BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF044E10

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       393   2e-132   Gentiana triflora
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  392   4e-132   Sesamum indicum [beniseed]
gb|KJB72027.1|  hypothetical protein B456_011G154000                    389   1e-131   Gossypium raimondii
gb|AAF19001.1|AF212157_1  S-adenosylhomocysteine hydrolase              385   1e-131   Allium cepa
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  391   1e-131   Nelumbo nucifera [Indian lotus]
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             390   2e-131   Nelumbo nucifera [Indian lotus]
gb|KJB72029.1|  hypothetical protein B456_011G154000                    389   2e-131   Gossypium raimondii
gb|KHG17040.1|  Adenosylhomocysteinase                                  390   2e-131   Gossypium arboreum [tree cotton]
gb|KJB37872.1|  hypothetical protein B456_006G223900                    389   3e-131   Gossypium raimondii
gb|KJB72028.1|  hypothetical protein B456_011G154000                    390   3e-131   Gossypium raimondii
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   390   3e-131   Citrus sinensis [apfelsine]
gb|KJB72024.1|  hypothetical protein B456_011G154000                    390   3e-131   Gossypium raimondii
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             390   4e-131   Citrus sinensis [apfelsine]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             390   4e-131   Citrus clementina [clementine]
dbj|BAA03710.1|  cytokinin binding protein CBP57                        388   7e-131   Nicotiana sylvestris
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  389   1e-130   Vitis vinifera
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             388   2e-130   Sesamum indicum [beniseed]
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    388   2e-130   Catharanthus roseus [chatas]
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             388   2e-130   Sesamum indicum [beniseed]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                388   3e-130   Cucumis melo [Oriental melon]
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                388   3e-130   Eucalyptus grandis [rose gum]
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             388   3e-130   
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                390   4e-130   Erythranthe guttata [common monkey flower]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     387   4e-130   Cucumis sativus [cucumbers]
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             387   5e-130   Nicotiana sylvestris
gb|KJB37873.1|  hypothetical protein B456_006G223900                    387   5e-130   Gossypium raimondii
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  387   6e-130   Gossypium arboreum [tree cotton]
emb|CDP11183.1|  unnamed protein product                                387   8e-130   Coffea canephora [robusta coffee]
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       386   1e-129   Nicotiana benthamiana
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     386   1e-129   Nicotiana tabacum [American tobacco]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         386   2e-129   Jatropha curcas
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  385   2e-129   Malus domestica [apple tree]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             385   2e-129   Nicotiana tomentosiformis
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  385   2e-129   Pyrus x bretschneideri [bai li]
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     385   3e-129   Nicotiana tabacum [American tobacco]
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   385   3e-129   Ricinus communis
ref|NP_001289538.1|  adenosylhomocysteinase                             385   3e-129   Nicotiana sylvestris
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             385   4e-129   Setaria italica
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                384   5e-129   Erythranthe guttata [common monkey flower]
ref|XP_010097949.1|  hypothetical protein L484_026840                   384   7e-129   Morus notabilis
gb|AGT16642.1|  Adenosylhomocysteinase                                  384   7e-129   Saccharum hybrid cultivar R570
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  384   8e-129   Solanum lycopersicum
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  384   8e-129   Malus domestica [apple tree]
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             384   9e-129   Setaria italica
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  384   9e-129   Populus euphratica
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             384   9e-129   Phoenix dactylifera
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             384   1e-128   Pyrus x bretschneideri [bai li]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             384   1e-128   
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      383   2e-128   Gossypium hirsutum [American cotton]
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     382   4e-128   Populus tomentosa [Chinese white poplar]
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                382   4e-128   Solanum tuberosum [potatoes]
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  382   4e-128   
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     382   4e-128   Populus tomentosa [Chinese white poplar]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     382   4e-128   Populus tomentosa [Chinese white poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     382   4e-128   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     382   4e-128   Populus tomentosa [Chinese white poplar]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     382   4e-128   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     382   4e-128   Populus tomentosa [Chinese white poplar]
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                384   4e-128   Erythranthe guttata [common monkey flower]
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   382   4e-128   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     382   4e-128   Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     382   4e-128   Populus tomentosa [Chinese white poplar]
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     382   5e-128   Populus tomentosa [Chinese white poplar]
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    382   5e-128   
