRGDVNNISIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTR+P
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRVP  176



>ref|XP_003537599.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Glycine 
max]
 gb|KHN41952.1| Hypothetical protein glysoja_003692 [Glycine soja]
Length=270

 Score =   322 bits (825),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS++GDV VG  SSIWYGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_004287879.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=269

 Score =   322 bits (824),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/176 (87%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWIRETGQAIDRLGSRLQGNYFFKEQLSRHRTLMNVFDKAPEVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIG VQVGR SSIWYGCVLRGD NS+SIG+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASIIGQVQVGRGSSIWYGCVLRGDANSISIGSGTNIQDNSLVHVAKSNLDGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGM ATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMAATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_009799511.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=271

 Score =   322 bits (825),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNLFDKVPVVEKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI+GDV +GR +SIWYGCVLRGDVN+VSIG GTN+QDNSL+HVAKSN++G+VLPT
Sbjct  61   VAPSASIVGDVHIGRSASIWYGCVLRGDVNNVSIGAGTNVQDNSLIHVAKSNISGRVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG NVT+GHSAVLHGCTVEDEAF+G GAT+LDG VVEKN+M+AAGALVRQNTRIP
Sbjct  121  TIGKNVTIGHSAVLHGCTVEDEAFIGTGATVLDGAVVEKNSMVAAGALVRQNTRIP  176



>ref|XP_006383176.1| hypothetical protein POPTR_0005s12280g [Populus trichocarpa]
 gb|ERP60973.1| hypothetical protein POPTR_0005s12280g [Populus trichocarpa]
Length=271

 Score =   322 bits (824),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPVVEKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI G+V VGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASITGNVHVGRSSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NV+VGHSAVLHGCTVEDEAFVG GATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVSVGHSAVLHGCTVEDEAFVGTGATLLDGVCVEKHAMVAAGALVRQNTRIP  176



>gb|ACU19296.1| unknown [Glycine max]
Length=270

 Score =   322 bits (824),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS++GDV VG  SSIWYGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_004232424.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Solanum 
lycopersicum]
Length=270

 Score =   321 bits (823),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGS  +A YTVGFWIRETGQALDRLGCRLQGNYYF E LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAMKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDV +GR +SIWYGCVLRGDVNSVSIG GTN+QDNSL+HVAKSN++GKVLPT
Sbjct  61   VAPSASIIGDVHIGRSASIWYGCVLRGDVNSVSIGAGTNVQDNSLIHVAKSNISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKNAM+AAGA VRQNTRIP
Sbjct  121  IIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNAMVAAGAHVRQNTRIP  176



>gb|EPS71345.1| hypothetical protein M569_03414 [Genlisea aurea]
Length=249

 Score =   320 bits (821),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M SLG+AFYTVGFWIRETGQALDRLG RLQGNY+F EQLSRHR LMNLFDKVP VH++AF
Sbjct  1    MASLGKAFYTVGFWIRETGQALDRLGSRLQGNYHFQEQLSRHRTLMNLFDKVPVVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI GDV +G  SSIWYGCVLRGD   V IGTGTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASITGDVHIGGGSSIWYGCVLRGDAKHVGIGTGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IGNNVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  VIGNNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|XP_006340643.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Solanum tuberosum]
Length=270

 Score =   321 bits (822),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGS  +A YTVGFWIRETGQALDRLGCRLQGNYYF E LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAMKAIYTVGFWIRETGQALDRLGCRLQGNYYFQEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDV +GR +SIWYGCVLRGDVNSVSIG GTN+QDNSL+HVAKSN++GKVLPT
Sbjct  61   VAPSASIIGDVHIGRSASIWYGCVLRGDVNSVSIGAGTNVQDNSLIHVAKSNISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKNAM+AAGA VRQNTRIP
Sbjct  121  IIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNAMVAAGAHVRQNTRIP  176



>ref|XP_004291863.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   321 bits (822),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVN++ IG GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGKGSSIWYGCVLRGDVNNIVIGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVVHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>gb|AFK45344.1| unknown [Medicago truncatula]
 gb|KEH40168.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=272

 Score =   321 bits (822),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A Y+VGFWIRETGQA+DRLG RLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGKAIYSVGFWIRETGQAIDRLGSRLQGNYYFQEQLSRHRTLMNVFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            +APSAS+IGDV +GR SSIWYGCV+RGDVN++S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   IAPSASVIGDVHIGRGSSIWYGCVMRGDVNNISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQN+RIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNSRIP  176



>ref|XP_003517218.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Glycine 
max]
Length=270

 Score =   320 bits (820),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS++GDV VG  SSIWYGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_008786862.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   320 bits (820),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK+P V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKLPKVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG  SSIWYGCVLRGDVNS+ +GTGTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGGGSSIWYGCVLRGDVNSIRVGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AAG+LVRQN +IP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHGMVAAGSLVRQNAKIP  176



>ref|XP_010679758.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=272

 Score =   320 bits (819),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDK P + ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNVFDKKPLIDKQTF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G  SSIWYGCVLRGDVN++SIG+GTNIQDNSLVHVAK+N+ GKVLPT
Sbjct  61   VAPSASVIGDVQIGCGSSIWYGCVLRGDVNNISIGSGTNIQDNSLVHVAKTNVAGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSA+LHGCTV+DEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAILHGCTVDDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|XP_008788543.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   319 bits (817),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  1    MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPIVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ SSIWYGCVLRGDVN + +G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGQGSSIWYGCVLRGDVNRIRVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDE FVGMGA LLDGVVVEK+ M+AAGALVRQNT+IP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFVGMGAVLLDGVVVEKHGMVAAGALVRQNTKIP  176



>ref|XP_009110271.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Brassica 
rapa]
Length=269

 Score =   318 bits (816),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IG+VQ+GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGNVQIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A++AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAAGALVRQNTRIP  176



>ref|XP_010538097.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Tarenaya 
hassleriana]
Length=277

 Score =   319 bits (817),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGSLGRA YTVGFWIRETGQALDRLGCRLQGN+YF EQLSRHR LMN+FDK PSV ++AF
Sbjct  1    MGSLGRAIYTVGFWIRETGQALDRLGCRLQGNHYFREQLSRHRTLMNVFDKAPSVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G  SSIWYGCVLRGDVN +S+G+ TNIQDNSLVHVAKSN++GKVLPT
Sbjct  61   VAPSASVIGDVQIGGGSSIWYGCVLRGDVNGISVGSWTNIQDNSLVHVAKSNISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCT+EDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNT IP
Sbjct  121  IIGDNVTIGHSAVLHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTIIP  176



>emb|CDX96658.1| BnaA08g22010D [Brassica napus]
Length=269

 Score =   318 bits (816),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IG+VQ+GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGNVQIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A++AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAAGALVRQNTRIP  176



>ref|XP_009590737.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=271

 Score =   318 bits (816),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHE LSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEHLSRHRTLMNLFDKVPVVEKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI+GDV +GR +SIWYGCVLRGDVNSV IG GTN+QDNSL+HVAKSN++G+VLPT
Sbjct  61   VAPSASIVGDVHIGRSASIWYGCVLRGDVNSVIIGAGTNVQDNSLIHVAKSNVSGRVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKN+M+AAGALVRQ TRIP
Sbjct  121  TIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNSMVAAGALVRQKTRIP  176



>ref|XP_004512067.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Cicer 
arietinum]
Length=269

 Score =   318 bits (816),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+AFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN+F+K P VH++AF
Sbjct  1    MGTLGKAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVFNKTPYVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            +APSASI GDVQ+G+ SSIWYGCVLRGDVNS++IG+ TNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   IAPSASITGDVQIGQSSSIWYGCVLRGDVNSITIGSSTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_010679759.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=255

 Score =   318 bits (814),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFW+RE+GQALDRLGCRLQGNY+F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAVYTVGFWVRESGQALDRLGCRLQGNYFFQEQLSRHRTLMNVFDKKPMVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDV++G  SSIWYGC+LRGDVN +SIG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVRIGHRSSIWYGCILRGDVNFISIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAF+G GATLLDGV+VEK+ M+AAG+LVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFIGTGATLLDGVLVEKHGMVAAGSLVRQNTRIP  176



>ref|XP_010931534.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Elaeis 
guineensis]
Length=325

 Score =   320 bits (821),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFWIRETGQA+DRLGCRLQGNYYF EQLSRHR LMN+FDKVP V ++AF
Sbjct  54   MGTLGKAIYTVGFWIRETGQAIDRLGCRLQGNYYFQEQLSRHRTLMNIFDKVPQVDKDAF  113

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG  SSIWYGCVLRGDVNS+ +G+GTN+QDNSLVHVAKSN++GKVLPT
Sbjct  114  VAPSASVIGDVQVGGGSSIWYGCVLRGDVNSIRVGSGTNVQDNSLVHVAKSNISGKVLPT  173

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AAGALVRQNT+IP
Sbjct  174  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKHGMVAAGALVRQNTKIP  229



>ref|NP_564091.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
 sp|Q9FWR5.1|GCA1_ARATH RecName: Full=Gamma carbonic anhydrase 1, mitochondrial; Short=AtCA1; 
Short=GAMMA CA1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF98404.1|AC024609_5 Unknown protein [Arabidopsis thaliana]
 dbj|BAD44650.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01128.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE29870.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
Length=275

 Score =   318 bits (816),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>dbj|BAD43151.1| unknown protein [Arabidopsis thaliana]
Length=275

 Score =   318 bits (816),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_007222873.1| hypothetical protein PRUPE_ppa009923mg [Prunus persica]
 gb|EMJ24072.1| hypothetical protein PRUPE_ppa009923mg [Prunus persica]
Length=272

 Score =   318 bits (815),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR  YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|NP_001185039.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
 gb|AEE29871.1| gamma carbonic anhydrase 1 [Arabidopsis thaliana]
Length=220

 Score =   316 bits (810),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_008220827.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Prunus 
mume]
Length=272

 Score =   318 bits (815),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR  YTVGFWIRETGQA+DRLG RLQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGFWIRETGQAVDRLGSRLQGSYYFKEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>ref|XP_008810436.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Phoenix 
dactylifera]
Length=272

 Score =   318 bits (815),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y VGFWIRETGQA+DRLGCR QGNYYF EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1    MGTLGRAIYAVGFWIRETGQAIDRLGCRFQGNYYFQEQLSRHRTLMNIFDKVPNVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS++GDVQVG+ SSIWYGCVLRGDVNS+ IG+GTNIQDNSLVHVAKSN++G+VL T
Sbjct  61   VAPSASVMGDVQVGQGSSIWYGCVLRGDVNSIRIGSGTNIQDNSLVHVAKSNVSGRVLRT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNT+IP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTKIP  176



>gb|KFK44104.1| hypothetical protein AALP_AA1G216400 [Arabis alpina]
Length=275

 Score =   318 bits (815),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P VH+EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKSPIVHKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+GR SSIWYGCVLRGDVN+V++G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDVNTVTVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDE  +GMGATLLDGVVVEK++++AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETLIGMGATLLDGVVVEKHSIVAAGALVRQNTRIP  176



>ref|XP_004967660.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Setaria 
italica]
Length=263

 Score =   317 bits (813),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+A Y VGFWIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKTPHVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGPGASIWYGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG NVTVGHSAVL GCT+EDEAFVGMGATLLDGV+VEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGENVTVGHSAVLQGCTIEDEAFVGMGATLLDGVIVEKHGMVAAGALVRQNTRIP  176



>ref|XP_009399949.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=272

 Score =   318 bits (814),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y VG WIRETGQA+DRLGCRLQGNY F EQLSRHR LMN+FDKVP+VH++AF
Sbjct  1    MGTLGRAIYAVGCWIRETGQAIDRLGCRLQGNYLFQEQLSRHRTLMNIFDKVPNVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV VG+ SSIWYGCVLRGDVNS+ IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVHVGQGSSIWYGCVLRGDVNSIHIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDG VVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGAVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_003612060.1| Transcription factor APFI-like protein [Medicago truncatula]
 gb|AES95018.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=270

 Score =   317 bits (813),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN++DKVP VH++AF
Sbjct  1    MGTLGRAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVYDKVPYVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            +APSASI GDVQ+G  SSIWYGCVLRGDVN+++IG+ TNIQDNSLVHVAKSNL+G+VLPT
Sbjct  61   IAPSASITGDVQIGHASSIWYGCVLRGDVNNITIGSSTNIQDNSLVHVAKSNLSGRVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIP  176



>ref|XP_009386943.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=272

 Score =   317 bits (813),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLGCRLQGNY F EQLSRHR LMN+FDKVP+VH+ AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGCRLQGNYLFQEQLSRHRTLMNIFDKVPNVHKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP AS+IGDVQVG+ SSIWYGCVLRGDVNS+ +G+ TNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPGASVIGDVQVGQGSSIWYGCVLRGDVNSIHVGSSTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHS VLHGCTVEDEAFVGMGA LLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSVVLHGCTVEDEAFVGMGAVLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_009365039.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=272

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGGYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNT+IP
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTKIP  176



>ref|XP_003612061.1| Transcription factor APFI-like protein [Medicago truncatula]
 gb|AES95019.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=201

 Score =   314 bits (805),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFYTVGFWIRETGQA+DRLG RLQGNY+F EQLSRHR LMN++DKVP VH++AF
Sbjct  1    MGTLGRAFYTVGFWIRETGQAIDRLGSRLQGNYFFQEQLSRHRPLMNVYDKVPYVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            +APSASI GDVQ+G  SSIWYGCVLRGDVN+++IG+ TNIQDNSLVHVAKSNL+G+VLPT
Sbjct  61   IAPSASITGDVQIGHASSIWYGCVLRGDVNNITIGSSTNIQDNSLVHVAKSNLSGRVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIP  176



>ref|XP_011011740.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011011741.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
 ref|XP_011011742.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Populus 
euphratica]
Length=271

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYSVGFWIRETGQALDRLGCRLQGNYYFKEQLSRHRTLMNVFDKAPVVEKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI G+V VGR SSIWYGCVLRGDVNSVS+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASITGNVHVGRGSSIWYGCVLRGDVNSVSVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NV+VGHSAVLHGCTVED +FVG GATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVSVGHSAVLHGCTVEDASFVGPGATLLDGVCVEKHAMVAAGALVRQNTRIP  176



>gb|KHN36089.1| Hypothetical protein glysoja_003212 [Glycine soja]
Length=270

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS++GDV VG  SSIWYGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLL GV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLGGVYVEKHAMVAAGALVRQNTRIP  176



>ref|XP_010550419.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Tarenaya 
hassleriana]
Length=265

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+AFY VGFWIRETGQALDRLGCRLQGNYYF E+LSRHR LMN+FDK PSV ++AF
Sbjct  1    MGTLGKAFYNVGFWIRETGQALDRLGCRLQGNYYFREELSRHRTLMNVFDKAPSVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV+VG  SSIWYGCVLRGD NS+S+G GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASVIGDVRVGHGSSIWYGCVLRGDANSISVGAGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GH AVLHGCT+EDEAF+G  ATLLDG  VEK+AM+A+GALVRQNTRIP
Sbjct  121  IIGDNVTIGHGAVLHGCTIEDEAFIGTSATLLDGAYVEKHAMVASGALVRQNTRIP  176



>gb|AAM61583.1| unknown [Arabidopsis thaliana]
Length=275

 Score =   317 bits (812),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_009336133.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Pyrus 
x bretschneideri]
Length=272

 Score =   317 bits (811),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGGYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNLTGKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLTGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVV+EK+AM+AAG+LVRQNT+IP
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVIEKHAMVAAGSLVRQNTKIP  176



>ref|XP_008364986.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Malus 
domestica]
Length=272

 Score =   317 bits (811),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLNGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRIP  176



>ref|XP_002455477.1| hypothetical protein SORBIDRAFT_03g011540 [Sorghum bicolor]
 gb|EES00597.1| hypothetical protein SORBIDRAFT_03g011540 [Sorghum bicolor]
Length=263

 Score =   316 bits (809),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGPGASIWYGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_007156970.1| hypothetical protein PHAVU_002G032600g [Phaseolus vulgaris]
 gb|ESW28964.1| hypothetical protein PHAVU_002G032600g [Phaseolus vulgaris]
Length=270

 Score =   316 bits (809),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVH++AF
Sbjct  1    MGTLGRAFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKGPSVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS++GDV VG  SSIWYGCVLRGDVN + IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNGIVIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  176



>gb|KCW68228.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=269

 Score =   316 bits (809),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 163/176 (93%), Gaps = 4/176 (2%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTV    VLHGCTVEDEAFVGMGATLLDGVVVEK+ M+A GALVRQNTRIP
Sbjct  121  IIGDNVTV----VLHGCTVEDEAFVGMGATLLDGVVVEKHGMVAGGALVRQNTRIP  172



>ref|XP_009365536.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Pyrus x 
bretschneideri]
Length=272

 Score =   316 bits (809),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSRHRTLMNVFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRGDVN++ +G+GTNIQDNSLVHVAKSNL+GK LPT
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRGDVNNIVVGSGTNIQDNSLVHVAKSNLSGKALPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRIP  176