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     382   5e-128   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     382   5e-128   Populus tomentosa [Chinese white poplar]
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  382   5e-128   Eucalyptus grandis [rose gum]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   382   5e-128   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     382   5e-128   Populus tomentosa [Chinese white poplar]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     382   5e-128   Populus tomentosa [Chinese white poplar]
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  382   5e-128   Nelumbo nucifera [Indian lotus]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   382   5e-128   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   382   5e-128   Populus tomentosa [Chinese white poplar]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   382   5e-128   Populus tomentosa [Chinese white poplar]
ref|NP_001148534.1|  adenosylhomocysteinase                             382   5e-128   
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   382   6e-128   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   382   6e-128   Populus tomentosa [Chinese white poplar]
ref|XP_006373090.1|  adenosylhomocysteinase family protein              382   6e-128   Populus trichocarpa [western balsam poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   382   6e-128   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   382   6e-128   Populus tomentosa [Chinese white poplar]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             382   6e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                382   6e-128   
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   382   7e-128   Populus tomentosa [Chinese white poplar]
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             382   7e-128   Populus euphratica
gb|ABG22475.1|  Adenosylhomocysteinase, putative, expressed             378   7e-128   Oryza sativa Japonica Group [Japonica rice]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   382   7e-128   Populus tomentosa [Chinese white poplar]
ref|NP_189023.1|  adenosylhomocysteinase 2                              382   7e-128   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   382   8e-128   Populus tomentosa [Chinese white poplar]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             382   8e-128   Arabidopsis thaliana [mouse-ear cress]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   381   8e-128   Populus tomentosa [Chinese white poplar]
ref|XP_002300147.1|  adenosylhomocysteinase family protein              381   9e-128   Populus trichocarpa [western balsam poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   381   9e-128   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   381   9e-128   Populus tomentosa [Chinese white poplar]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   381   9e-128   Populus tomentosa [Chinese white poplar]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   381   1e-127   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   381   1e-127   Populus tomentosa [Chinese white poplar]
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     381   1e-127   Populus tomentosa [Chinese white poplar]
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             381   1e-127   Solanum lycopersicum
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     381   1e-127   Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   381   1e-127   Populus tomentosa [Chinese white poplar]
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     382   1e-127   Eucalyptus grandis [rose gum]
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     381   1e-127   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     381   1e-127   Populus tomentosa [Chinese white poplar]
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   381   1e-127   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     381   1e-127   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     381   1e-127   Populus tomentosa [Chinese white poplar]
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             381   1e-127   Solanum tuberosum [potatoes]
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       380   2e-127   Prunus mume [ume]
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     380   2e-127   Populus tomentosa [Chinese white poplar]
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             380   2e-127   Elaeis guineensis
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     380   2e-127   Populus tomentosa [Chinese white poplar]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             380   2e-127   Prunus persica
gb|EPS72602.1|  adenosylhomocysteinase                                  383   2e-127   Genlisea aurea
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    383   2e-127   Linum usitatissimum
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       380   2e-127   Gentiana triflora
gb|ACN34730.1|  unknown                                                 380   2e-127   Zea mays [maize]
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     380   2e-127   Chrysanthemum x morifolium [florist's chrysanthemum]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    380   2e-127   Petroselinum crispum
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               380   2e-127   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        380   2e-127   Trifolium pratense [peavine clover]
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             380   3e-127   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           380   3e-127   Brassica rapa
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             379   3e-127   Oryza sativa Japonica Group [Japonica rice]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   380   3e-127   Populus tomentosa [Chinese white poplar]
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        380   3e-127   
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             380   3e-127   
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     380   3e-127   Populus tomentosa [Chinese white poplar]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     380   4e-127   Populus tomentosa [Chinese white poplar]
emb|CDX85127.1|  BnaC07g07790D                                          379   4e-127   
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     380   4e-127   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   380   4e-127   Populus tomentosa [Chinese white poplar]