>emb|CDM82924.1| unnamed protein product [Triticum aestivum]
Length=262

 Score =   315 bits (808),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + +AFY VGFWIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VH+EAFVAP
Sbjct  1    MAKAFYAVGFWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKAPHVHKEAFVAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SAS+IGDV+VG+ SSIWYGC+LRGD N+V +G+GTNIQDNS+VHVAKSNL+GKV PTIIG
Sbjct  61   SASLIGDVEVGQGSSIWYGCILRGDANNVQVGSGTNIQDNSVVHVAKSNLSGKVFPTIIG  120

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  DNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  173



>gb|ACU23675.1| unknown [Glycine max]
Length=270

 Score =   316 bits (809),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR FY VGFWIRETGQA+DRLG RLQGNY F EQLSRHR LMNLFDK PSVHR+AF
Sbjct  1    MGTLGRVFYAVGFWIRETGQAIDRLGSRLQGNYLFQEQLSRHRPLMNLFDKAPSVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS++GDV VG  SSIWYGCVLRGDVNS++IG+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASLLGDVHVGPASSIWYGCVLRGDVNSITIGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVL GCTVEDEAF+GMG TLLDGV VEK+A +AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFIGMGVTLLDGVYVEKHATVAAGALVRQNTRIP  176



>gb|EYU31197.1| hypothetical protein MIMGU_mgv1a012119mg [Erythranthe guttata]
Length=261

 Score =   315 bits (807),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            LGR+  TVGFWIRETGQALDRLGCRLQGNY+F EQLSRHR LMNLFDK P V ++ FVAP
Sbjct  3    LGRSICTVGFWIRETGQALDRLGCRLQGNYFFQEQLSRHRTLMNLFDKAPFVQKDVFVAP  62

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SASIIGDV VG +SSIWYGCV+RGDVN VSIG+GTNIQDNSLVHVAKSNL GKVLPT+IG
Sbjct  63   SASIIGDVHVGSNSSIWYGCVVRGDVNKVSIGSGTNIQDNSLVHVAKSNLYGKVLPTLIG  122

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +NVTVGHSA+LHGCTVEDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  123  DNVTVGHSAILHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  175



>ref|XP_003567426.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Brachypodium 
distachyon]
Length=260

 Score =   315 bits (807),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + +AFY VGFWIRETGQALDRLG RLQGNY+FHEQ+SRHR LMN+FDK P VHREAFVAP
Sbjct  1    MAKAFYAVGFWIRETGQALDRLGSRLQGNYFFHEQISRHRTLMNIFDKAPYVHREAFVAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SAS+IGDVQVG+ SSIWYGCVLRGD N+V IG+GTNIQDNS+VHVAKSNL+GKV PTIIG
Sbjct  61   SASLIGDVQVGQGSSIWYGCVLRGDANNVQIGSGTNIQDNSVVHVAKSNLSGKVFPTIIG  120

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  DNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  173



>emb|CDX83758.1| BnaC08g18870D [Brassica napus]
Length=269

 Score =   315 bits (806),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IG+VQ+GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV  T
Sbjct  61   VAPSASVIGNVQIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVPAT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDEAF+GMGATLLDGVVVEK+A++AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDEAFIGMGATLLDGVVVEKHALVAAGALVRQNTRIP  176



>ref|XP_010477178.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
 ref|XP_010477179.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
Length=269

 Score =   315 bits (806),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+GR SSIWYGCVLRGD NSVS+G+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDANSVSVGSGTNIQDNSLLHVAKSNLSGKVHPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_010459631.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010459632.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial isoform 
X2 [Camelina sativa]
Length=269

 Score =   314 bits (805),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+GR SSIWYGCVLRGD N+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>gb|AFK48594.1| unknown [Lotus japonicus]
Length=273

 Score =   313 bits (803),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFIQEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ SSIWYG VLRGDVNS+ +G+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASVIGDVQVGKGSSIWYGTVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLGGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNT++P
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKVP  176



>dbj|BAD44607.1| unknown protein [Arabidopsis thaliana]
Length=275

 Score =   313 bits (802),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWI ETGQALDRLGCRLQG  YF EQLSRHR  MN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWILETGQALDRLGCRLQGKNYFREQLSRHRTQMNVFDKAPIVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_008655471.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Zea 
mays]
 gb|AFW79496.1| hypothetical protein ZEAMMB73_562884 [Zea mays]
Length=263

 Score =   312 bits (800),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 144/176 (82%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VHR+AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ +SIWYGCVLRGD N++ IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGQGASIWYGCVLRGDANNIQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVT+GHSAVL GCTVEDEAFVGMGATLLDGVVV K+ M+AAG+LVRQNTRIP
Sbjct  121  IIGNNVTIGHSAVLQGCTVEDEAFVGMGATLLDGVVVGKHGMVAAGSLVRQNTRIP  176



>ref|XP_003523810.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Glycine 
max]
 gb|KHN45863.1| Hypothetical protein glysoja_023086 [Glycine soja]
Length=276

 Score =   313 bits (801),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VG WIRETGQA+DRLG RLQG YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYSVGNWIRETGQAIDRLGSRLQGGYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+GR SSIWYG VLRGDVNS+ +G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQLGRGSSIWYGVVLRGDVNSIRVGNGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIP  176



>ref|XP_006305516.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
 gb|EOA38414.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
Length=275

 Score =   313 bits (801),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKAPIVDKTAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+GR SSIWYGCVLRGD N+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVE++ F+GMGATLLDGVVVE++ M+AAGALVRQNTRIP
Sbjct  121  IIGDNVTIGHSAVLHGCTVENQTFIGMGATLLDGVVVEEHGMVAAGALVRQNTRIP  176



>ref|XP_009799510.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like isoform 
X1 [Nicotiana sylvestris]
Length=284

 Score =   313 bits (801),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 164/189 (87%), Gaps = 13/189 (7%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGS G+A YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMNLFDKVP V ++AF
Sbjct  1    MGSAGKAIYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNLFDKVPVVEKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI+GDV +GR +SIWYGCVLRGDVN+VSIG GTN+QDNSL+HVAKSN++G+VLPT
Sbjct  61   VAPSASIVGDVHIGRSASIWYGCVLRGDVNNVSIGAGTNVQDNSLIHVAKSNISGRVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVED-------------EAFVGMGATLLDGVVVEKNAMIAAGA  613
             IG NVT+GHSAVLHGCTVED             EAF+G GAT+LDG VVEKN+M+AAGA
Sbjct  121  TIGKNVTIGHSAVLHGCTVEDEAFIGTGATVLDXEAFIGTGATVLDGAVVEKNSMVAAGA  180

Query  614  LVRQNTRIP  640
            LVRQNTRIP
Sbjct  181  LVRQNTRIP  189



>ref|XP_010498381.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Camelina 
sativa]
Length=269

 Score =   311 bits (798),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQLSRHR LMN+FDK P V + AF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQLSRHRTLMNVFDKTPIVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+GR SSIWYGCVLRGD N+VS+G+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSLVHVAKSNLSGKVHPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLHGCTVE+E F+GMGATLLDGVVVEK+ M+AAGALVRQNT IP
Sbjct  121  IIGDNVTIGHSAVLHGCTVENETFIGMGATLLDGVVVEKHGMVAAGALVRQNTTIP  176



>dbj|BAK01732.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   311 bits (797),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/173 (83%), Positives = 160/173 (92%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + +AFY VG WIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VH+EAFVAP
Sbjct  1    MTKAFYAVGLWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKAPHVHKEAFVAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SAS+IGDV+VG  SSIWYGCVLRGD N+V +G+GTNIQDNS+VHVAKSNL+GKV PTIIG
Sbjct  61   SASLIGDVEVGPGSSIWYGCVLRGDANNVQVGSGTNIQDNSVVHVAKSNLSGKVFPTIIG  120

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  DNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALVRQNTRIP  173



>ref|XP_008388037.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial [Malus domestica]
Length=272

 Score =   311 bits (798),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQA+DRLG  LQG+YYF EQLS+HR LMN+F+K P V ++ F
Sbjct  1    MGTLGRAIYTVGFWIRETGQAIDRLGSSLQGSYYFKEQLSQHRTLMNVFNKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDVQVGR SSIWYGCVLRGDVN++ +G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLRGDVNNIVVGYGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNT+IP
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTKIP  176



>ref|XP_008672300.1| PREDICTED: uncharacterized protein LOC100217184 isoform X1 [Zea 
mays]
 gb|ACN28454.1| unknown [Zea mays]
 tpg|DAA54232.1| TPA: transcription factor APFI [Zea mays]
Length=262

 Score =   311 bits (796),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_010523601.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Tarenaya 
hassleriana]
Length=276

 Score =   311 bits (796),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQALDRLG RLQG++Y  EQLSRHR LMN+FDK P V ++AF
Sbjct  1    MGTLGRAIYTVGFWIRETGQALDRLGYRLQGSHYLQEQLSRHRTLMNVFDKAPLVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ  R SSIWYGCVLRGDVN +S+G+ TNIQDN+LVHVAKSN++GKVLPT
Sbjct  61   VAPSASVIGDVQXXRASSIWYGCVLRGDVNGISVGSRTNIQDNALVHVAKSNISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGALVRQNTRIP  176



>tpg|DAA54233.1| TPA: hypothetical protein ZEAMMB73_935334 [Zea mays]
Length=222

 Score =   308 bits (790),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|NP_001137016.1| uncharacterized protein LOC100217184 [Zea mays]
 gb|ACF83081.1| unknown [Zea mays]
Length=222

 Score =   308 bits (790),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 143/176 (81%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>gb|ACU22925.1| unknown [Glycine max]
Length=211

 Score =   308 bits (789),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/176 (83%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VG WIRETGQA+DRLG RL G YYF EQLSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYSVGNWIRETGQAIDRLGSRLHGGYYFQEQLSRHRTLMNIFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+GR SSIWYG VLRGDVNS+ +G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQLGRGSSIWYGVVLRGDVNSIRVGNGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNTRIP
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIP  176



>gb|AFK46651.1| unknown [Lotus japonicus]
Length=273

 Score =   310 bits (794),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 162/176 (92%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFILEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ SSIWYG VLRGDV+S+ +G+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASVIGDVQVGKGSSIWYGTVLRGDVSSIRVGSGTNIQDNSLVHVAKSNLGGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNT++P
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKVP  176



>dbj|BAB39954.1| OSJNBa0004B13.8 [Oryza sativa Japonica Group]
Length=257

 Score =   308 bits (790),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+AFY VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHR LMN+FDK P VHR+AF
Sbjct  1    MAGLGKAFYAVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRTLMNIFDKTPHVHRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGD+QVG+ +SIWYGCVLRGD N+V IG+GTNIQDNSLVHVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDIQVGQGASIWYGCVLRGDANNVQIGSGTNIQDNSLVHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  619
            IIG+NVTVGHSAVL GCTVEDEAFVGMGATLLDGVVVEK+ M+AAGAL+
Sbjct  121  IIGDNVTVGHSAVLQGCTVEDEAFVGMGATLLDGVVVEKHGMVAAGALL  169



>gb|ACG35255.1| transcription factor APFI [Zea mays]
Length=262

 Score =   307 bits (787),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+A Y VGFWIRETGQALDRLGCRLQG Y+FHEQ+SRHR +MN+FDK P VH++AF
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGKYFFHEQISRHRTIMNIFDKTPHVHKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG  +SIWYGCVLRGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  61   VAPSASLIGDVQVGSGASIWYGCVLRGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IGNNVTV HSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  121  TIGNNVTVCHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIP  176



>ref|XP_010484635.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial-like [Camelina 
sativa]
Length=258

 Score =   307 bits (786),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPNVDKKAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP+ASI GDV VGR SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALVRQNTRIP  176



>ref|XP_006393845.1| hypothetical protein EUTSA_v10004794mg [Eutrema salsugineum]
 gb|ABB45859.1| hypothetical protein [Eutrema halophilum]
 gb|ESQ31131.1| hypothetical protein EUTSA_v10004794mg [Eutrema salsugineum]
Length=258

 Score =   306 bits (784),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AF
Sbjct  1    MGTMGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASI GDV VGR SSIWYGCVLRGD NS+++G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASITGDVHVGRGSSIWYGCVLRGDANSITVGAGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AM+A+GALVRQNTRIP
Sbjct  121  VIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKQAMVASGALVRQNTRIP  176



>ref|XP_010444788.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Camelina 
sativa]
Length=258

 Score =   305 bits (782),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/176 (81%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPNVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP+ASI GDV VGR SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALVRQNTRIP  176



>ref|XP_002890347.1| F18O14.34 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66606.1| F18O14.34 [Arabidopsis lyrata subsp. lyrata]
Length=299

 Score =   306 bits (784),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 165/200 (83%), Gaps = 24/200 (12%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ----------------------  226
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  YF EQ                      
Sbjct  1    MGTVGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQRKLLRNSSFHSDFEFVVSTAFT  60

Query  227  --LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGT  400
              +SRHR LMN+FDK P V +EAFVAPSAS+IGDVQ+GR SSIWYGCVLRGDVN+VS+G+
Sbjct  61   QLISRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVQIGRGSSIWYGCVLRGDVNTVSVGS  120

Query  401  GTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVV  580
            GTNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVV
Sbjct  121  GTNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVV  180

Query  581  VEKNAMIAAGALVRQNTRIP  640
            VEK+ M+AAGALVRQNTRIP
Sbjct  181  VEKHGMVAAGALVRQNTRIP  200



>ref|NP_001241093.1| uncharacterized protein LOC100805278 [Glycine max]
 gb|ACU23511.1| unknown [Glycine max]
 gb|KHN22241.1| Hypothetical protein glysoja_021997 [Glycine soja]
Length=273

 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VG WIR TGQA+DRLG  LQG YY  EQLSRHR LM++FDK P V  + F
Sbjct  1    MGTLGRAIYSVGNWIRGTGQAIDRLGSLLQGGYYVQEQLSRHRTLMDIFDKAPVVDEDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+GR SSIWYG VLRGDVNS+ +GTGTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQLGRGSSIWYGVVLRGDVNSIRVGTGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAV+HGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVIHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTRIP  176



>gb|AAF79435.1|AC025808_17 F18O14.34 [Arabidopsis thaliana]
Length=298

 Score =   304 bits (778),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 164/199 (82%), Gaps = 23/199 (12%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQ----------------------  226
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG  YF EQ                      
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNYFREQRKILRNSIFHSDFEFVKSEEFR  60

Query  227  -LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTG  403
             +SRHR LMN+FDK P V +EAFVAPSAS+IGDV +GR SSIWYGCVLRGDVN+VS+G+G
Sbjct  61   LVSRHRTLMNVFDKAPIVDKEAFVAPSASVIGDVHIGRGSSIWYGCVLRGDVNTVSVGSG  120

Query  404  TNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVV  583
            TNIQDNSLVHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVEDE F+GMGATLLDGVVV
Sbjct  121  TNIQDNSLVHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVEDETFIGMGATLLDGVVV  180

Query  584  EKNAMIAAGALVRQNTRIP  640
            EK+ M+AAGALVRQNTRIP
Sbjct  181  EKHGMVAAGALVRQNTRIP  199



>ref|XP_011083663.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Sesamum 
indicum]
Length=272

 Score =   303 bits (776),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MGSLGRA YT+G WIR TGQA+DR+GCRLQG+YYF EQLSRHR LM+L DK P V ++AF
Sbjct  1    MGSLGRAIYTLGNWIRVTGQAVDRVGCRLQGSYYFQEQLSRHRTLMDLLDKSPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            +AP AS+IGDVQVG+ SSIWYG VLRGDVNS+ +G+GTNIQDNSLVHVAKSNL GK LPT
Sbjct  61   IAPGASVIGDVQVGQGSSIWYGSVLRGDVNSIHVGSGTNIQDNSLVHVAKSNLGGKELPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVT+GHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNTR+P
Sbjct  121  IIGNNVTIGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRVP  176



>ref|XP_010465384.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial-like [Camelina 
sativa]
Length=258

 Score =   300 bits (769),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKSPSVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP+ASI GDV VGR SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAVLH CTVEDEA++G  AT+LDG  +EK+AM+A+GALVRQNTRIP
Sbjct  121  VIGDNVTVGHSAVLHRCTVEDEAYIGTSATVLDGAHIEKHAMVASGALVRQNTRIP  176



>ref|XP_006393603.1| hypothetical protein EUTSA_v10011707mg [Eutrema salsugineum]
 gb|ESQ30889.1| hypothetical protein EUTSA_v10011707mg [Eutrema salsugineum]
Length=276

 Score =   300 bits (768),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQALDR+G RLQG+ YF E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSRLQGSPYFQEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL+GKV PT
Sbjct  61   VAPSASVIGDVQIGKRSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLSGKVQPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AA ALV++NTRIP
Sbjct  121  IIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAAALVKENTRIP  176



>ref|NP_569036.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
 sp|Q94AU7.1|GCA3_ARATH RecName: Full=Gamma carbonic anhydrase 3, mitochondrial; Short=AtCA3; 
Short=GAMMA CA3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK76458.1| putative ferripyochelin-binding protein [Arabidopsis thaliana]
 gb|AAL85116.1| putative ferripyochelin-binding protein [Arabidopsis thaliana]
 gb|AAM64929.1| ferripyochelin-binding protein-like [Arabidopsis thaliana]
 gb|AED98222.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
Length=258

 Score =   299 bits (766),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++G+AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1    MGTMGKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKTPNVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP+AS+ GDV VGR SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAK+NL+GKVLPT
Sbjct  61   VAPNASLSGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNALVHVAKTNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALVRQNTRIP
Sbjct  121  VIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALVRQNTRIP  176



>gb|ABK26184.1| unknown [Picea sitchensis]
Length=273

 Score =   296 bits (758),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+  Y  GF IRETGQA+DR GCRLQGN+ F EQLSRHR LMN+F+K PS+HR+ F
Sbjct  1    MGTLGKVIYMAGFLIRETGQAIDRFGCRLQGNHGFQEQLSRHRTLMNIFEKAPSLHRDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA+++GDV+VG+ SSIWYG VLRGDVNS+ +G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  61   VAPSAAVMGDVKVGQGSSIWYGSVLRGDVNSIMVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGN VT+GH AVLHGCTVEDEAFVGMGATLLDGVV+EKNAM+AAG+LVRQN RIP
Sbjct  121  IIGNKVTIGHGAVLHGCTVEDEAFVGMGATLLDGVVLEKNAMVAAGSLVRQNARIP  176



>ref|XP_009103523.1| PREDICTED: gamma carbonic anhydrase 3, mitochondrial [Brassica 
rapa]
Length=253

 Score =   294 bits (753),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            +G+A Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3    MGKALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAFVAP  62

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SAS+IG+V VG  SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT+IG
Sbjct  63   SASLIGNVHVGPASSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIG  122

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AM+ +GALVRQNTRIP
Sbjct  123  DNVTIGHSAVLHGCTVEDEAYIGASATVLDGAHVEKQAMVESGALVRQNTRIP  175



>gb|KFK28325.1| hypothetical protein AALP_AA8G501300 [Arabis alpina]
Length=257

 Score =   293 bits (751),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + +AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AFVAP
Sbjct  1    MAKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAFVAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SASI GDV VGR SSIWYGCVLRGD NS+S+G GT+IQDN+L+HVAKSNL+GKVLPT+IG
Sbjct  61   SASITGDVNVGRGSSIWYGCVLRGDANSISVGAGTSIQDNALIHVAKSNLSGKVLPTVIG  120

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +NVT+GHSAVLHGCTVEDEA++   AT+LDG  VEK+AM+A GALVRQNTRIP
Sbjct  121  DNVTIGHSAVLHGCTVEDEAYISASATVLDGAHVEKHAMVAPGALVRQNTRIP  173



>emb|CDY45234.1| BnaA07g12560D [Brassica napus]
Length=253

 Score =   293 bits (750),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 155/173 (90%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            +G+A Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3    MGKALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKQAFVAP  62

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SAS+IG+V VG  SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT+IG
Sbjct  63   SASLIGNVHVGPASSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIG  122

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK AM+ +GALVRQNT+IP
Sbjct  123  DNVTIGHSAVLHGCTVEDEAYIGASATVLDGAHVEKQAMVESGALVRQNTKIP  175



>ref|XP_002894036.1| hypothetical protein ARALYDRAFT_891497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70295.1| hypothetical protein ARALYDRAFT_891497 [Arabidopsis lyrata subsp. 
lyrata]
Length=255

 Score =   293 bits (749),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP
Sbjct  121  LIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIP  176



>ref|XP_002865062.1| gamma CA3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41321.1| gamma CA3 [Arabidopsis lyrata subsp. lyrata]
Length=269

 Score =   293 bits (750),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 159/187 (85%), Gaps = 11/187 (6%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVA  439
            VAP+ASI GDV VGR SSIWYGCVLR           GD NS+S+G GTNIQDN+LVHVA
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRDIPIDLTIYSAGDANSISVGAGTNIQDNALVHVA  120

Query  440  KSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  619
            K+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALV
Sbjct  121  KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  620  RQNTRIP  640
            RQNTRIP
Sbjct  181  RQNTRIP  187



>gb|AFK09615.1| gamma carbonic anhydrase 3 [Arabidopsis kamchatica]
 gb|AFK09617.1| gamma carbonic anhydrase 3 [Arabidopsis halleri subsp. halleri]
Length=269

 Score =   292 bits (748),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 159/187 (85%), Gaps = 11/187 (6%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVA  439
            VAP+ASI GDV VGR SSIWYGCVLR           GD NS+++G GTNIQDN+LVHVA
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRDIPVDLTTYSAGDANSITVGAGTNIQDNALVHVA  120

Query  440  KSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  619
            K+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALV
Sbjct  121  KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  620  RQNTRIP  640
            RQNTRIP
Sbjct  181  RQNTRIP  187



>gb|ADQ43216.1| GAMMA CA3/carbonate dehydratase [Schrenkiella parvula]
Length=255

 Score =   291 bits (745),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 158/176 (90%), Gaps = 3/176 (2%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++GRAFY+VGFWIRETGQALDRLGCRLQG  +F EQ SRHR LMN+FDK PSV +EAF
Sbjct  1    MGTMGRAFYSVGFWIRETGQALDRLGCRLQGKNHFREQ-SRHRTLMNVFDKAPSVDKEAF  59

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIGDV VGR SSIWYGCVLR D NS+S+G GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  60   VAPSASIIGDVHVGRGSSIWYGCVLR-DANSISVGAGTNIQDNSLVHVAKSNLSGKVLPT  118

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVT+ HSAVLHGCTVED+A++G  AT+LDG  VEK AM+A+GALVRQNTRIP
Sbjct  119  VIGDNVTI-HSAVLHGCTVEDKAYIGASATVLDGAHVEKQAMVASGALVRQNTRIP  173



>ref|XP_009612501.1| PREDICTED: gamma carbonic anhydrase 1, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=273

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A Y++G  +R TGQALDR+G RLQG+ Y  E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSLGAIVRATGQALDRIGNRLQGSSYLEEHLSRHRTLMNIFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP AS+IGDV VGR+SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSN++ KVLPT
Sbjct  61   VAPGASVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIP  176



>ref|XP_010463232.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Camelina 
sativa]
Length=195

 Score =   288 bits (738),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+F K P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFGKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  61   VAPSASVIGDVQIGKSSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP
Sbjct  121  LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIP  176



>ref|NP_001078808.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
 gb|AED98223.1| gamma carbonic anhydrase 3 [Arabidopsis thaliana]
Length=269

 Score =   291 bits (744),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 160/187 (86%), Gaps = 11/187 (6%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++G+AFY+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P+V + AF
Sbjct  1    MGTMGKAFYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKTPNVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVA  439
            VAP+AS+ GDV VGR SSIWYGCVLR           GD NS+S+G GTNIQDN+LVHVA
Sbjct  61   VAPNASLSGDVHVGRGSSIWYGCVLRDIPFDLMTDSAGDANSISVGAGTNIQDNALVHVA  120

Query  440  KSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  619
            K+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALV
Sbjct  121  KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  620  RQNTRIP  640
            RQNTRIP
Sbjct  181  RQNTRIP  187



>ref|NP_175159.1| gamma carbonic anhydrase 2 [Arabidopsis thaliana]
 sp|Q9C6B3.1|GCA2_ARATH RecName: Full=Gamma carbonic anhydrase 2, mitochondrial; Short=AtCA2; 
Short=GAMMA CA2; AltName: Full=Transcription factor 
APFI; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG52641.1|AC079677_5 unknown protein; 6976-8939 [Arabidopsis thaliana]
 gb|AAK76653.1| unknown protein [Arabidopsis thaliana]
 gb|AAM44984.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32144.1| gamma carbonic anhydrase 2 [Arabidopsis thaliana]
Length=278

 Score =   291 bits (744),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP
Sbjct  121  LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIP  176



>emb|CDY30772.1| BnaC07g16720D [Brassica napus]
Length=257

 Score =   288 bits (737),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            +GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV ++AFVAP
Sbjct  3    MGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKSPSVDKQAFVAP  62

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SAS+IG+V VG  SSIWYGCVLRGD NS+S+G GTNIQDN+LVHVAKSNL+GKVLPT+IG
Sbjct  63   SASLIGNVHVGPASSIWYGCVLRGDANSISVGAGTNIQDNTLVHVAKSNLSGKVLPTLIG  122

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +NVT+GHSAVLHGCTV+D +++G  AT+LDG  VEK AM+ +GALVRQNTRIP
Sbjct  123  DNVTIGHSAVLHGCTVDDGSYIGASATVLDGAHVEKQAMVESGALVRQNTRIP  175



>gb|AAK28403.1|AF249876_1 transcription factor APFI [Arabidopsis thaliana]
Length=278

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+ ++GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTTISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP
Sbjct  121  LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIP  176



>emb|CDY47592.1| BnaC08g04620D [Brassica napus]
Length=276

 Score =   288 bits (738),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR  YTVG WIR +GQALDR+G  LQG++   E LSRHR LM++FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGNWIRGSGQALDRVGSILQGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL+GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVR+NTRIP
Sbjct  121  TIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRENTRIP  176



>gb|EYU45182.1| hypothetical protein MIMGU_mgv1a011728mg [Erythranthe guttata]
Length=272

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YT+G WIR TG+A+D++G  LQG+ Y  E LSRHR LM +FDK P V ++AF
Sbjct  1    MGTLGKAVYTLGNWIRGTGKAMDKVGSLLQGSSYIEEHLSRHRTLMEIFDKSPVVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            +AP AS+IGDVQVG+ +SIWYG VLRGDVNS+SIG GTNIQDNSLVHVAKSNL+G VLPT
Sbjct  61   IAPGASVIGDVQVGQGASIWYGSVLRGDVNSISIGYGTNIQDNSLVHVAKSNLSGNVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAV+HGCT+EDEAFVGMGATLLDGVVVEK+AM+AAG+LVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVIHGCTIEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRQNTRIP  176



>emb|CDY17034.1| BnaA08g03980D [Brassica napus]
Length=276

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR  YTVG WIR +GQALDR+G  LQG++   E LSRHR LM++FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGNWIRGSGQALDRVGSLLQGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLAGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVR+NTRIP
Sbjct  121  TIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRENTRIP  176



>ref|XP_010500247.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Camelina 
sativa]
 ref|XP_010479124.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Camelina 
sativa]
Length=278

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+F K P V ++ F
Sbjct  1    MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFGKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  61   VAPSASVIGDVQIGKSSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP
Sbjct  121  LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIP  176



>ref|XP_009771198.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Nicotiana 
sylvestris]
Length=273

 Score =   288 bits (736),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A Y++G  +R TGQALDR+G RLQG+ Y  E LSRHR LMN+ DK P V ++ F
Sbjct  1    MGTLGKAIYSLGSIVRATGQALDRVGNRLQGSSYLEEHLSRHRTLMNILDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP AS+IGDV VGR+SSIWYGCVLRGDVNS+S+G+G+NIQDNSLVHVAKSN++ KVLPT
Sbjct  61   VAPGASVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGSNIQDNSLVHVAKSNISQKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGALVRQNTRIP  176



>emb|CDY67628.1| BnaCnng55730D [Brassica napus]
Length=276

 Score =   288 bits (736),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVE +AM+AAG++V++NTRIP
Sbjct  121  TIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAAGSIVKENTRIP  176



>ref|XP_006304043.1| hypothetical protein CARUB_v10009842mg, partial [Capsella rubella]
 gb|EOA36941.1| hypothetical protein CARUB_v10009842mg, partial [Capsella rubella]
Length=306

 Score =   288 bits (738),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQALDR+G  LQG++   E LSRHR LMN+FDK P V ++ F
Sbjct  29   MGTLGRAIYTVGNWIRGTGQALDRVGSLLQGSHRIEEHLSRHRTLMNVFDKSPLVDKDVF  88

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP AS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDN+LVHVAK+N++GKVLPT
Sbjct  89   VAPGASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNTLVHVAKTNISGKVLPT  148

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVEK+AM+AAG+LV+QNTRIP
Sbjct  149  LIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVEKHAMVAAGSLVKQNTRIP  204



>gb|ACJ85087.1| unknown [Medicago truncatula]
Length=226

 Score =   286 bits (731),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VG  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1    MGTLGRAIYSVGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGDVQ+G+ SSIWYG VLRGDVN + IG+GTN+QDNSLVHVAKSNL+GKVLPT
Sbjct  60   VAPSAAVIGDVQIGKGSSIWYGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGKVLPT  119

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNT+IP
Sbjct  120  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKIP  175



>gb|KEH36170.1| gamma carbonic anhydrase-like protein [Medicago truncatula]
Length=272

 Score =   287 bits (734),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 157/176 (89%), Gaps = 1/176 (1%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VG  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1    MGTLGRAIYSVGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGDVQ+G+ SSIWYG VLRGDVN + IG+GTN+QDNSLVHVAKSNL+GKVLPT
Sbjct  60   VAPSAAVIGDVQIGKGSSIWYGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGKVLPT  119

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNT+IP
Sbjct  120  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKIP  175



>gb|AFK09616.1| gamma carbonic anhydrase 3 [Arabidopsis halleri subsp. gemmifera]
Length=269

 Score =   286 bits (733),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 157/187 (84%), Gaps = 11/187 (6%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++G+AFY VGFWIRETGQALDRLGCRLQG  +F EQLS HR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGQALDRLGCRLQGKNHFREQLSTHRTLMNVFDKAPSVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVA  439
            VAP+ASI GDV VGR SSIWYGCVLR           GD NS+++G  TNIQDN+LVHVA
Sbjct  61   VAPNASITGDVHVGRGSSIWYGCVLRDIPVDLTTYSAGDANSITVGARTNIQDNALVHVA  120

Query  440  KSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  619
            K+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALV
Sbjct  121  KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  180

Query  620  RQNTRIP  640
            RQNTRIP
Sbjct  181  RQNTRIP  187



>ref|XP_004238283.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Solanum 
lycopersicum]
Length=273

 Score =   286 bits (731),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A Y++G  +R TG+ALDR+G RLQG+ +  E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSLGSIVRATGKALDRVGNRLQGSSHIEEHLSRHRTLMNVFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP AS+IGDV VGR+SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSN++ KVLPT
Sbjct  61   VAPGASVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AAGALV+QNTRIP
Sbjct  121  IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGALVKQNTRIP  176



>gb|AFK09618.1| gamma carbonic anhydrase 3 [Arabidopsis lyrata subsp. lyrata]
Length=268

 Score =   285 bits (730),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/187 (73%), Positives = 158/187 (84%), Gaps = 12/187 (6%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG++G+AFY VGFWIRETG+ALDRLGCRLQG  +F EQLSRHR LMN+FDK PSV + AF
Sbjct  1    MGTMGKAFYNVGFWIRETGRALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPSVDKGAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLR-----------GDVNSVSIGTGTNIQDNSLVHVA  439
            VAP+ASI GDV VGR  SIWYGCVLR           GD NS+S+G GTNIQDN+LVHVA
Sbjct  61   VAPNASITGDVHVGR-GSIWYGCVLRDIPIDLTIYSAGDANSISVGAGTNIQDNALVHVA  119

Query  440  KSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  619
            K+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+GALV
Sbjct  120  KTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVASGALV  179

Query  620  RQNTRIP  640
            RQNTRIP
Sbjct  180  RQNTRIP  186



>ref|NP_001066265.1| Os12g0169700 [Oryza sativa Japonica Group]
 gb|ABA95932.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29284.1| Os12g0169700 [Oryza sativa Japonica Group]
 gb|EAY82406.1| hypothetical protein OsI_37621 [Oryza sativa Indica Group]
 gb|EAZ19787.1| hypothetical protein OsJ_35366 [Oryza sativa Japonica Group]
 dbj|BAG96313.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P VH++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRVHKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+G+NIQDNSLVHVAK+N++GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGSNIQDNSLVHVAKANISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVT+GHSAVLH CTVEDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP
Sbjct  121  IIGNNVTIGHSAVLHACTVEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIP  176



>emb|CDY50984.1| BnaC02g48920D [Brassica napus]
Length=260

 Score =   285 bits (728),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M S+GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P V +EA 
Sbjct  1    MASMGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPIVDKEAL  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSASIIG+V +G  SSIWYGCVLRGD N++++G GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASIIGNVHLGPGSSIWYGCVLRGDANTITVGAGTNIQDNSLVHVAKSNLNGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IG+NVT+G+SAVLHGCT+EDE+++G  AT+LDG  VEK+A++ +G+LVRQNTRIP
Sbjct  121  LIGDNVTIGNSAVLHGCTLEDESYIGASATVLDGAHVEKHAIVESGSLVRQNTRIP  176



>ref|XP_009145039.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Brassica 
rapa]
Length=276

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS++GDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKV PT
Sbjct  61   VAPSASVLGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVSPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG+NVTVGHSAV+HGCTVED+AFVGMGATLLDGVVVE +AM+AAG++V++NTRIP
Sbjct  121  TIGDNVTVGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAAGSIVKENTRIP  176



>ref|XP_006341958.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Solanum 
tuberosum]
Length=273