emb|CDY53211.1|  BnaC03g74050D                                          379   4e-127   Brassica napus [oilseed rape]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   380   4e-127   Populus tomentosa [Chinese white poplar]
ref|XP_003629610.1|  Adenosylhomocysteinase                             380   4e-127   Medicago truncatula
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     380   4e-127   Populus tomentosa [Chinese white poplar]
emb|CDX77483.1|  BnaA07g06210D                                          379   4e-127   
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             380   4e-127   Glycine max [soybeans]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     380   4e-127   Populus tomentosa [Chinese white poplar]
ref|NP_001078387.1|  adenosylhomocysteinase 1                           374   4e-127   Arabidopsis thaliana [mouse-ear cress]
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        379   5e-127   Kalanchoe daigremontiana
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     379   5e-127   Populus tomentosa [Chinese white poplar]
dbj|BAH19670.1|  AT4G13940                                              374   5e-127   Arabidopsis thaliana [mouse-ear cress]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       379   5e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             379   5e-127   Eutrema salsugineum [saltwater cress]
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     379   6e-127   Populus tomentosa [Chinese white poplar]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   379   6e-127   Populus tomentosa [Chinese white poplar]
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  379   6e-127   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     379   6e-127   Populus tomentosa [Chinese white poplar]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   379   6e-127   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     379   7e-127   Populus tomentosa [Chinese white poplar]
gb|AEI54335.1|  adenosylhomocysteinase                                  379   7e-127   Glycine max [soybeans]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     379   7e-127   Populus tomentosa [Chinese white poplar]
gb|KJB28098.1|  hypothetical protein B456_005G027700                    379   9e-127   Gossypium raimondii
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   379   9e-127   Populus tomentosa [Chinese white poplar]
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     379   1e-126   Populus tomentosa [Chinese white poplar]
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   379   1e-126   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   379   1e-126   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   379   1e-126   Populus tomentosa [Chinese white poplar]
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             379   1e-126   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   379   1e-126   Populus tomentosa [Chinese white poplar]
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   379   1e-126   Populus tomentosa [Chinese white poplar]
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   379   1e-126   Populus tomentosa [Chinese white poplar]
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               378   1e-126   Capsicum annuum
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      378   1e-126   Brassica oleracea var. alboglabra [Chinese broccoli]
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             378   1e-126   Cicer arietinum [garbanzo]
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       380   1e-126   
ref|NP_001067845.2|  Os11g0455500                                       379   1e-126   
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     378   2e-126   Populus tomentosa [Chinese white poplar]
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    377   2e-126   Arabidopsis thaliana [mouse-ear cress]
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    377   2e-126   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     377   3e-126   Populus tomentosa [Chinese white poplar]
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   377   3e-126   Populus tomentosa [Chinese white poplar]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             377   3e-126   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             377   3e-126   Phaseolus vulgaris [French bean]
gb|EMT01272.1|  Adenosylhomocysteinase                                  377   3e-126   
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   377   3e-126   Populus tomentosa [Chinese white poplar]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   377   3e-126   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              377   5e-126   Populus tomentosa [Chinese white poplar]
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    377   5e-126   Medicago sativa [alfalfa]
emb|CDY47309.1|  BnaAnng08830D                                          377   5e-126   Brassica napus [oilseed rape]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             377   5e-126   Arabidopsis lyrata subsp. lyrata
ref|NP_001265954.1|  adenosylhomocysteinase-like                        377   5e-126   Cicer arietinum [garbanzo]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             377   6e-126   Capsella rubella
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            376   7e-126   Arabidopsis thaliana [mouse-ear cress]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    376   8e-126   Triticum aestivum [Canadian hard winter wheat]
emb|CDY58805.1|  BnaC08g46780D                                          376   8e-126   Brassica napus [oilseed rape]
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           376   8e-126   Brassica rapa
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            376   8e-126   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            376   9e-126   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62888.1|  adenosylhomocysteinase                                  376   9e-126   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193130.1|  adenosylhomocysteinase 1                              376   9e-126   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           376   1e-125   Camelina sativa [gold-of-pleasure]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  376   1e-125   Phoenix dactylifera
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    376   1e-125   Phalaenopsis sp.