 Score =   284 bits (726),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 158/176 (90%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A Y++G  +R TG+ALDR+G RLQG+ +  E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGKAIYSLGSIVRATGKALDRVGNRLQGSSHIEEHLSRHRTLMNIFDKAPVVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP A++IGDV VGR+SSIWYGCVLRGDVNS+S+G+GTNIQDNSLVHVAKSN++ KVLPT
Sbjct  61   VAPGATVIGDVHVGRNSSIWYGCVLRGDVNSISVGSGTNIQDNSLVHVAKSNISQKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAV+HGCT+EDEAF+GMGATLLDGV VEK+AM+AAG+LV+QNTRIP
Sbjct  121  IIGNNVTVGHSAVVHGCTIEDEAFIGMGATLLDGVHVEKHAMVAAGSLVKQNTRIP  176



>gb|AFK41197.1| unknown [Medicago truncatula]
Length=272

 Score =   283 bits (724),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+ G  IR+TGQA+DRLG  LQG Y   EQLSRHR ++N+FDK P + ++ F
Sbjct  1    MGTLGRAIYSAGQLIRKTGQAVDRLGSHLQGGY-IEEQLSRHRTVLNIFDKAPVIDKDVF  59

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGDVQ+G+ SSIWYG VLRGDVN + IG+GTN+QDNSLVHVAKSNL+G VLPT
Sbjct  60   VAPSAAVIGDVQIGKGSSIWYGSVLRGDVNIIRIGSGTNLQDNSLVHVAKSNLSGMVLPT  119

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AAGALVRQNT+IP
Sbjct  120  IIGDNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKNAMVAAGALVRQNTKIP  175



>ref|XP_006663861.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Oryza 
brachyantha]
Length=273

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P +H++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRIHKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+GTNIQDNSLVHV+K+N++GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVSKANISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVT+GHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP
Sbjct  121  IIGSNVTIGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIP  176



>ref|XP_009107430.1| PREDICTED: LOW QUALITY PROTEIN: gamma carbonic anhydrase 2, mitochondrial-like 
[Brassica rapa]
Length=276

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR  YTVG WI  +GQALDR+G  L G++   E LSRHR LM++FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGNWICGSGQALDRIGSLLXGSHRLEEHLSRHRTLMSVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKVLPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLAGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG+NVTVGHSAV+HGCTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LVR+NTRIP
Sbjct  121  TIGDNVTVGHSAVIHGCTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVRENTRIP  176



>ref|XP_002463275.1| hypothetical protein SORBIDRAFT_02g041030 [Sorghum bicolor]
 gb|EER99796.1| hypothetical protein SORBIDRAFT_02g041030 [Sorghum bicolor]
Length=273

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA +TVG WIR TGQA+DRLG  LQG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1    MGTLGRAIFTVGKWIRGTGQAMDRLGSTLQGGLRVEEQVSRHRTIMNIFEKEPKIHRDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+GTNIQDNSLVHVAK+N +GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVAKANFSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGV+VEK++M+ AG+LV+QNTRIP
Sbjct  121  IIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVLVEKHSMVGAGSLVKQNTRIP  176



>ref|NP_001169012.1| uncharacterized protein LOC100382844 [Zea mays]
 gb|ACN31405.1| unknown [Zea mays]
Length=273

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 156/176 (89%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA +TVG WIR TGQA+DRLG  +QG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1    MGTLGRAIFTVGKWIRGTGQAMDRLGSTIQGGLRVEEQVSRHRTIMNIFEKEPRIHRDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+GTNIQDNSLVHV+K+N++GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVSKANISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP
Sbjct  121  IIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIP  176



>gb|KFK36155.1| hypothetical protein AALP_AA4G085200 [Arabis alpina]
Length=276

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 154/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR  YTVG  IR TGQALDR+G  LQG + F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRVIYTVGKAIRVTGQALDRVGSTLQGGHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+G+ SSIWYGCVLRGDVN++SIG+GTNIQDNSLVHVAK+NL+ K LPT
Sbjct  61   VAPSASVIGDVQIGKGSSIWYGCVLRGDVNNISIGSGTNIQDNSLVHVAKTNLSNKSLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG+NVT+GHSAV+H CTVEDEAFVGMGATLLDGVVVEK+AM+AAG+LV+ NTRIP
Sbjct  121  TIGDNVTIGHSAVIHACTVEDEAFVGMGATLLDGVVVEKHAMVAAGSLVKGNTRIP  176



>gb|AFK40628.1| unknown [Lotus japonicus]
Length=193

 Score =   277 bits (709),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/161 (82%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA Y+VGFWIRETGQA+DRLG RLQG Y+  EQLSRHR LMN+FDK P+V ++ F
Sbjct  1    MGTLGRAIYSVGFWIRETGQAIDRLGSRLQGGYFIQEQLSRHRTLMNIFDKAPTVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVG+ SSIWYG VLRGDVNS+ +G+GTNIQDNSLVHVAKSNL GKVLPT
Sbjct  61   VAPSASVIGDVQVGKGSSIWYGTVLRGDVNSIRVGSGTNIQDNSLVHVAKSNLGGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNA  595
            IIGNNVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEK  
Sbjct  121  IIGNNVTVGHSAVLHGCTVEDEAFVGMGAILLDGVVVEKKC  161



>emb|CDY23649.1| BnaA05g17800D [Brassica napus]
Length=277

 Score =   280 bits (715),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 132/177 (75%), Positives = 158/177 (89%), Gaps = 1/177 (1%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR +GQALDR+G  LQG++ F E LSRHR LMN+FDK P V ++ F
Sbjct  1    MGTLGRAIYTVGKWIRGSGQALDRVGSLLQGSHRFEEHLSRHRTLMNVFDKSPLVDKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS++GDVQ+G+ SSIWYGCVLRGDVN++S+G+GTNIQDNSLVHVAK+NL GKV PT
Sbjct  61   VAPSASVLGDVQIGKGSSIWYGCVLRGDVNNISVGSGTNIQDNSLVHVAKTNLGGKVSPT  120

Query  473  IIGNNVTV-GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG+NVTV GHSAV+HGCTVED+AFVGMGATLLDGVVVE +AM+AAG++V++NTRIP
Sbjct  121  TIGDNVTVAGHSAVIHGCTVEDDAFVGMGATLLDGVVVETHAMVAAGSIVKENTRIP  177



>gb|EAZ04886.1| hypothetical protein OsI_27068 [Oryza sativa Indica Group]
Length=273

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     EQLSRHR +MN+F+K P +H++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSTIQGGLRVEEQLSRHRTIMNIFEKEPRIHKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG GTNIQDNSLVHV+K+N++GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGAGTNIQDNSLVHVSKANISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGN VT+GHSAVLH C VEDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP
Sbjct  121  IIGNRVTIGHSAVLHACIVEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIP  176



>ref|XP_004958498.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial-like [Setaria 
italica]
Length=273

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA +TVG WIR TGQA+DRLG  LQG     EQ+SRHR +MN+F+K P +HR+ F
Sbjct  1    MGTLGRAIFTVGKWIRGTGQAMDRLGSTLQGGLRVEEQVSRHRTIMNIFEKEPRIHRDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+GTNIQDNSLVHV++SN++ KVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGTNIQDNSLVHVSRSNISRKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP
Sbjct  121  IIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIP  176



>ref|NP_001060439.1| Os07g0642900 [Oryza sativa Japonica Group]
 dbj|BAC16488.1| putative transcription factor APFI [Oryza sativa Japonica Group]
 dbj|BAD30257.1| putative transcription factor APFI [Oryza sativa Japonica Group]
 dbj|BAF22353.1| Os07g0642900 [Oryza sativa Japonica Group]
 gb|EAZ40840.1| hypothetical protein OsJ_25319 [Oryza sativa Japonica Group]
 dbj|BAG87352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YT G WIR TGQA+DRLG  +QG     EQL RHR +MN+F+K P +H++ F
Sbjct  1    MGTLGRAIYTAGKWIRGTGQAMDRLGSTIQGGLRVDEQLPRHRTIMNIFEKEPRIHKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGD+++G  SSIWYG +LRGDVNS+ IG GTNIQDNSLVHV+K+N++GKVLPT
Sbjct  61   VAPSAAVIGDIEIGHGSSIWYGSILRGDVNSIHIGVGTNIQDNSLVHVSKANISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGN+VT+GHSAVLH C VEDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP
Sbjct  121  IIGNSVTIGHSAVLHACIVEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIP  176



>ref|XP_002968991.1| hypothetical protein SELMODRAFT_145865 [Selaginella moellendorffii]
 ref|XP_002990654.1| hypothetical protein SELMODRAFT_448100 [Selaginella moellendorffii]
 gb|EFJ08286.1| hypothetical protein SELMODRAFT_448100 [Selaginella moellendorffii]
 gb|EFJ30107.1| hypothetical protein SELMODRAFT_145865 [Selaginella moellendorffii]
Length=266

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = +2

Query  125  GRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPS  304
            GRA Y +GFWIRETGQALDRLGCR+QGNY F EQL+RHR LMNL+DK P V    F+APS
Sbjct  3    GRALYQIGFWIRETGQALDRLGCRIQGNYIFREQLNRHRTLMNLYDKKPEVMENVFIAPS  62

Query  305  ASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGN  484
            A++IGDV V   SSIWYGCVLRGDVN + +G GTNIQDN+LVHVA++ ++GKV PTIIG+
Sbjct  63   ATLIGDVSVAGGSSIWYGCVLRGDVNEIRVGYGTNIQDNTLVHVARTGMSGKVAPTIIGD  122

Query  485  NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             VT+GH+AVLH CTV+DE+FVGMGATLLDGV VEK AM+ AG+LV QNTRIP
Sbjct  123  AVTIGHNAVLHACTVDDESFVGMGATLLDGVYVEKGAMVGAGSLVTQNTRIP  174



>gb|EPS62312.1| hypothetical protein M569_12479, partial [Genlisea aurea]
Length=267

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 152/176 (86%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A Y +G WIR  GQA+DRLG  +QG Y+  E +S+HR L+ L +K P V ++AF
Sbjct  1    MGTLGKAVYRLGSWIRVAGQAVDRLGSTVQGGYFVPETISKHRTLLALSEKTPIVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            +APS+S+IGDVQVG  SSIWYG VLRGDVNS+S+GTGTNIQDNSLVHVAKSN+ GK LPT
Sbjct  61   IAPSSSVIGDVQVGSGSSIWYGAVLRGDVNSISVGTGTNIQDNSLVHVAKSNIGGKELPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGNNVTVGHSAV+HGCT++DEAF+GMGATLLDGV VEK++M+ AG+LVRQNTRIP
Sbjct  121  IIGNNVTVGHSAVIHGCTIDDEAFIGMGATLLDGVTVEKHSMVGAGSLVRQNTRIP  176



>ref|XP_003562574.1| PREDICTED: gamma carbonic anhydrase 2, mitochondrial [Brachypodium 
distachyon]
Length=275

 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVG WIR TGQA+DRLG  +QG     E +SRHR +M +F+K P ++++ F
Sbjct  1    MGTLGRAIYTVGKWIRGTGQAMDRLGSAVQGGLRAEEHVSRHRTIMGIFEKEPRINKDVF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSA++IGDV++G  SSIWYG +LRGDVN++ IG+G+NIQDNSLVHV+KSN++GKVLPT
Sbjct  61   VAPSAAVIGDVEIGHGSSIWYGSILRGDVNTIQIGSGSNIQDNSLVHVSKSNISGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGN VTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ AG+LV+QNTRIP
Sbjct  121  IIGNKVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGAGSLVKQNTRIP  176



>emb|CDY55089.1| BnaA02g34770D [Brassica napus]
Length=258

 Score =   271 bits (694),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 151/173 (87%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            +GRA Y+VGFWIRETGQALDRLGCRLQG  +F EQLSRHR LMN+FDK P V ++AFVAP
Sbjct  1    MGRALYSVGFWIRETGQALDRLGCRLQGKNHFREQLSRHRTLMNVFDKAPLVDKDAFVAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SASIIG+V +G  SSIWYGCVLRGD N++++G GTNIQDNSLVHVAKSNL GKVLPT+IG
Sbjct  61   SASIIGNVHLGPGSSIWYGCVLRGDANTITVGAGTNIQDNSLVHVAKSNLNGKVLPTLIG  120

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +NVT+ +SA+L GCT+EDE+++G  AT+LDG  VEK+A++ +GALVR NTRIP
Sbjct  121  DNVTIRNSALLLGCTLEDESYIGASATVLDGAHVEKHAIVESGALVRHNTRIP  173



>ref|XP_001754319.1| predicted protein [Physcomitrella patens]
 gb|EDQ80769.1| predicted protein [Physcomitrella patens]
Length=248

 Score =   263 bits (673),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 140/171 (82%), Gaps = 0/171 (0%)
 Frame = +2

Query  128  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  307
            RA YTVGFWIRETGQALDR GCRLQGNY F E+LSRH+ L NLFDK P V  +AFVAPSA
Sbjct  4    RALYTVGFWIRETGQALDRAGCRLQGNYVFREELSRHKTLFNLFDKKPVVAEDAFVAPSA  63

Query  308  SIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNN  487
            S++GDVQVG  SSIWYGCVLRGD + + +G+ TNIQD+SLV V  S   G   P +IGN 
Sbjct  64   SLVGDVQVGPKSSIWYGCVLRGDASGIRVGSETNIQDHSLVSVGGSRFGGGHAPAVIGNR  123

Query  488  VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VT+GHSAV+H CTVEDEAFVGMGATL+DGVVVEK A +AAG+LV +NTRIP
Sbjct  124  VTIGHSAVIHACTVEDEAFVGMGATLMDGVVVEKGAFVAAGSLVTENTRIP  174



>gb|ACG33606.1| transcription factor APFI [Zea mays]
Length=250

 Score =   256 bits (655),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  188  GCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVL  367
            G R  G Y+FHEQ+SRHR +MN+FDK P VH++AFVAPSAS+IGDVQVG  +SIWYGCVL
Sbjct  14   GRRGGGKYFFHEQISRHRTIMNIFDKTPHVHKDAFVAPSASLIGDVQVGSGASIWYGCVL  73

Query  368  RGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFV  547
            RGD N + IG+GTNIQDNSL+HVAKSNL+GKV PT IGNNVTVGHSAVL GCTVEDEAFV
Sbjct  74   RGDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPTTIGNNVTVGHSAVLQGCTVEDEAFV  133

Query  548  GMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            G+GATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  134  GIGATLLDGVVVEKHGMVAAGALVRQNTRIP  164



>ref|XP_006416491.1| hypothetical protein EUTSA_v10008724mg [Eutrema salsugineum]
 gb|ESQ34844.1| hypothetical protein EUTSA_v10008724mg [Eutrema salsugineum]
Length=221

 Score =   253 bits (646),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 136/163 (83%), Gaps = 0/163 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRAFY+VGFWIRETGQALDRLGCRLQG   F EQLSRHR LMN+FDK P V +EAF
Sbjct  1    MGTLGRAFYSVGFWIRETGQALDRLGCRLQGKNCFREQLSRHRTLMNVFDKAPIVDKEAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQ+GR SSIWYGCVLRGD N+V++G+GTNIQDNSLVHVAKSNL+GKVLPT
Sbjct  61   VAPSASVIGDVQIGRGSSIWYGCVLRGDANTVTVGSGTNIQDNSLVHVAKSNLSGKVLPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMI  601
            IIG+NVT+GHSAVLHGCTV      G     L G   ++ A +
Sbjct  121  IIGDNVTIGHSAVLHGCTVRIRPLSGWVRHFLTGSWSKRMAWL  163



>gb|KCW68230.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=241

 Score =   252 bits (644),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  FHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSI  394
             H  +SRHR LMN+FDK P V ++AFVAPSASIIGDVQVGR SSIWYGCVLRGDVNS+S+
Sbjct  3    IHLSVSRHRTLMNIFDKAPVVDKDAFVAPSASIIGDVQVGRGSSIWYGCVLRGDVNSISV  62

Query  395  GTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDG  574
            G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDG
Sbjct  63   GSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDG  122

Query  575  VVVEKNAMIAAGALVRQNTRIP  640
            VVVEK+ M+A GALVRQNTRIP
Sbjct  123  VVVEKHGMVAGGALVRQNTRIP  144



>gb|KJB43471.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=226

 Score =   243 bits (619),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/131 (89%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  427
            MN+FDK P V R+AFVAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+SIG+GTNIQDNSL
Sbjct  1    MNVFDKAPIVDRDAFVAPSASVIGDVQVGRSSSIWYGCVLRGDVNSISIGSGTNIQDNSL  60

Query  428  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  607
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AA
Sbjct  61   VHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAA  120

Query  608  GALVRQNTRIP  640
            GALVRQNTRIP
Sbjct  121  GALVRQNTRIP  131



>ref|XP_007136607.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
 gb|ESW08601.1| hypothetical protein PHAVU_009G0592001g, partial [Phaseolus vulgaris]
Length=134

 Score =   239 bits (610),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/131 (87%), Positives = 125/131 (95%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  427
            MN+FDK P V ++AFVAPSAS+IGDVQVGR SSIWYGCVLRGDVNS+ +G+GTNIQDNSL
Sbjct  1    MNIFDKAPVVDKDAFVAPSASVIGDVQVGRGSSIWYGCVLRGDVNSIRVGSGTNIQDNSL  60

Query  428  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  607
            VHVAKSNL+GKVLPT+IG+NVTVGHSAVLHGCTVEDEAFVGMGA LLDGVVVEKNAM+AA
Sbjct  61   VHVAKSNLSGKVLPTVIGDNVTVGHSAVLHGCTVEDEAFVGMGAVLLDGVVVEKNAMVAA  120

Query  608  GALVRQNTRIP  640
            GALVRQNTRIP
Sbjct  121  GALVRQNTRIP  131



>ref|XP_001776500.1| predicted protein [Physcomitrella patens]
 gb|EDQ58633.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 146/176 (83%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR  +++G   R TGQALDRLG RLQG   F +++S+H+ ++++FDK P +   AF
Sbjct  1    MGTLGRVVFSLGKAARTTGQALDRLGSRLQGGNTFKDEVSKHQTVLSIFDKKPVIEESAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP AS++G+V++G+ SS+WYGCVLRGDV+ + +G+ TNIQDN++VHVAK+N++G V PT
Sbjct  61   VAPGASVVGEVEIGKQSSVWYGCVLRGDVHHIKVGSETNIQDNTVVHVAKTNVSGNVEPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            +IGN VT+GH++VLH CTVEDE+FVGMG+T+LDG VVEK AM+AAG++V Q TR+P
Sbjct  121  VIGNRVTIGHNSVLHACTVEDESFVGMGSTILDGAVVEKGAMVAAGSVVTQRTRVP  176



>gb|AFK37757.1| unknown [Medicago truncatula]
Length=149

 Score =   233 bits (594),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/131 (84%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  427
            MN+FDK P V ++AF+APSAS+IGDV +GR SSIWYGCV+RGDVN++S+G+GTNIQDNSL
Sbjct  1    MNVFDKAPVVGKDAFIAPSASVIGDVHIGRGSSIWYGCVMRGDVNNISVGSGTNIQDNSL  60

Query  428  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  607
            VHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK+AM+AA
Sbjct  61   VHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKHAMVAA  120

Query  608  GALVRQNTRIP  640
            GALVRQN+RIP
Sbjct  121  GALVRQNSRIP  131



>gb|ACV52585.1| transcription factor APFI-like protein, partial [Nicotiana benthamiana]
Length=152

 Score =   233 bits (593),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  236  HRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQ  415
            HR LMNLFDKVP V ++AFVAPSASI+GDV +G  +SIWYGCVLRGDVNSVSIG GTN+Q
Sbjct  1    HRTLMNLFDKVPVVDKDAFVAPSASIVGDVHIGHSASIWYGCVLRGDVNSVSIGAGTNVQ  60

Query  416  DNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNA  595
            DNSL+HVAKSN++G+V PT IG NVT+GHSAVLHGCTVEDEAF+GMGAT+LDG VVEKN+
Sbjct  61   DNSLIHVAKSNISGRVSPTTIGKNVTIGHSAVLHGCTVEDEAFIGMGATVLDGAVVEKNS  120

Query  596  MIAAGALVRQNTRIP  640
            M+AAGALVRQNTRIP
Sbjct  121  MVAAGALVRQNTRIP  135



>ref|XP_001758123.1| predicted protein [Physcomitrella patens]
 gb|EDQ76945.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGR  +++G   R TGQALDRLG RLQG Y F +++S+H+ ++ +F+K P +   AF
Sbjct  1    MGTLGRVVFSLGKAARSTGQALDRLGSRLQGGYVFKDEVSKHQTILGIFNKKPVIEESAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP AS++G+VQ+G +SSIWYGCVLRGDV+ + +G  +NIQDN++V+V K+N++  + PT
Sbjct  61   VAPGASVVGEVQIGENSSIWYGCVLRGDVHQIKVGAESNIQDNTVVNVPKTNVSSSIEPT  120

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            IIGN VT+GH++VLH CTVEDE+FVGMG+T+LDG VVEK AM+AAG++V + TR+P
Sbjct  121  IIGNRVTIGHNSVLHACTVEDESFVGMGSTILDGAVVEKGAMVAAGSVVAEKTRVP  176



>gb|KJB17751.1| hypothetical protein B456_003G013500 [Gossypium raimondii]
Length=229

 Score =   234 bits (596),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 126/176 (72%), Gaps = 42/176 (24%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LG+A YTVGFW+RETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P V R+AF
Sbjct  1    MGTLGKAIYTVGFWVRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNVFDKAPFVDRDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAPSAS+IGDVQVGR SSIWYGCVLRG                                 
Sbjct  61   VAPSASVIGDVQVGRGSSIWYGCVLRG---------------------------------  87

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
                     HSAVLHGCTVEDEAFVGMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  88   ---------HSAVLHGCTVEDEAFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  134



>ref|XP_002504597.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65855.1| predicted protein [Micromonas sp. RCC299]
Length=254

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + R  +++G  +RETGQALDR+GC +QG+  F E +S+HR +M +++K P++ R  F+AP
Sbjct  1    MSRFMFSIGTVLRETGQALDRIGCSMQGSNAFREAISKHRTIMGIYEKTPALPRAGFIAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SAS+IGDV +G  SS+WYG VLRGDVNS+ IG+ TNIQDN+++HVAK+N+ G   PTIIG
Sbjct  61   SASVIGDVTIGEKSSVWYGAVLRGDVNSIRIGSQTNIQDNTVIHVAKTNVGGVAAPTIIG  120

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            + VTVGH+A+LH CTV+D+AFVGMGAT++DG VVE  AM+AAGALV   T +P
Sbjct  121  DRVTVGHNAILHACTVKDDAFVGMGATVMDGAVVESGAMVAAGALVTPGTVVP  173



>gb|AFW79497.1| hypothetical protein ZEAMMB73_562884 [Zea mays]
Length=218

 Score =   230 bits (587),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  427
            MN+FDK P VHR+AFVAPSAS+IGDVQVG+ +SIWYGCVLRGD N++ IG+GTNIQDNSL
Sbjct  1    MNIFDKTPHVHRDAFVAPSASLIGDVQVGQGASIWYGCVLRGDANNIQIGSGTNIQDNSL  60

Query  428  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  607
            VHVAKSNL+GKV PTIIGNNVT+GHSAVL GCTVEDEAFVGMGATLLDGVVV K+ M+AA
Sbjct  61   VHVAKSNLSGKVFPTIIGNNVTIGHSAVLQGCTVEDEAFVGMGATLLDGVVVGKHGMVAA  120

Query  608  GALVRQNTRIP  640
            G+LVRQNTRIP
Sbjct  121  GSLVRQNTRIP  131



>tpg|DAA63887.1| TPA: hypothetical protein ZEAMMB73_753225 [Zea mays]
Length=239

 Score =   231 bits (588),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +2

Query  227  LSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGT  406
            +SRHR +MN+F+K P +HR+ FVAPSA++IGDV++G  SSIWYG +LRGDVNS+ IG+GT
Sbjct  5    VSRHRTIMNIFEKEPRIHRDVFVAPSAAVIGDVEIGHGSSIWYGSILRGDVNSIHIGSGT  64

Query  407  NIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVE  586
            NIQDNSLVHV+K+N++GKVLPTIIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVE
Sbjct  65   NIQDNSLVHVSKANISGKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVE  124

Query  587  KNAMIAAGALVRQNTRIP  640
            K++M+ AG+LV+QNTRIP
Sbjct  125  KHSMVGAGSLVKQNTRIP  142



>ref|XP_006305517.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
 gb|EOA38415.1| hypothetical protein CARUB_v10009987mg [Capsella rubella]
Length=230

 Score =   226 bits (576),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  427
            MN+FDK P V + AFVAPSAS+IGDVQ+GR SSIWYGCVLRGD N+VS+G+GTNIQDNSL
Sbjct  1    MNVFDKAPIVDKTAFVAPSASVIGDVQIGRGSSIWYGCVLRGDANTVSVGSGTNIQDNSL  60

Query  428  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  607
            VHVAKSNL+GKV PTIIG+NVT+GHSAVLHGCTVE++ F+GMGATLLDGVVVE++ M+AA
Sbjct  61   VHVAKSNLSGKVHPTIIGDNVTIGHSAVLHGCTVENQTFIGMGATLLDGVVVEEHGMVAA  120

Query  608  GALVRQNTRIP  640
            GALVRQNTRIP
Sbjct  121  GALVRQNTRIP  131



>ref|XP_003059787.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55739.1| predicted protein [Micromonas pusilla CCMP1545]
Length=255

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + R  + +G  +RETGQALDR+GC  QG+  F E +S+HR +  +++KVP +    FVAP
Sbjct  1    MARVMHALGTALRETGQALDRIGCSFQGSNVFREAISKHRTIQQIYEKVPKLPAAGFVAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SAS+IGDV +G +SS+WYG VLRGDVN VSIG+ TNIQDN++VHVAK+N+ G  LPT+IG
Sbjct  61   SASVIGDVTIGENSSVWYGAVLRGDVNPVSIGSFTNIQDNAVVHVAKTNVGGVSLPTVIG  120

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            + VTVGH+A++H CT++D+AF+GMGAT++DG  VE  AM+AAGALV   T +P
Sbjct  121  DRVTVGHNAIIHACTIKDDAFIGMGATVMDGATVEAGAMVAAGALVTPGTTVP  173



>gb|EMT05784.1| hypothetical protein F775_31542 [Aegilops tauschii]
Length=229

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  427
            M++FDK P ++++ FVAPSAS+IGDV++G  SSIWYG VLRGDVNS+ IG+G+NIQDNSL
Sbjct  1    MSIFDKEPRINKDVFVAPSASVIGDVEIGHGSSIWYGSVLRGDVNSIRIGSGSNIQDNSL  60

Query  428  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  607
            VHVAK+N++GKVLPTIIG+NVTVGHSAVLH CT+EDEAFVGMGATLLDGVVVEK++M+ A
Sbjct  61   VHVAKTNISGKVLPTIIGSNVTVGHSAVLHACTIEDEAFVGMGATLLDGVVVEKHSMVGA  120

Query  608  GALVRQNTRIP  640
            G+LV+QNTRIP
Sbjct  121  GSLVKQNTRIP  131



>dbj|BAB10927.1| ferripyochelin-binding protein-like [Arabidopsis thaliana]
Length=213

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +2

Query  248  MNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSL  427
            MN+FDK P+V + AFVAP+AS+ GDV VGR SSIWYGCVLRGD NS+S+G GTNIQDN+L
Sbjct  1    MNVFDKTPNVDKGAFVAPNASLSGDVHVGRGSSIWYGCVLRGDANSISVGAGTNIQDNAL  60

Query  428  VHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAA  607
            VHVAK+NL+GKVLPT+IG+NVT+GHSAVLHGCTVEDEA++G  AT+LDG  VEK+AM+A+
Sbjct  61   VHVAKTNLSGKVLPTVIGDNVTIGHSAVLHGCTVEDEAYIGTSATVLDGAHVEKHAMVAS  120

Query  608  GALVRQNTRIP  640
            GALVRQNTRIP
Sbjct  121  GALVRQNTRIP  131



>emb|CBI17490.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 119/133 (89%), Gaps = 2/133 (2%)
 Frame = +2

Query  248  MNLFDKVPSVHREAFV--APSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDN  421
            MNLFDK P V ++A V  AP+AS+IGDV+VG+ SSIWYGCVLRGDVNS+SIG+GTNI+DN
Sbjct  1    MNLFDKAPVVAKDASVSVAPTASVIGDVKVGQRSSIWYGCVLRGDVNSISIGSGTNIEDN  60

Query  422  SLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMI  601
            +LVHVA+S+L+GKVLPT IG+ VT+GH AVLHGCTVE+EAF+GMGATLLDG  VEK+AM+
Sbjct  61   ALVHVARSSLSGKVLPTTIGDTVTIGHGAVLHGCTVENEAFIGMGATLLDGAFVEKHAMV  120

Query  602  AAGALVRQNTRIP  640
            AAG LV Q+TRIP
Sbjct  121  AAGVLVLQDTRIP  133



>ref|XP_011398885.1| Uncharacterized protein F751_3627 [Auxenochlorella protothecoides]
 gb|KFM25989.1| Uncharacterized protein F751_3627 [Auxenochlorella protothecoides]
Length=237

 Score =   197 bits (500),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 121/174 (70%), Gaps = 0/174 (0%)
 Frame = +2

Query  119  SLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVA  298
            SLG   Y +GF +RETGQALDR+G RLQG+Y F E+L+R R L NLF+  PS+  +AFVA
Sbjct  8    SLGYVVYRLGFALRETGQALDRVGSRLQGSYAFREELNRARPLQNLFNLKPSLGTDAFVA  67

Query  299  PSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTII  478
            P+AS+IGDV +G  SS++YG VLR D  S+ +G GTNIQD SL+  A  ++      T I
Sbjct  68   PNASVIGDVTLGPRSSVFYGSVLRADSGSIKVGAGTNIQDGSLIRTAPQSIDEHAADTTI  127

Query  479  GNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            G NVT+GH   +HG T+EDE  VGMGA L  G VV K AM+AAGA+V   T IP
Sbjct  128  GANVTIGHQVSMHGVTLEDEVLVGMGAVLSHGTVVRKGAMVAAGAVVPPGTEIP  181



>ref|XP_005649920.1| trimeric LpxA-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25376.1| trimeric LpxA-like protein [Coccomyxa subellipsoidea C-169]
Length=219

 Score =   195 bits (495),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = +2

Query  143  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  322
            +GF IRETGQALDRLGCRLQGN  F E + +HR +M+L  K  S+   AFVAPSA++IGD
Sbjct  8    LGFIIRETGQALDRLGCRLQGNNAFLEDVFQHRTVMSLGGKKASIGDGAFVAPSAAVIGD  67

Query  323  VQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGH  502
            V +G+ SSIWYG VLRGD  +++IG  TN+QDN  V  +K+ L G    T IGN+VTVGH
Sbjct  68   VTLGKRSSIWYGTVLRGDEGAITIGDNTNLQDNVSVRTSKAFLGGHAGATSIGNSVTVGH  127

Query  503  SAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            S +L   T+EDEA +GMGATLL+GV VEK A +AAGA+V   T IP
Sbjct  128  SVLLDTVTIEDEALIGMGATLLEGVKVEKGAQVAAGAVVSPGTVIP  173



>ref|XP_008672301.1| PREDICTED: uncharacterized protein LOC100217184 isoform X2 [Zea 
mays]
 tpg|DAA54234.1| TPA: hypothetical protein ZEAMMB73_935334 [Zea mays]
Length=214

 Score =   191 bits (486),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 113/176 (64%), Gaps = 48/176 (27%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  LG+A Y VGFWIRETGQALDRLGCRLQG  YF  +                      
Sbjct  1    MAGLGKAMYAVGFWIRETGQALDRLGCRLQGK-YFFHE----------------------  37

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
                                     + D N + IG+GTNIQDNSL+HVAKSNL+GKV PT
Sbjct  38   -------------------------QRDANIIQIGSGTNIQDNSLIHVAKSNLSGKVFPT  72

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IGNNVTVGHSAVL GCTVEDEAFVG+GATLLDGVVVEK+ M+AAGALVRQNTRIP
Sbjct  73   TIGNNVTVGHSAVLQGCTVEDEAFVGIGATLLDGVVVEKHGMVAAGALVRQNTRIP  128



>ref|XP_008871299.1| hypothetical protein H310_07655 [Aphanomyces invadans]
 gb|ETW00274.1| hypothetical protein H310_07655 [Aphanomyces invadans]
Length=235

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 124/171 (73%), Gaps = 0/171 (0%)
 Frame = +2

Query  128  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  307
            +A Y +G  +RETGQA+DRLG R+ G+    E+ SRHR +M L+DKVP +  +++VAP+A
Sbjct  3    KAIYQLGRAVRETGQAVDRLGLRVLGSNLHREKFSRHRQVMALYDKVPMIAHDSWVAPNA  62

Query  308  SIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNN  487
            S+IGDV++   SSIWYG V+RGD+N VSIG  TNIQD +++H + +   G    T IGNN
Sbjct  63   SVIGDVEICNDSSIWYGVVIRGDLNKVSIGNRTNIQDRAVIHTSSTTTPGLAPGTSIGNN  122

Query  488  VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VTVGH A+L+ CT+E+   VGMG+ +LDG +VE N+++AAG +V    RIP
Sbjct  123  VTVGHGAILYSCTIENNVLVGMGSIVLDGALVESNSILAAGTVVPPGRRIP  173



>ref|XP_005644680.1| gamma-carbonic anhydrase [Coccomyxa subellipsoidea C-169]
 gb|EIE20136.1| gamma-carbonic anhydrase [Coccomyxa subellipsoidea C-169]
Length=263

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 119/174 (68%), Gaps = 0/174 (0%)
 Frame = +2

Query  119  SLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVA  298
            S  + F   G   R+TGQ LD +G ++QG Y + E +  H+ L     K P++   AFVA
Sbjct  2    SAQKIFKLFGSVARQTGQTLDSIGLKIQGQYGYKEGVPTHQTLQGYLGKRPTLGTGAFVA  61

Query  299  PSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTII  478
            P+AS+IGDV++G +SS+WYG VLRGDVN + +G  TNIQD   VHVA+ N  GKV PT I
Sbjct  62   PNASVIGDVKLGNNSSVWYGAVLRGDVNHIVVGNNTNIQDGVTVHVARHNPQGKVAPTTI  121