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    376   1e-125   Arabis alpina [alpine rockcress]
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             379   1e-125   
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       376   1e-125   Nicotiana suaveolens
emb|CDY50106.1|  BnaC01g43540D                                          377   1e-125   Brassica napus [oilseed rape]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                375   2e-125   Camelina sativa [gold-of-pleasure]
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    375   2e-125   Arabis alpina [alpine rockcress]
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     375   2e-125   Populus tomentosa [Chinese white poplar]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    375   2e-125   Camelina sativa [gold-of-pleasure]
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                375   3e-125   Brassica rapa
emb|CDY01177.1|  BnaA04g06420D                                          375   3e-125   
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  375   3e-125   Fragaria vesca subsp. vesca
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                375   3e-125   Brassica rapa
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     375   4e-125   Populus tomentosa [Chinese white poplar]
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             374   4e-125   Glycine max [soybeans]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    374   8e-125   Mesembryanthemum crystallinum
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    374   8e-125   
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     374   9e-125   Populus tomentosa [Chinese white poplar]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          373   1e-124   Amborella trichopoda
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             373   1e-124   Vitis vinifera
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      373   1e-124   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                373   1e-124   Tarenaya hassleriana [spider flower]
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             373   1e-124   Cucumis melo [Oriental melon]
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                373   1e-124   Tarenaya hassleriana [spider flower]
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    373   2e-124   Arabis alpina [alpine rockcress]
emb|CDY50423.1|  BnaCnng19320D                                          373   2e-124   Brassica napus [oilseed rape]
ref|XP_003601687.1|  Adenosylhomocysteinase                             373   2e-124   Medicago truncatula
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             372   2e-124   Phoenix dactylifera
emb|CDP15078.1|  unnamed protein product                                372   4e-124   Coffea canephora [robusta coffee]
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             372   5e-124   Cucumis sativus [cucumbers]
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  372   5e-124   Beta vulgaris subsp. vulgaris [field beet]
gb|ABR16547.1|  unknown                                                 372   5e-124   Picea sitchensis
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           372   5e-124   Tarenaya hassleriana [spider flower]
gb|ABK25129.1|  unknown                                                 372   6e-124   Picea sitchensis
gb|ABK24229.1|  unknown                                                 372   6e-124   Picea sitchensis
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    372   6e-124   Lupinus luteus
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    372   6e-124   Lupinus luteus
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    371   9e-124   
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    371   1e-123   Pinus pinaster [cluster pine]
gb|ABR16573.1|  unknown                                                 370   1e-123   Picea sitchensis
gb|ABR17322.1|  unknown                                                 370   1e-123   Picea sitchensis
ref|NP_001234012.1|  adenosylhomocysteinase                             370   1e-123   
gb|ABR16616.1|  unknown                                                 369   1e-123   Picea sitchensis
gb|ABR16138.1|  unknown                                                 370   2e-123   Picea sitchensis
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             370   2e-123   Elaeis guineensis
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                370   2e-123   Brassica rapa
gb|ACN40278.1|  unknown                                                 370   3e-123   Picea sitchensis
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             369   5e-123   Phaseolus vulgaris [French bean]
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             365   2e-121   Oryza brachyantha
ref|XP_001755906.1|  predicted protein                                  363   9e-121   
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             363   1e-120   Selaginella moellendorffii
ref|XP_001755926.1|  predicted protein                                  362   2e-120   
ref|XP_001755929.1|  predicted protein                                  362   3e-120   
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     357   3e-118   Phaseolus vulgaris [French bean]
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      345   1e-113   Petunia x hybrida [garden petunia]
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  345   2e-113   Gossypium arboreum [tree cotton]
gb|ABR16332.1|  unknown                                                 345   2e-113   Picea sitchensis
gb|KJB19538.1|  hypothetical protein B456_003G108500                    343   5e-113   Gossypium raimondii
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                341   4e-112   
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     338   5e-111   Eucalyptus grandis [rose gum]
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     337   3e-110   Helicosporidium sp. ATCC 50920
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              335   1e-109   Volvox carteri f. nagariensis
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                331   4e-108   Chlorella variabilis
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  330   1e-107   Chlamydomonas reinhardtii
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       330   1e-107   Chlamydomonas sp. ICE-L
gb|ABI22054.1|  S-adenosyl-L-homocysteine hydrolase                     318   4e-107   Caragana jubata [camel's tail]
ref|NP_001031627.1|  adenosylhomocysteinase 1                           322   3e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011397211.1|  Adenosylhomocysteinase                             328   4e-106   Auxenochlorella protothecoides
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       326   5e-106   Dunaliella salina
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   323   1e-105   Citrus sinensis [apfelsine]
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             322   8e-105   Guillardia theta CCMP2712
gb|AAD56027.1|AF181566_1  S-adenosyl-L-homocysteine hydrolase           311   1e-104   Solanum chacoense
ref|XP_005708566.1|  adenosylhomocysteinase                             322   2e-104   Galdieria sulphuraria
gb|KIZ05177.1|  adenosylhomocysteinase                                  334   4e-104   Monoraphidium neglectum
gb|KCW60457.1|  hypothetical protein EUGRSUZ_H03177                     312   4e-101   Eucalyptus grandis [rose gum]
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   312   6e-101   
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   312   7e-101   
gb|KCW60454.1|  hypothetical protein EUGRSUZ_H03173                     311   2e-100   Eucalyptus grandis [rose gum]
gb|EPR62066.1|  putative adenosylhomocysteinase                         313   6e-100   Toxoplasma gondii GT1
gb|KFG55060.1|  putative adenosylhomocysteinase                         313   6e-100   Toxoplasma gondii FOU
gb|EPT27008.1|  adenosylhomocysteinase, putative                        313   6e-100   Toxoplasma gondii ME49
gb|KFH13893.1|  putative adenosylhomocysteinase                         313   7e-100   Toxoplasma gondii MAS
gb|ESS32583.1|  putative adenosylhomocysteinase                         313   9e-100   Toxoplasma gondii VEG
gb|KFG42936.1|  putative adenosylhomocysteinase                         313   1e-99    Toxoplasma gondii p89
ref|XP_008611237.1|  adenosylhomocysteinase                             308   3e-99    Saprolegnia diclina VS20
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                308   5e-99    Chondrus crispus [carageen]
gb|AGV54286.1|  adenosylhomocysteinase                                  307   7e-99    
gb|EMS57266.1|  Adenosylhomocysteinase                                  314   1e-98    
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  306   1e-98    
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  306   2e-98    
gb|AGF95113.1|  adenosylhomocysteinase                                  298   4e-98    
gb|KCW60456.1|  hypothetical protein EUGRSUZ_H03176                     304   9e-98    
emb|CCA20123.1|  unnamed protein product                                303   2e-97    
ref|XP_008893590.1|  adenosylhomocysteinase                             303   2e-97    
ref|XP_009531393.1|  hypothetical protein PHYSODRAFT_347096             302   5e-97    
ref|XP_008872075.1|  adenosylhomocysteinase 2                           302   7e-97    
ref|XP_002902721.1|  adenosylhomocysteinase                             301   1e-96    
ref|XP_010024049.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    301   2e-96    
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     300   3e-96    
ref|XP_009833581.1|  adenosylhomocysteinase 2                           300   6e-96    