Query  479  GNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            GNNVTVGH A++H  TVED   VGMGAT+LDGV V+K +++AAGA+V     +P
Sbjct  122  GNNVTVGHGAIIHAATVEDNVLVGMGATILDGVTVQKGSVVAAGAVVTPGKTVP  175



>ref|XP_009831264.1| hypothetical protein H257_07436 [Aphanomyces astaci]
 gb|ETV79423.1| hypothetical protein H257_07436 [Aphanomyces astaci]
Length=235

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 123/171 (72%), Gaps = 0/171 (0%)
 Frame = +2

Query  128  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  307
            +A + +G  +RETGQA+DRLG R+ G+    E+ SRHR +M L+DK P +  +++VAP+A
Sbjct  3    KAIFELGRAVRETGQAVDRLGLRVLGSSLHREKFSRHRQIMALYDKAPVIAHDSWVAPNA  62

Query  308  SIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNN  487
            S+IGDV++   SS+WYG V+RGD+N VSIG  TNIQD +++H + +   G    T IGNN
Sbjct  63   SVIGDVEICNDSSVWYGVVIRGDLNKVSIGNRTNIQDRAVIHTSSTTTPGLAPGTSIGNN  122

Query  488  VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VTVGH A+L+ CT+E+   VGMG+ +LDG +VE N+++AAG +V    RIP
Sbjct  123  VTVGHGAILYSCTIENNVLVGMGSIVLDGALVESNSILAAGTVVPPGRRIP  173



>gb|KDO22056.1| hypothetical protein SPRG_12043 [Saprolegnia parasitica CBS 223.65]
Length=236

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 124/173 (72%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            L +  + +G  +RETGQA+DRLG R+ G+    E+ SRHR +MNL+DKVPSV  +++VAP
Sbjct  2    LRKVTFELGRCVRETGQAMDRLGLRVLGSNEAREKFSRHRQIMNLYDKVPSVAYDSWVAP  61

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            +AS+IGDV++   +S+WYG V+RGD+N VSIG  TNIQD +++H + +   G      IG
Sbjct  62   NASVIGDVEICNDASVWYGVVIRGDLNKVSIGNRTNIQDRTVIHTSSTTTPGLAPGASIG  121

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            N+VTVGH  +L+ CT+E+   +GMG+ +LDG +VE N+++AAG +V    RIP
Sbjct  122  NDVTVGHGCILYSCTIENNCLIGMGSIVLDGALVESNSILAAGTVVPPGRRIP  174



>ref|XP_008608997.1| hypothetical protein SDRG_05080 [Saprolegnia diclina VS20]
 gb|EQC37477.1| hypothetical protein SDRG_05080 [Saprolegnia diclina VS20]
Length=236

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/173 (49%), Positives = 124/173 (72%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            L +  + +G  +RETGQA+DRLG R+ G+    E+ SRHR +MNL+DKVPSV  +++VAP
Sbjct  2    LRKVTFELGRCVRETGQAMDRLGLRVLGSNEAREKFSRHRQIMNLYDKVPSVAYDSWVAP  61

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            +AS+IGDV++   +S+WYG V+RGD+N VSIG  TNIQD +++H + +   G      IG
Sbjct  62   NASVIGDVEICNDASVWYGVVIRGDLNKVSIGNRTNIQDRTVIHTSSTTTPGLAPGASIG  121

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            N+VTVGH  +L+ CT+E+   +GMG+ +LDG +VE N+++AAG +V    RIP
Sbjct  122  NDVTVGHGCILYSCTIENNCLIGMGSIVLDGALVESNSILAAGTVVPPGRRIP  174



>ref|XP_005536976.1| transcription factor APFI [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80940.1| transcription factor APFI [Cyanidioschyzon merolae strain 10D]
Length=303

 Score =   186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 121/177 (68%), Gaps = 4/177 (2%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQL--SRHRVLMNLFDKVPSVHRE  286
            M    R  Y +G+  RETGQALDR GC LQGN+ + E L  SRHR +MNL D+ P +  +
Sbjct  1    MSVFRRFLYHLGYLARETGQALDRAGCFLQGNFAYREALYLSRHRQIMNLVDRKPIISPQ  60

Query  287  A-FVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAK-SNLTGK  460
              F+AP+A+IIGDV +G  SS+WYG V+RGDVN V IG  TN+QD +++HVA       +
Sbjct  61   VQFIAPNAAIIGDVAIGAASSVWYGAVIRGDVNKVVIGERTNVQDRAVIHVASGGGKLER  120

Query  461  VLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNT  631
             LPT IGN VT+GH A+LH C VED+A VGMGA +LDG  VE  A+I AG+++   T
Sbjct  121  ALPTFIGNEVTIGHGAILHACAVEDQAVVGMGAIVLDGSRVESGAVIGAGSVLPPGT  177



>emb|CCI47075.1| unnamed protein product [Albugo candida]
Length=236

 Score =   184 bits (466),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 122/168 (73%), Gaps = 0/168 (0%)
 Frame = +2

Query  137  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  316
            + VG   RETGQALDR+G ++ GN  + EQ SRHR ++NL+DK P++  + +VAP+A++I
Sbjct  7    FKVGRAFRETGQALDRVGLKVLGNNSYKEQFSRHRQIINLYDKQPAIAHDVWVAPNATVI  66

Query  317  GDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTV  496
            GDV++   +S+WY  V+RGD+N+V+IG  TN+QD +++H +K N  G    T IGNNVT+
Sbjct  67   GDVEICNDASVWYNVVIRGDLNAVTIGNRTNVQDRTVIHTSKENSPGVPAGTSIGNNVTI  126

Query  497  GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            GH  VL+ CT+E+ + +GMG+ +LDG ++E N +I AG++V    RIP
Sbjct  127  GHGCVLYSCTIENTSLIGMGSIILDGALIESNTIIGAGSVVPPGARIP  174



>emb|CCA20868.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=236

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 119/168 (71%), Gaps = 0/168 (0%)
 Frame = +2

Query  137  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  316
            + VG   RETGQALDR+G R+     + EQ SRHR ++NL DK P++  + +VAP+A++I
Sbjct  7    FKVGRAFRETGQALDRVGLRVLEKNSYKEQFSRHRQIINLSDKRPTIAHDVWVAPNATVI  66

Query  317  GDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTV  496
            GDV++   +S+WY  V+RGD+N+V+IG  TN+QD +++H +K    G    T IGNNVT+
Sbjct  67   GDVEICNDASVWYNVVIRGDLNAVTIGNRTNVQDRTVIHTSKDTSPGIPAGTSIGNNVTI  126

Query  497  GHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            GH  VL+ CT+E+ + +GMG+ +LDG +VE N +I AG++V   TRIP
Sbjct  127  GHGCVLYSCTIENTSLIGMGSIILDGALVESNTIIGAGSVVPPGTRIP  174



>ref|XP_002673591.1| gamma carbonic dehydratase [Naegleria gruberi]
 gb|EFC40847.1| gamma carbonic dehydratase [Naegleria gruberi]
Length=257

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 118/171 (69%), Gaps = 8/171 (5%)
 Frame = +2

Query  137  YTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASII  316
            + +G   RE G+A+DR+GC LQG+  + E L+R R +M   +  PSV   +F+AP+AS+I
Sbjct  10   HLIGSLFREAGEAMDRVGCFLQGSLAYKEDLNRTRRVMKFKNFKPSVQPSSFIAPNASVI  69

Query  317  GDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKV---LPTIIGNN  487
            G V +G +SS+WY  V+RGDVNS+ IG  TNIQD  ++H      TGKV    PTIIGNN
Sbjct  70   GSVSLGPNSSVWYNVVIRGDVNSIQIGENTNIQDRVIIHC-----TGKVGHEKPTIIGNN  124

Query  488  VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VTV   A+LH CT+EDE+++G GAT+LDG VV + AMIA GA+V   T +P
Sbjct  125  VTVESGAILHACTLEDESYIGFGATVLDGAVVGRGAMIAPGAVVTPGTIVP  175



>ref|XP_011398930.1| Uncharacterized protein F751_3672 [Auxenochlorella protothecoides]
 gb|KFM26034.1| Uncharacterized protein F751_3672 [Auxenochlorella protothecoides]
Length=232

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 117/169 (69%), Gaps = 0/169 (0%)
 Frame = +2

Query  134  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  313
              ++G  +R TG+A+D LG  LQG+  + E LS+ + ++      P++    F+APSAS+
Sbjct  5    LKSLGSVVRSTGKAIDSLGLALQGSLGYRETLSKAQTVLPYAGAKPAIADSVFIAPSASV  64

Query  314  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  493
            IG+V +G  SS+WYG VLRGDVNS+S+G  TNIQDN LVHVAK N   + LPT IG++VT
Sbjct  65   IGNVTLGSGSSVWYGTVLRGDVNSISVGEKTNIQDNVLVHVAKHNAAHQELPTRIGSSVT  124

Query  494  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VGH AV+H  T+ D   +GMGA ++DG VVE  +++AAGALV   T +P
Sbjct  125  VGHGAVIHAATLGDRVVIGMGAVVMDGAVVEPESIVAAGALVTPGTVVP  173



>dbj|GAM24838.1| hypothetical protein SAMD00019534_080130 [Acytostelium subglobosum 
LB1]
Length=244

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 115/174 (66%), Gaps = 0/174 (0%)
 Frame = +2

Query  119  SLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVA  298
            S+    Y +G  IR TG++LD+LGC LQGNY + E LSRH  +  L  KV S+ +E+F+A
Sbjct  4    SMKNIIYLIGDSIRSTGKSLDKLGCNLQGNYSYMENLSRHSRVTPLRGKVASLGKESFIA  63

Query  299  PSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTII  478
            PS+ +IG+V++G  SS+WY  VLR DVNS+ +G  T I D ++VH +  N      PT++
Sbjct  64   PSSCVIGNVEIGTKSSVWYNTVLRADVNSIVVGNETVISDRTVVHCSSENGPKGAQPTVV  123

Query  479  GNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            GN V VG  A+LH C +ED+ ++G G+ + DG VVEK A + AG+LV    R+P
Sbjct  124  GNRVFVGPGAILHACVIEDDVYIGPGSAVFDGAVVEKGAHLEAGSLVTAGKRVP  177



>gb|KHG18626.1| Protein YrdA [Gossypium arboreum]
 gb|KHG19737.1| Protein YrdA [Gossypium arboreum]
Length=191

 Score =   171 bits (433),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +2

Query  371  GDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVG  550
            GDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT IGNNVTVGHSAVLHGCTVEDEAFVG
Sbjct  5    GDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTNIGNNVTVGHSAVLHGCTVEDEAFVG  64

Query  551  MGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            MGATLLDGVVVEK+AM+AAGALVRQNTRIP
Sbjct  65   MGATLLDGVVVEKHAMVAAGALVRQNTRIP  94



>gb|KJB43469.1| hypothetical protein B456_007G201900 [Gossypium raimondii]
Length=188

 Score =   170 bits (430),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 2/94 (2%)
 Frame = +2

Query  359  CVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDE  538
            CV  GDVNS+SIG+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDE
Sbjct  2    CV--GDVNSISIGSGTNIQDNSLVHVAKSNLSGKVLPTIIGSNVTVGHSAVLHGCTVEDE  59

Query  539  AFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            AFVGMGATLLDGV VEK+AM+AAGALVRQNTRIP
Sbjct  60   AFVGMGATLLDGVYVEKHAMVAAGALVRQNTRIP  93



>ref|XP_009523979.1| hypothetical protein PHYSODRAFT_285582 [Phytophthora sojae]
 gb|EGZ21262.1| hypothetical protein PHYSODRAFT_285582 [Phytophthora sojae]
Length=236

 Score =   171 bits (433),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 118/173 (68%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP
Sbjct  2    MRKVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPKIAHDVWVAP  61

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            +A+++GDV++   +S++Y  V+RGD+N V IG  TN+QD +++H A S   G      IG
Sbjct  62   NATVVGDVEICNDASVFYNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIG  121

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            N+VT+GH   L+ CTVE+ A +GMG+ +LDG +VE N +IAAG++V    RIP
Sbjct  122  NDVTIGHGCTLYSCTVENNALIGMGSIILDGALVESNTVIAAGSVVPPGRRIP  174



>gb|KDO84602.1| hypothetical protein CISIN_1g0242242mg, partial [Citrus sinensis]
Length=86

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/86 (87%), Positives = 80/86 (93%), Gaps = 0/86 (0%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            MG+LGRA YTVGFWIRETGQALDRLGCRLQGNYYF EQLSRHR LMN+FDK P+V ++AF
Sbjct  1    MGTLGRAVYTVGFWIRETGQALDRLGCRLQGNYYFQEQLSRHRTLMNIFDKAPAVDKDAF  60

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLR  370
            VAPSASIIGDVQVGR SSIWYGCVLR
Sbjct  61   VAPSASIIGDVQVGRGSSIWYGCVLR  86



>ref|XP_005847553.1| hypothetical protein CHLNCDRAFT_35390 [Chlorella variabilis]
 gb|EFN55451.1| hypothetical protein CHLNCDRAFT_35390 [Chlorella variabilis]
Length=261

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 118/176 (67%), Gaps = 3/176 (2%)
 Frame = +2

Query  113  MGSLGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAF  292
            M  L RA  T G  +R  G+ALD LG  +QG+  + E L++ + +     K P +    F
Sbjct  1    MSVLTRA--TAGL-LRGLGRALDGLGSAVQGSGAYKETLNKAQSVQAFAGKRPQLADSVF  57

Query  293  VAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPT  472
            VAP+AS++GDV++G  +SIWYG V+RGDVNSV IG  TN+QDN LVHVAK N+ GK LPT
Sbjct  58   VAPNASVVGDVKIGSGASIWYGAVVRGDVNSVVIGDRTNVQDNVLVHVAKHNMAGKALPT  117

Query  473  IIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             IG+NVT+G  A +H  T+ED   VGMGA ++DG  VE  +++AAGALV   T IP
Sbjct  118  QIGSNVTIGPGATIHAATIEDCVVVGMGAVIMDGAKVESKSVVAAGALVPPGTVIP  173



>ref|XP_008890951.1| hypothetical protein PPTG_01107 [Phytophthora parasitica INRA-310]
 gb|ETI56121.1| hypothetical protein F443_01293 [Phytophthora parasitica P1569]
 gb|ETK95912.1| hypothetical protein L915_01223 [Phytophthora parasitica]
 gb|ETL49292.1| hypothetical protein L916_01206 [Phytophthora parasitica]
 gb|ETM02344.1| hypothetical protein L917_01180 [Phytophthora parasitica]
 gb|ETM55585.1| hypothetical protein L914_01223 [Phytophthora parasitica]
 gb|ETN24946.1| hypothetical protein PPTG_01107 [Phytophthora parasitica INRA-310]
 gb|ETO84854.1| hypothetical protein F444_01295 [Phytophthora parasitica P1976]
 gb|ETP25915.1| hypothetical protein F441_01271 [Phytophthora parasitica CJ01A1]
 gb|ETP53918.1| hypothetical protein F442_01235 [Phytophthora parasitica P10297]
Length=236

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 118/173 (68%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP
Sbjct  2    MRKVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPKIAHDVWVAP  61

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            +A+++GDV++   +S++Y  V+RGD+N V IG  TN+QD +++H A S   G      IG
Sbjct  62   NATVVGDVEICNDASVFYNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIG  121

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            N+VT+GH   L+ CT+E+ + +GMG+ +LDG +VE N +IAAG++V    RIP
Sbjct  122  NDVTIGHGCTLYSCTIENNSLIGMGSIILDGALVESNTIIAAGSVVPPGRRIP  174



>ref|XP_002908534.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY61617.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=236

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 118/173 (68%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + +  + +G  +RETGQALDRLG R+  +  F E+ SRHR +M L+DK P +  + +VAP
Sbjct  2    MRKVTFELGRCVRETGQALDRLGLRVLNDNSFKEKFSRHRQVMALYDKRPRIAHDVWVAP  61

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            +A+++GDV++   +S++Y  V+RGD+N V IG  TN+QD +++H A S   G      IG
Sbjct  62   NATVVGDVEICNDASVFYNVVIRGDLNQVRIGNRTNVQDRTVIHTASSTSPGLAPGANIG  121

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            N+VT+GH   L+ CTVE+ + +GMG+ +LDG +VE N +IAAG++V    RIP
Sbjct  122  NDVTIGHGCTLYSCTVENNSLIGMGSIILDGALVESNTIIAAGSVVPPGRRIP  174



>gb|KCW68231.1| hypothetical protein EUGRSUZ_F01883 [Eucalyptus grandis]
Length=209

 Score =   168 bits (426),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +2

Query  365  LRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAF  544
            L GDVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPTIIG+NVTVGHSAVLHGCTVEDEAF
Sbjct  21   LSGDVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTIIGDNVTVGHSAVLHGCTVEDEAF  80

Query  545  VGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VGMGATLLDGVVVEK+ M+A GALVRQNTRIP
Sbjct  81   VGMGATLLDGVVVEKHGMVAGGALVRQNTRIP  112



>gb|AAU93943.1| gamma-carbonic anhydrase, partial [Helicosporidium sp. ex Simulium 
jonesi]
Length=246