ref|XP_005535237.1|  S-adenosyl-L-homocysteine hydrolase                300   2e-95    
ref|XP_003057172.1|  adenosylhomocysteinase                             299   2e-95    
emb|CCI50303.1|  unnamed protein product                                298   4e-95    
ref|XP_002505983.1|  adenosylhomocysteinase                             296   2e-94    
gb|EWM21100.1|  s-adenosyl homocysteine hydrolase                       296   2e-93    
ref|XP_005790915.1|  S-adenosyl-L-homocysteine hydrolase                292   6e-93    
emb|CBJ28078.1|  S-Adenosyl homocysteine hydrolase                      291   1e-92    
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                293   1e-92    
gb|KFG60763.1|  putative adenosylhomocysteinase                         286   4e-92    
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              290   5e-92    
ref|XP_005786995.1|  S-adenosyl-L-homocysteine hydrolase                289   6e-92    
ref|XP_002177758.1|  adenosylhomocysteinase                             288   1e-91    
ref|XP_009033133.1|  hypothetical protein AURANDRAFT_69644              288   1e-91    
ref|WP_020576907.1|  S-adenosyl-L-homocysteine hydrolase                287   4e-91    
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      287   6e-91    
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    286   1e-90    
ref|XP_009493630.1|  adenosylhomocysteinase 1                           286   2e-90    
ref|XP_002765933.1|  conserved hypothetical protein                     285   2e-90    
ref|XP_003081254.1|  SAHH_PETCR Adenosylhomocysteinase (ISS)            283   4e-90    
ref|XP_002788757.1|  conserved hypothetical protein                     285   4e-90    
ref|XP_001419579.1|  predicted protein                                  284   5e-90    
gb|KHN12344.1|  Adenosylhomocysteinase                                  282   6e-90    
ref|WP_017625947.1|  S-adenosyl-L-homocysteine hydrolase                284   7e-90    
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    283   1e-89    
ref|WP_011292928.1|  S-adenosyl-L-homocysteine hydrolase                282   3e-89    
ref|WP_012631604.1|  S-adenosyl-L-homocysteine hydrolase                282   5e-89    
ref|WP_012524242.1|  S-adenosyl-L-homocysteine hydrolase                282   6e-89    
ref|WP_028648434.1|  S-adenosyl-L-homocysteine hydrolase                281   9e-89    
ref|WP_038287745.1|  hypothetical protein                               281   1e-88    
gb|EPT24453.1|  S-Adenosyl homocysteine hydrolase                       276   1e-88    
ref|WP_017538521.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    280   2e-88    
ref|WP_017583238.1|  S-adenosyl-L-homocysteine hydrolase                280   2e-88    
ref|WP_014911909.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    280   3e-88    
gb|EMS57067.1|  Adenosylhomocysteinase                                  277   4e-88    
ref|WP_020389898.1|  S-adenosyl-L-homocysteine hydrolase                279   8e-88    
ref|WP_014142777.1|  S-adenosyl-L-homocysteine hydrolase                279   8e-88    
ref|WP_030260730.1|  MULTISPECIES: hypothetical protein                 278   9e-88    
ref|WP_028072996.1|  hypothetical protein                               273   1e-87    
gb|EJY87176.1|  Adenosylhomocysteinase                                  278   1e-87    
ref|WP_031077053.1|  hypothetical protein                               278   2e-87    
ref|WP_017613514.1|  S-adenosyl-L-homocysteine hydrolase                277   2e-87    
ref|WP_017595102.1|  S-adenosyl-L-homocysteine hydrolase                277   2e-87    
ref|WP_030289952.1|  MULTISPECIES: hypothetical protein                 277   3e-87    
gb|ABA01148.1|  S-adenosyl-L-homocystein hydrolase                      270   3e-87    
ref|WP_017596835.1|  S-adenosyl-L-homocysteine hydrolase                277   4e-87    
ref|WP_017542451.1|  S-adenosyl-L-homocysteine hydrolase                276   5e-87    
ref|WP_004953444.1|  S-adenosyl-L-homocysteine hydrolase                277   5e-87    
gb|ABS24379.1|  adenosylhomocysteinase                                  277   5e-87    
ref|WP_018386384.1|  S-adenosyl-L-homocysteine hydrolase                277   6e-87    
ref|WP_041448694.1|  adenosylhomocysteinase                             276   6e-87    
ref|WP_017618754.1|  S-adenosyl-L-homocysteine hydrolase                276   8e-87    
ref|WP_042456565.1|  hypothetical protein                               276   9e-87    
ref|WP_035848617.1|  hypothetical protein                               276   1e-86    
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                276   1e-86    
ref|WP_043474120.1|  adenosylhomocysteinase                             275   1e-86    
ref|WP_033342518.1|  hypothetical protein                               275   1e-86    
ref|WP_030742429.1|  adenosylhomocysteinase                             276   1e-86    
ref|WP_030245490.1|  hypothetical protein                               275   2e-86    
ref|WP_038286492.1|  hypothetical protein                               275   2e-86    
ref|WP_012919256.1|  S-adenosyl-L-homocysteine hydrolase                275   2e-86    
ref|WP_042387828.1|  hypothetical protein                               275   2e-86    
ref|WP_033354750.1|  hypothetical protein                               275   2e-86    
ref|WP_017604622.1|  S-adenosyl-L-homocysteine hydrolase                275   2e-86    
ref|WP_038286830.1|  hypothetical protein                               275   2e-86    
ref|WP_028587624.1|  adenosylhomocysteinase                             275   2e-86    
ref|WP_015752724.1|  S-adenosyl-L-homocysteine hydrolase                275   2e-86    
ref|WP_038284612.1|  hypothetical protein                               275   2e-86    
ref|WP_014804737.1|  S-adenosyl-L-homocysteine hydrolase                275   3e-86    
ref|WP_019886836.1|  S-adenosyl-L-homocysteine hydrolase                275   4e-86    
ref|WP_037605447.1|  hypothetical protein                               275   4e-86    
ref|WP_018123759.1|  S-adenosyl-L-homocysteine hydrolase                274   5e-86    
ref|WP_019711661.1|  S-adenosyl-L-homocysteine hydrolase                274   5e-86    
ref|WP_031015775.1|  adenosylhomocysteinase                             270   5e-86    
ref|WP_017608316.1|  S-adenosyl-L-homocysteine hydrolase                274   5e-86    
ref|WP_030694652.1|  adenosylhomocysteinase                             271   6e-86    
ref|WP_030543976.1|  adenosylhomocysteinase                             274   6e-86    
ref|WP_027721098.1|  adenosylhomocysteinase                             274   6e-86    
ref|WP_019608106.1|  S-adenosyl-L-homocysteine hydrolase                274   6e-86    
ref|WP_043108500.1|  adenosylhomocysteinase                             273   6e-86    
ref|WP_013154760.1|  S-adenosyl-L-homocysteine hydrolase                274   7e-86    
ref|WP_030398087.1|  MULTISPECIES: hypothetical protein                 273   9e-86    
ref|WP_030264019.1|  hypothetical protein                               273   1e-85    
ref|WP_027182367.1|  adenosylhomocysteinase                             273   1e-85    
ref|WP_031136433.1|  adenosylhomocysteinase                             273   1e-85    
ref|WP_018846770.1|  S-adenosyl-L-homocysteine hydrolase                273   1e-85    
ref|WP_011368885.1|  S-adenosyl-L-homocysteine hydrolase                273   1e-85    
ref|WP_037910293.1|  adenosylhomocysteinase                             273   2e-85    
ref|WP_023588381.1|  S-adenosyl-L-homocysteine hydrolase                273   2e-85    
ref|WP_028072995.1|  hypothetical protein                               268   2e-85    
ref|WP_041129509.1|  adenosylhomocysteinase                             273   2e-85    
ref|WP_006348984.1|  S-adenosyl-L-homocysteine hydrolase                273   2e-85    
ref|WP_033218411.1|  S-adenosyl-L-homocysteine hydrolase                273   2e-85    
ref|WP_011419216.1|  S-adenosyl-L-homocysteine hydrolase                273   2e-85    
ref|WP_034088535.1|  hypothetical protein                               273   2e-85    
ref|WP_030735559.1|  adenosylhomocysteinase                             272   2e-85    
ref|XP_010024045.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    271   2e-85    
ref|WP_042816899.1|  adenosylhomocysteinase                             271   2e-85    
ref|WP_042410976.1|  hypothetical protein                               272   2e-85    
ref|WP_040477321.1|  S-adenosyl-L-homocysteine hydrolase                273   3e-85    
ref|WP_010472770.1|  S-adenosyl-L-homocysteine hydrolase                272   3e-85    
ref|WP_030773209.1|  adenosylhomocysteinase                             272   3e-85    
ref|WP_028061676.1|  hypothetical protein                               272   3e-85    
ref|WP_028810729.1|  adenosylhomocysteinase                             272   3e-85    
ref|WP_027177311.1|  adenosylhomocysteinase                             272   3e-85    
ref|WP_031068303.1|  adenosylhomocysteinase                             272   3e-85    
ref|WP_029970146.1|  adenosylhomocysteinase                             271   4e-85    
ref|WP_028576653.1|  adenosylhomocysteinase                             271   4e-85    
ref|WP_014046362.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    272   4e-85    
ref|WP_039960509.1|  adenosylhomocysteinase                             266   4e-85    
ref|WP_035863223.1|  S-adenosyl-L-homocysteine hydrolase                272   4e-85    
ref|WP_030310801.1|  hypothetical protein                               271   5e-85    
ref|WP_015336419.1|  Adenosylhomocysteinase                             271   5e-85    
ref|WP_027734715.1|  adenosylhomocysteinase                             271   5e-85    