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 115/162 (71%), Gaps = 0/162 (0%)
 Frame = +2

Query  155  IRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDVQVG  334
            +R  G+A++ +G  +QG   + E L++ + L+    K PS+  E FVAPSAS+IGDV++G
Sbjct  1    LRGLGKAVESIGVMMQGTLAYRETLNKSQTLLTYNAKRPSLAAEVFVAPSASVIGDVKIG  60

Query  335  RHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVL  514
              SS+WYG V+RGDV SVSIG+ T++QDN++VHVAK N    +  T IG++VTVGH AV+
Sbjct  61   ASSSVWYGAVVRGDVGSVSIGSHTSVQDNAMVHVAKHNAQNTLRGTSIGSHVTVGHGAVV  120

Query  515  HGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            H  T+ED  FVG GAT++DG  V++ A++AAG+L+     +P
Sbjct  121  HAATLEDGCFVGAGATVMDGATVQRGAVLAAGSLLAPGASVP  162



>gb|KDO84603.1| hypothetical protein CISIN_1g0242241mg, partial [Citrus sinensis]
Length=183

 Score =   164 bits (414),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +2

Query  374  DVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGM  553
            DVNS+S+G+GTNIQDNSLVHVAKSNL+GKVLPT IG+NVTVGHSAVLHGCTVEDEAFVGM
Sbjct  1    DVNSISVGSGTNIQDNSLVHVAKSNLSGKVLPTTIGDNVTVGHSAVLHGCTVEDEAFVGM  60

Query  554  GATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            GATLLDGVVVE++ M+AAG+LVRQNTRIP
Sbjct  61   GATLLDGVVVERHGMVAAGSLVRQNTRIP  89



>gb|EMT05905.1| hypothetical protein F775_31227 [Aegilops tauschii]
Length=94

 Score =   159 bits (401),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + +AFY VGFWIRETGQALDRLGCRLQGNY+FHEQ+SRHR LMN+FDK P VH+EAFVAP
Sbjct  1    MAKAFYAVGFWIRETGQALDRLGCRLQGNYFFHEQISRHRTLMNIFDKAPHVHKEAFVAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNS  385
            SAS+IGDV+VG+ SSIWYGCVLR +V  
Sbjct  61   SASLIGDVEVGQGSSIWYGCVLRDNVEK  88



>gb|KDD73982.1| hypothetical protein H632_c1679p0 [Helicosporidium sp. ATCC 50920]
Length=251

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 118/185 (64%), Gaps = 13/185 (7%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            LG  FY +GF +RETGQALDR+G R++G++ F E+L+R R LMN+F K P + RE FVAP
Sbjct  9    LGYVFYRLGFALRETGQALDRVGSRMEGSWAFREELNRSRTLMNIFHKKPELGRETFVAP  68

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNS-------------VSIGTGTNIQDNSLVHVAK  442
            SAS+IG V +G  +S++YG VLR +V+S             +++G  TNIQD  ++    
Sbjct  69   SASLIGRVTLGDQASVFYGSVLRDNVSSPPLPTPSTADKGRITVGPRTNIQDGVVIRTGP  128

Query  443  SNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVR  622
              L      T++G++VTVGH A LHG  V D   VGMGA L  GVV+E  +M+AA A+V 
Sbjct  129  GCLGEHKCDTVLGSDVTVGHLAALHGARVGDGCLVGMGAVLGHGVVMEPGSMVAANAVVA  188

Query  623  QNTRI  637
              T +
Sbjct  189  PGTTV  193



>ref|XP_005703463.1| hypothetical protein Gasu_55130 [Galdieria sulphuraria]
 gb|EME26943.1| hypothetical protein Gasu_55130 [Galdieria sulphuraria]
Length=280

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 118/173 (68%), Gaps = 6/173 (3%)
 Frame = +2

Query  140  TVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIG  319
            T G  +R++GQALD++G + QG Y + E LSRH  +  + DK P +  + FVAP+AS+IG
Sbjct  10   TTGNLLRKSGQALDKVGEQFQGVYAYKELLSRHHRMRAILDKKPLLSSQVFVAPNASVIG  69

Query  320  DVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN------LTGKVLPTIIG  481
             V++G +SS+WYG ++RGDV SVSIG  TN+QD + +H++K +      L      T+IG
Sbjct  70   TVELGPNSSVWYGAIVRGDVASVSIGENTNVQDRACIHLSKGDSMFQGGLLNNCTETVIG  129

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            + V++GH A++HG  ++DE  VGMGA LL+G  + K+A++ +GA+V +   IP
Sbjct  130  SRVSIGHGAIIHGAHIQDECMVGMGAILLEGCKISKHAIVGSGAVVPRKAIIP  182



>ref|XP_005850191.1| hypothetical protein CHLNCDRAFT_20587 [Chlorella variabilis]
 gb|EFN58089.1| hypothetical protein CHLNCDRAFT_20587 [Chlorella variabilis]
Length=230

 Score =   160 bits (406),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/155 (50%), Positives = 106/155 (68%), Gaps = 0/155 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + R  + VG  +RETG ALDR G  LQG++ F E+LSRHR L  L  K PS+  + FVAP
Sbjct  1    MSRVLHAVGKALRETGLALDRAGATLQGSFAFREELSRHRSLAPLGGKSPSLGLDVFVAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            SA++IGDV++G ++S++YG V+R D  S+SIG  +N+QD  ++  A + L+G    T IG
Sbjct  61   SAAVIGDVKLGDNASVFYGSVIRADSGSISIGDKSNVQDGCVIRTASAFLSGHSADTTIG  120

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVE  586
              VT+GH A LHGCTV D A +GM +TLL+G  VE
Sbjct  121  RMVTIGHQASLHGCTVGDRALIGMNSTLLEGCSVE  155



>ref|XP_001703237.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|EDO96533.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
Length=229

 Score =   157 bits (398),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +2

Query  134  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  313
             + VGF +RE+GQAL+R+GCRLQG Y F E+L+RH  ++ +   VPS+ + ++VAPS  +
Sbjct  11   LHRVGFAMRESGQALERVGCRLQGVYSFEEKLNRHATVLPMRHNVPSLDKTSWVAPSGMV  70

Query  314  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  493
             G V +G +SS+WYG ++RGD   V +G+ +NIQD + V  A S  +G   P  IG+NV+
Sbjct  71   SGSVTLGENSSVWYGAIVRGDFQPVVVGSNSNIQDAAYVG-ATSEFSG---PVTIGDNVS  126

Query  494  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VGH AVL GCTV D   +GM + + +   ++  A+IAAG+ V + T +P
Sbjct  127  VGHGAVLKGCTVGDNVLIGMNSIISEHAEIQSGAVIAAGSYVEEGTTVP  175



>gb|AAS48195.1| mitochondrial NADH:ubiquinone oxidoreductase 27 kDa subunit [Chlamydomonas 
reinhardtii]
Length=216

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 113/169 (67%), Gaps = 4/169 (2%)
 Frame = +2

Query  134  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  313
             + VGF +RE+GQAL+R+GCRLQG Y F E+L+RH  ++ +   VPS+ + ++VAPS  +
Sbjct  11   LHRVGFAMRESGQALERVGCRLQGVYSFEEKLNRHATVLPMRHNVPSLDKTSWVAPSGMV  70

Query  314  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  493
             G V +G +SS+WYG ++RGD   V +G+ +NIQD + V  A S  +G   P  IG+NV+
Sbjct  71   SGSVTLGENSSVWYGAIVRGDFQPVVVGSNSNIQDAAYVG-ATSEFSG---PVTIGDNVS  126

Query  494  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VGH AVL GCTV D   +GM + + +   ++  A+IAAG+ V + T +P
Sbjct  127  VGHGAVLKGCTVGDNVLIGMNSIISEHAEIQSGAVIAAGSYVEEGTTVP  175



>ref|XP_002948065.1| hypothetical protein VOLCADRAFT_73531 [Volvox carteri f. nagariensis]
 gb|EFJ51053.1| hypothetical protein VOLCADRAFT_73531 [Volvox carteri f. nagariensis]
Length=229

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 109/169 (64%), Gaps = 4/169 (2%)
 Frame = +2

Query  134  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  313
             + VGF +RE+G AL+R+GCRLQG Y F E+LSRH  ++ +  + PS+ + A+VAPS  +
Sbjct  11   LHRVGFAMRESGLALERVGCRLQGIYSFEEKLSRHASVLPMRYETPSIAKSAWVAPSGML  70

Query  314  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  493
             G+V +G  SS+WYG ++RGD   V++G  +NIQD + V  A         P  IGNNV+
Sbjct  71   SGNVSIGEGSSVWYGAIVRGDFQPVTVGNNSNIQDAAYVGAASEFSP----PVNIGNNVS  126

Query  494  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VGH AVL GCT+ D   VG+ A + + V V+  A+IAAGA V +   +P
Sbjct  127  VGHGAVLKGCTIGDNVLVGINAVISENVEVQSGAVIAAGAYVEEGAVVP  175



>dbj|BAF32946.1| putative gamma-type carbonic anhydrase [Pleurochrysis haptonemofera]
Length=234

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            L R    VG  +R+TGQA++R+GCR Q N+ F+E   RHR +MNL+D+ P V + AF+AP
Sbjct  2    LKRVAVGVGKALRDTGQAIERMGCRAQDNFIFNEPYCRHRAVMNLYDQRPRVAQGAFIAP  61

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            +A++IG+V +   +SIWYG V+RGD +++ IG  ++I D S+V  +  N TG    T IG
Sbjct  62   NAAVIGNVDIEPRTSIWYGAVIRGDQSNIFIGGESSIGDRSVVQSSTVNPTGFSARTCIG  121

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            + V +G   VL  CT+ED   +G G  + +G ++E  AM+  G++V Q  R+P
Sbjct  122  DWVKIGQGCVLRACTIEDYCQIGDGCIVQEGALIENGAMLEPGSVVPQGARVP  174



>ref|XP_001696746.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAR82949.1| putative gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAR82950.1| putative gamma carbonic anhydrase [Chlamydomonas reinhardtii]
 gb|AAS48197.1| mitochondrial NADH:ubiquinone oxidoreductase 32 kDa subunit [Chlamydomonas 
reinhardtii]
 gb|EDP00854.1| gamma carbonic anhydrase [Chlamydomonas reinhardtii]
Length=312

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 116/197 (59%), Gaps = 28/197 (14%)
 Frame = +2

Query  134  FYTVGFWIRETGQALDRLGCRLQG-----------NYYFHEQLSRHRVLMNLFDKVPSV-  277
             Y +G   R  G ALD LG  +QG           N  F     +  V +N    VP+  
Sbjct  29   LYGLGSLFRGVGAALDELGSMVQGPQGSVKDHVQPNLAFAPVHRKPDVPVNAGQVVPAPP  88

Query  278  ----------------HREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTN  409
                            H  AFVA +A+++G+V++G  SS+WYG VLRGDVN + +G  +N
Sbjct  89   AAARTLKIKEVVVPNKHSTAFVAANANVLGNVKLGAGSSVWYGAVLRGDVNGIEVGANSN  148

Query  410  IQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEK  589
            IQDN++VHV+K ++ G   PT+IGNNVT+GH+A +H CT+ED   VGMGAT+LDG  V+ 
Sbjct  149  IQDNAIVHVSKYSMDGTARPTVIGNNVTIGHAATVHACTIEDNCLVGMGATVLDGATVKS  208

Query  590  NAMIAAGALVRQNTRIP  640
             +++AAGA+V  NT IP
Sbjct  209  GSIVAAGAVVPPNTTIP  225



>gb|ETI49161.1| hypothetical protein F443_06919 [Phytophthora parasitica P1569]
 gb|ETK89052.1| hypothetical protein L915_06794 [Phytophthora parasitica]
 gb|ETL42459.1| hypothetical protein L916_06736 [Phytophthora parasitica]
 gb|ETL95631.1| hypothetical protein L917_06603 [Phytophthora parasitica]
 gb|ETM48826.1| hypothetical protein L914_06698 [Phytophthora parasitica]
 gb|ETO77896.1| hypothetical protein F444_06984 [Phytophthora parasitica P1976]
 gb|ETP18931.1| hypothetical protein F441_06922 [Phytophthora parasitica CJ01A1]
Length=251

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 109/165 (66%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  325
            G  IR  GQ +DR+G  L+G + + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKFTYTEHLNPSTRAVKNLGRSPKFEESVFVAPNASVIGDV  66

Query  326  QVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHS  505
            +VG+ SSIWY   +RGDVN ++IG  TNIQD ++VHVAK +   K +PT IG+NVTVG +
Sbjct  67   KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGSNVTVGPA  123

Query  506  AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            A++H CT++D   +G GA +LDG VV   ++I AG++V +  ++P
Sbjct  124  AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITAGSIVTKGKQVP  168



>ref|XP_008903478.1| hypothetical protein PPTG_09984 [Phytophthora parasitica INRA-310]
 gb|ETN10960.1| hypothetical protein PPTG_09984 [Phytophthora parasitica INRA-310]
 gb|ETP46878.1| hypothetical protein F442_06954 [Phytophthora parasitica P10297]
Length=251

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 109/165 (66%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  325
            G  IR  GQ +DR+G  L+G + + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKFTYTEHLNPSTRAVKNLGRSPKFEEGVFVAPNASVIGDV  66

Query  326  QVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHS  505
            +VG+ SSIWY   +RGDVN ++IG  TNIQD ++VHVAK +   K +PT IG+NVTVG +
Sbjct  67   KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGSNVTVGPA  123

Query  506  AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            A++H CT++D   +G GA +LDG VV   ++I AG++V +  ++P
Sbjct  124  AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITAGSIVTKGKQVP  168



>ref|XP_005766975.1| gamma carbonic anhydrase [Emiliania huxleyi CCMP1516]
 gb|ABG37688.1| gamma carbonic anhydrase [Emiliania huxleyi]
 gb|EOD14546.1| gamma carbonic anhydrase [Emiliania huxleyi CCMP1516]
Length=235

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 111/173 (64%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            + R    VG  +R+TGQA++R+G R Q N+ F E++ RHR LMNLFD+ P +    FVAP
Sbjct  1    MKRVLVGVGKALRDTGQAVERMGMRAQDNWIFQEKICRHRALMNLFDQRPKLRPSVFVAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            +AS+IG+V V   SSIWYG V+RGD + V IG  ++I D S+V  A  N TG    T IG
Sbjct  61   NASLIGNVSVMDESSIWYGAVVRGDQSPVDIGGKSSIGDRSVVLSASVNPTGFAAKTSIG  120

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            + VTVG   VL GCTV++ A VG G  + +G +VE + ++ AG+++     +P
Sbjct  121  DWVTVGQGCVLRGCTVDNFAVVGDGCVIGEGALVETHGVLEAGSVLPAGGLVP  173



>ref|WP_025898515.1| carbonic anhydrase [Sneathiella glossodoripedis]
Length=173

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 93/124 (75%), Gaps = 5/124 (4%)
 Frame = +2

Query  269  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN  448
            PS     FVAPSA +IGDV++G  SSIW+ CV+RGDVNS+ IG  +NIQD +++HV+   
Sbjct  13   PSFDDTVFVAPSADVIGDVEIGEGSSIWFNCVVRGDVNSIRIGKRSNIQDGTVIHVSNG-  71

Query  449  LTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQN  628
                  P +IG++V VGH+ ++HGCT+EDE+FVGMGAT+LDG VVE  AM+AAGAL+  N
Sbjct  72   ----THPAVIGDDVLVGHNCIIHGCTLEDESFVGMGATVLDGAVVESGAMVAAGALLTPN  127

Query  629  TRIP  640
             R+P
Sbjct  128  KRVP  131



>ref|WP_002727628.1| carbonic anhydrase [Phaeospirillum molischianum]
 emb|CCG40950.1| Protein yrdA [Phaeospirillum molischianum DSM 120]
Length=174

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +2

Query  263  KVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAK  442
            ++P +   AF+AP+A++IGDV +G  SSIW+GC+LRGDVN + IG  TNIQD +++HV +
Sbjct  11   RLPEIDATAFIAPNATVIGDVTIGAESSIWFGCILRGDVNEIRIGARTNIQDGTVIHVTR  70

Query  443  SNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVR  622
                 +   T IG+++T+GH+AVLHGCT+ED  F+GMGA LLDGVVVE+ AMIAAGA+V 
Sbjct  71   -----RTFGTNIGSDITIGHAAVLHGCTLEDCCFIGMGAVLLDGVVVEREAMIAAGAVVT  125

Query  623  QNTRI  637
               RI
Sbjct  126  PGKRI  130



>ref|XP_002997211.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY69573.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=251

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 108/165 (65%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  325
            G  IR  GQ +DR+G  L+G   + E L+     +    + P      FVAP+A++IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKLAYTEHLNPSTRAVKNLGRSPKFEEGVFVAPNAAVIGDV  66

Query  326  QVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHS  505
            +VG+ SSIWY   +RGDVN ++IG  TNIQD ++VHVAK +   K +PT IGNNVTVG +
Sbjct  67   KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---KDIPTKIGNNVTVGPA  123

Query  506  AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            A++H CT++D   +G GA +LDG VV   ++I AG++V +  ++P
Sbjct  124  AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIITAGSIVTKGKQVP  168



>ref|WP_021802336.1| hexapeptide repeat-containing transferase [Clostridium intestinale]
 gb|ERK30033.1| hexapeptide repeat-containing transferase [Clostridium intestinale 
URNW]
Length=165

 Score =   150 bits (378),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 95/133 (71%), Gaps = 7/133 (5%)
 Frame = +2

Query  242  VLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDN  421
            ++    DK P +H   F+A +++I+GDV++G+ SSIW+G V+RGD NS+ IG G+N+QDN
Sbjct  1    MIKEFLDKKPMIHEGTFIAENSTIVGDVEIGKDSSIWFGAVIRGDENSIKIGEGSNVQDN  60

Query  422  SLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMI  601
            S++HV +  +T       IGN VTVGH A+LHGC +EDE  +GMGAT+L G  + KN +I
Sbjct  61   SIIHVDEHKVT-------IGNFVTVGHGAILHGCDIEDEVLIGMGATVLSGAKIGKNTII  113

Query  602  AAGALVRQNTRIP  640
             AGALV++N  IP
Sbjct  114  GAGALVKENANIP  126



>ref|XP_004351419.1| trimeric LpxA-like domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG14903.1| trimeric LpxA-like domain-containing protein [Dictyostelium fasciculatum]
Length=249

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            L   FY VG  +R TG+ALD +G  +QGNY + EQL+R   +  L  K+  + +++FVAP
Sbjct  2    LKNVFYLVGDAVRSTGKALDVVGRNMQGNYAYVEQLNRQSRVTPLRGKLAHLGKDSFVAP  61

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            ++S+IG V +G +S++WY  V+RGDVN +++G  T+I D +++H +  N       T IG
Sbjct  62   NSSVIGQVTIGNNSALWYNTVVRGDVNQITVGNETSIGDRTVIHASSKNGPKGEQATQIG  121

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            + V VG  A+LHGC +ED A +G G+ + DG VVEK A + AG+LV    R+P
Sbjct  122  SRVLVGSGAILHGCVIEDGANIGSGSIVYDGAVVEKGAHLEAGSLVASGKRVP  174



>ref|WP_021132357.1| carbonic anhydrase/acetyltransferase [Phaeospirillum fulvum]
 gb|EPY01605.1| carbonic anhydrase/acetyltransferase [Phaeospirillum fulvum MGU-K5]
Length=174

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 95/125 (76%), Gaps = 5/125 (4%)
 Frame = +2

Query  263  KVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAK  442
            ++P +   AF+AP+A++IG+V +G  SSIW+GC+LRGDVN + IG  TNIQD +++HV +
Sbjct  11   RLPEIDATAFIAPNATVIGEVTIGAESSIWFGCILRGDVNQIRIGERTNIQDGTVIHVTR  70

Query  443  SNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVR  622
                 K   T IG+++T+GH+AVLHGCT+ED  F+GMGA LLDGVVVE+ AM+AAGA+V 
Sbjct  71   -----KTFGTFIGSDITIGHAAVLHGCTLEDCCFIGMGAVLLDGVVVEREAMVAAGAVVT  125

Query  623  QNTRI  637
               R+
Sbjct  126  PGKRV  130



>gb|EWM27773.1| Trimeric LpxA [Nannochloropsis gaditana]
Length=263

 Score =   151 bits (381),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 110/171 (64%), Gaps = 0/171 (0%)
 Frame = +2

Query  128  RAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSA  307
            +   T+G  +RETGQALDR G    G+    E  SRHR + NLFD+ P V   AFV+PSA
Sbjct  34   KGLDTLGKALRETGQALDRTGMEALGSDKHKELWSRHRQVSNLFDQRPRVASNAFVSPSA  93

Query  308  SIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNN  487
            +++G+V +    SIWYG V+RGD NSV IG  TN+QD++++    S  +G      IGN 
Sbjct  94   TVVGEVSLWDKVSIWYGAVIRGDRNSVKIGNCTNVQDHAVICTVPSLDSGFPATVDIGNL  153

Query  488  VTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VT+GHSA +   T+ED+A VG+G+ + +G +VE  A +AAG++V    RIP
Sbjct  154  VTIGHSATITSATIEDKALVGIGSIVSEGALVETGAQLAAGSVVPPGGRIP  204



>ref|XP_009516211.1| hypothetical protein PHYSODRAFT_537494 [Phytophthora sojae]
 gb|EGZ28936.1| hypothetical protein PHYSODRAFT_537494 [Phytophthora sojae]
Length=251

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 107/165 (65%), Gaps = 3/165 (2%)
 Frame = +2

Query  146  GFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGDV  325
            G  IR  GQ +DR+G  L+G   + E L+     +    + P      FVAP+AS+IGDV
Sbjct  7    GKAIRSLGQTIDRVGVSLEGKLTYTEHLNPSTRAVKNLGRAPKFEEGVFVAPNASVIGDV  66

Query  326  QVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHS  505
            +VG+ SSIWY   +RGDVN ++IG  TNIQD ++VHVAK +   + +PT IGNNVTVG +
Sbjct  67   KVGKGSSIWYNATVRGDVNHITIGENTNIQDQAVVHVAKIH---QDIPTKIGNNVTVGPN  123

Query  506  AVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            A++H CT++D   +G GA +LDG VV   +++ AG++V    ++P
Sbjct  124  AIVHACTIQDHCIIGTGAQVLDGAVVGAKSIVTAGSIVTMGKQVP  168



>ref|XP_636871.1| trimeric LpxA-like domain-containing protein [Dictyostelium discoideum 
AX4]
 sp|Q54JC2.1|Y2881_DICDI RecName: Full=Uncharacterized protein DDB_G0288155 [Dictyostelium 
discoideum]
 gb|EAL63365.1| trimeric LpxA-like domain-containing protein [Dictyostelium discoideum 
AX4]
Length=246

 Score =   150 bits (379),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 108/162 (67%), Gaps = 1/162 (1%)
 Frame = +2

Query  134  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  313
            F  +G  ++ TG  L R GC++QG+Y + E+L+RH  L    D  P V +++F+AP+ASI
Sbjct  7    FGILGEVVKNTGLILHRTGCKMQGDYAYVEKLNRHTRLTAFGDNAPIVGQKSFIAPNASI  66

Query  314  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  493
            IGDV +G+ SSIWY  VLRGDVNS+ IG  T + D ++VH + +   G   PT IG+ V 
Sbjct  67   IGDVVIGKESSIWYNAVLRGDVNSIHIGDKTVVSDRTVVHCSSNGPLGP-KPTQIGDKVY  125

Query  494  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALV  619
            +G  +++H  T+  E+F+G G+TL DG VVEKN  + AG+L+
Sbjct  126  IGPGSIVHAATILGESFIGTGSTLCDGSVVEKNGFLEAGSLL  167



>ref|WP_007091625.1| MULTISPECIES: carbonic anhydrase [Thalassospira]
 gb|KEO58829.1| carbonic anhydrase [Thalassospira permensis NBRC 106175]
 gb|AJD51718.1| carbonic anhydrase/acetyltransferase [Thalassospira xiamenensis 
M-5 = DSM 17429]
Length=177

 Score =   148 bits (373),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = +2

Query  269  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN  448
            P++   AF+AP+A+IIGDV++G  + IW+GCV+RGDV+ + IG+ TNIQD ++VHVAK  
Sbjct  10   PTIDETAFIAPNATIIGDVEIGAETGIWFGCVIRGDVHEIRIGSRTNIQDLTMVHVAKGK  69

Query  449  LTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQN  628
                   T IG++VT+GHSAV+H CT+ED +FVGM AT++DG V+E+ AM+ AGAL+   
Sbjct  70   FG-----TYIGDDVTIGHSAVIHACTLEDRSFVGMSATVMDGCVIEQGAMLGAGALLAPG  124

Query  629  TRIP  640
             RIP
Sbjct  125  KRIP  128



>dbj|GAM26691.1| hypothetical protein SAMD00019534_098660 [Acytostelium subglobosum 
LB1]
Length=242

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 110/169 (65%), Gaps = 6/169 (4%)
 Frame = +2

Query  134  FYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASI  313
            F  +G  IR TG+ALDRLGC +QGNY + E+L+RH  +M     +  + REAF+AP++S+
Sbjct  6    FAVLGDSIRSTGKALDRLGCSIQGNYAYIEKLNRHSRVMPFRGNIAHLGREAFIAPNSSV  65

Query  314  IGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVT  493
            IG V++G  SS+WY  VLRGD N++ IGT + I D ++++  +         T IG NV 
Sbjct  66   IGSVRIGHQSSVWYNTVLRGDTNAIIIGTNSIISDRTVINATRDK------QTTIGTNVY  119

Query  494  VGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            VG  A+L+GC+++    +G G+ +L+GV +E  A + AG++V  NT +P
Sbjct  120  VGPGAILNGCSIDSNVVIGTGSIVLEGVRIESGASLEAGSIVPANTVVP  168



>ref|XP_002956125.1| hypothetical protein VOLCADRAFT_83469 [Volvox carteri f. nagariensis]
 gb|EFJ42865.1| hypothetical protein VOLCADRAFT_83469 [Volvox carteri f. nagariensis]
Length=313

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/203 (41%), Positives = 114/203 (56%), Gaps = 28/203 (14%)
 Frame = +2

Query  116  GSLGRAFYTVGFWIRETGQALDRLGCRLQGNY-YFHEQLSRHRVLMNLFDK---------  265
            G +    Y +G  +R  G ALD LG  +QG      E +  +     +  K         
Sbjct  23   GFVESTLYGLGSVLRGVGIALDELGSMIQGPQGAIKEHVQPNLAFAPVHRKPDVPVGAGQ  82

Query  266  ------------------VPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVS  391
                              +P+ H  AFVA +A+++G+V++G +SSIWYG VLRGDVN + 
Sbjct  83   VVPAPAAAARTLKVKEMVIPNKHSTAFVAANANVLGNVKIGANSSIWYGAVLRGDVNGIF  142

Query  392  IGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLD  571
            +G  TNIQDN + HV+K +L G    T IGNNVT+GH A +H CT+ED   VGMGAT+LD
Sbjct  143  VGNNTNIQDNVVAHVSKYSLDGDARTTTIGNNVTIGHGATVHACTIEDNCLVGMGATILD  202

Query  572  GVVVEKNAMIAAGALVRQNTRIP  640
            G  V+K A++AAGA+V   T IP
Sbjct  203  GATVKKGAIVAAGAVVPPKTVIP  225



>ref|WP_014804134.1| acetyltransferase [Turneriella parva]
 gb|AFM13633.1| transferase hexapeptide repeat containing protein [Turneriella 
parva DSM 21527]
Length=174

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 94/126 (75%), Gaps = 5/126 (4%)
 Frame = +2

Query  242  VLMNLFDKVPSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDN  421
            ++++  +  P +   A+VAP A ++GDV++G  SSIWYGCV+RGDV+S+ IG+ TNIQD 
Sbjct  1    MILSFKEVAPKIAASAYVAPGAVVLGDVEIGERSSIWYGCVVRGDVHSIRIGSDTNIQDA  60

Query  422  SLVHVAKSNLTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMI  601
            S+VHV     TG    T IGN VT+GH  +LHGCT++D++FVGMGATLLDGVVVE    +
Sbjct  61   SVVHV-----TGGKFATTIGNRVTIGHRVLLHGCTLQDDSFVGMGATLLDGVVVEPLGFV  115

Query  602  AAGALV  619
            AAGALV
Sbjct  116  AAGALV  121



>ref|WP_044828700.1| carbonic anhydrase [Thalassospira sp. HJ]
 gb|KJE35273.1| carbonic anhydrase [Thalassospira sp. HJ]
Length=175

 Score =   146 bits (369),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 93/124 (75%), Gaps = 5/124 (4%)
 Frame = +2

Query  269  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN  448
            P++   AF+AP+A+IIGDV++G  + IW+GCV+RGDV+ + IG+ TNIQD ++VHVAK  
Sbjct  10   PTIDETAFIAPNATIIGDVEIGAETGIWFGCVIRGDVHEIRIGSRTNIQDMTMVHVAKGK  69

Query  449  LTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQN  628
                   T IG++VT+GHSA++H CT+ED +FVGMGAT++DG V+E+  M+ A AL+   
Sbjct  70   FG-----TYIGDDVTIGHSAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGANALLAPG  124

Query  629  TRIP  640
             RIP
Sbjct  125  KRIP  128



>emb|CBN79571.1| gamma carbonic anhydrase [Ectocarpus siliculosus]
Length=304

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 113/173 (65%), Gaps = 4/173 (2%)
 Frame = +2

Query  122  LGRAFYTVGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAP  301
            L +A   VG   R  G++LD +G  L+ + Y  + L+  R + +   KVPS  + +FVAP
Sbjct  2    LNQAKTAVGMAARRVGRSLDGMGAALETHPYTEKLLASTRSVGHK-GKVPSTAQASFVAP  60

Query  302  SASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIG  481
            +AS+IGDV+VG  +S+WYG V+RGDVN V IG G+++ D+++VHVA   L G   PTI+G
Sbjct  61   NASVIGDVKVGEGASLWYGSVVRGDVNHVVIGAGSSVGDSAVVHVA--GLAGN-KPTIVG  117

Query  482  NNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
            NNV +G  A +H CT++D+  VG GAT++DG  V   AM+A GA V  N  +P
Sbjct  118  NNVVIGPRATIHACTLKDDCMVGAGATVMDGATVSSGAMVAPGATVSPNITVP  170



>gb|EKF07893.1| carbonic anhydrase/acetyltransferase [Thalassospira profundimaris 
WP0211]
Length=175

 Score =   145 bits (367),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 93/124 (75%), Gaps = 5/124 (4%)
 Frame = +2

Query  269  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN  448
            P++   AF+AP+A+IIGDV++G  + IW+GCV+RGDV+ + IG+ TNIQD ++VHVAK  
Sbjct  10   PTIDETAFIAPNATIIGDVEIGAETGIWFGCVIRGDVHEIRIGSRTNIQDLTMVHVAKGK  69

Query  449  LTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQN  628
                   T IG++VT+GHSA++H CT+ED +FVGMGAT++DG V+E+  M+ A AL+   
Sbjct  70   FG-----TYIGDDVTIGHSAIIHACTLEDRSFVGMGATVMDGCVIEQGGMLGANALLAPG  124

Query  629  TRIP  640
             RIP
Sbjct  125  KRIP  128



>ref|WP_013779035.1| hypothetical protein [Tepidanaerobacter acetatoxydans]
 ref|YP_007272937.1| conserved protein of unknown function [Tepidanaerobacter acetatoxydans 
Re1]
 gb|AEE92113.1| ferripyochelin binding protein (fbp) [Tepidanaerobacter acetatoxydans 
Re1]
 emb|CCP26961.1| conserved protein of unknown function [Tepidanaerobacter acetatoxydans 
Re1]
Length=169

 Score =   145 bits (366),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 90/124 (73%), Gaps = 6/124 (5%)
 Frame = +2

Query  269  PSVHREAFVAPSASIIGDVQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSN  448
            P + +  F+AP+A IIG+V +   SSIWYG +LRGDVN++ +G+ TNIQD S+VHVA+  
Sbjct  10   PKICQTCFIAPTADIIGNVTIKEKSSIWYGAILRGDVNTIEVGSYTNIQDGSIVHVAED-  68

Query  449  LTGKVLPTIIGNNVTVGHSAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQN  628
                  PTIIGNNVT+GH A+ HGC ++D AF+GMGA +LDG V+ + A+I AGALV + 
Sbjct  69   -----YPTIIGNNVTIGHGAIAHGCIIKDSAFIGMGAIILDGAVIGEGALIGAGALVIEG  123

Query  629  TRIP  640
              IP
Sbjct  124  KEIP  127



>ref|XP_008862851.1| hypothetical protein H310_01513 [Aphanomyces invadans]
 gb|ETW09046.1| hypothetical protein H310_01513 [Aphanomyces invadans]
Length=249

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 108/166 (65%), Gaps = 3/166 (2%)
 Frame = +2

Query  143  VGFWIRETGQALDRLGCRLQGNYYFHEQLSRHRVLMNLFDKVPSVHREAFVAPSASIIGD  322
            +G  +R  GQ LD++G  ++G   + E+L     L+N     P++    FVAP+AS+IG+
Sbjct  4    IGNTLRAFGQKLDKVGVSIEGALSYTERLVPSTRLVNHGGHKPALASTTFVAPNASVIGE  63

Query  323  VQVGRHSSIWYGCVLRGDVNSVSIGTGTNIQDNSLVHVAKSNLTGKVLPTIIGNNVTVGH  502
            V +G+ SS+WYG  +RGDVN+++IG  TNIQD ++VH AK        PTIIGNNVT+G 
Sbjct  64   VSIGQGSSVWYGATVRGDVNAITIGDNTNIQDQAVVHAAK---IANDFPTIIGNNVTIGP  120

Query  503  SAVLHGCTVEDEAFVGMGATLLDGVVVEKNAMIAAGALVRQNTRIP  640
             A++H   + ++  +G GA +LDG VV +N++I AG++V Q   +P
Sbjct  121  KAIIHAAKISNQCIIGTGAQVLDGAVVGENSIITAGSIVTQGKSVP  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375