ref|WP_020000884.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    271   5e-85    
ref|WP_017945881.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    271   5e-85    
ref|WP_043914237.1|  S-adenosyl-L-homocysteine hydrolase                271   5e-85    
ref|WP_033210793.1|  adenosylhomocysteinase                             271   6e-85    
ref|WP_017238337.1|  S-adenosyl-L-homocysteine hydrolase                271   6e-85    
ref|WP_039701391.1|  hypothetical protein                               271   6e-85    
ref|WP_030276178.1|  hypothetical protein                               271   6e-85    
ref|WP_020251800.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    271   7e-85    
ref|WP_009996356.1|  S-adenosyl-L-homocysteine hydrolase                271   7e-85    
ref|WP_030221825.1|  adenosylhomocysteinase                             271   7e-85    
ref|WP_017570953.1|  S-adenosyl-L-homocysteine hydrolase                271   7e-85    
ref|WP_003957148.1|  S-adenosyl-L-homocysteine hydrolase                271   7e-85    
ref|WP_020252885.1|  hypothetical protein                               271   8e-85    
ref|WP_031126383.1|  adenosylhomocysteinase                             271   9e-85    
ref|WP_030556303.1|  adenosylhomocysteinase                             271   9e-85    
ref|WP_038289513.1|  hypothetical protein                               271   9e-85    
ref|WP_015608928.1|  MULTISPECIES: SAHH Adenosylhomocysteinase          271   9e-85    
ref|WP_014136057.1|  S-adenosyl-L-homocysteine hydrolase                271   1e-84    
ref|WP_019763336.1|  S-adenosyl-L-homocysteine hydrolase                271   1e-84    
ref|WP_018552942.1|  S-adenosyl-L-homocysteine hydrolase                269   1e-84    
ref|WP_017575237.1|  S-adenosyl-L-homocysteine hydrolase                271   1e-84    
ref|WP_014155919.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    271   1e-84    
ref|WP_030221676.1|  adenosylhomocysteinase                             271   1e-84    
ref|WP_030365247.1|  adenosylhomocysteinase                             271   1e-84    
ref|WP_035801129.1|  hypothetical protein                               271   1e-84    
gb|ABI22140.1|  putative adenosylhomocysteinase                         271   1e-84    
ref|WP_015774474.1|  S-adenosyl-L-homocysteine hydrolase                270   1e-84    
ref|WP_003960672.1|  S-adenosyl-L-homocysteine hydrolase                271   1e-84    
ref|WP_030029718.1|  adenosylhomocysteinase                             270   1e-84    
ref|WP_030390893.1|  adenosylhomocysteinase                             268   1e-84    
ref|WP_033255593.1|  S-adenosyl-L-homocysteine hydrolase                270   1e-84    
ref|WP_037575816.1|  hypothetical protein                               270   2e-84    
ref|WP_030837066.1|  adenosylhomocysteinase                             270   2e-84    
ref|WP_018559695.1|  S-adenosyl-L-homocysteine hydrolase                270   2e-84    
ref|WP_027366923.1|  adenosylhomocysteinase                             270   2e-84    
ref|WP_028421799.1|  adenosylhomocysteinase                             270   2e-84    
ref|WP_027139388.1|  hypothetical protein                               271   2e-84    
ref|WP_007264450.1|  S-adenosyl-L-homocysteine hydrolase                270   2e-84    
ref|WP_030977071.1|  adenosylhomocysteinase                             270   2e-84    
ref|WP_033173798.1|  adenosylhomocysteinase                             270   2e-84    
ref|WP_005986067.1|  adenosylhomocysteinase                             270   2e-84    
ref|WP_030927023.1|  adenosylhomocysteinase                             270   2e-84    
ref|WP_030461911.1|  S-adenosyl-L-homocysteine hydrolase                270   2e-84    
ref|WP_030326708.1|  adenosylhomocysteinase                             269   2e-84    
ref|WP_037699778.1|  adenosylhomocysteinase                             270   2e-84    
ref|WP_030920540.1|  S-adenosyl-L-homocysteine hydrolase                270   2e-84    
ref|WP_030250255.1|  MULTISPECIES: adenosylhomocysteinase               270   2e-84    
ref|WP_031119192.1|  MULTISPECIES: adenosylhomocysteinase               270   3e-84    
ref|WP_028573810.1|  adenosylhomocysteinase                             270   3e-84    
ref|WP_040021917.1|  adenosylhomocysteinase                             270   3e-84    
ref|WP_017564266.1|  S-adenosyl-L-homocysteine hydrolase                270   3e-84    
ref|WP_029384937.1|  MULTISPECIES: adenosylhomocysteinase               270   3e-84    
ref|WP_017585142.1|  S-adenosyl-L-homocysteine hydrolase                270   3e-84    
ref|WP_015033968.1|  S-adenosyl-L-homocysteine hydrolase                270   3e-84    
ref|WP_027290196.1|  adenosylhomocysteinase                             269   4e-84    
ref|WP_024886447.1|  adenosylhomocysteinase                             270   4e-84    
ref|WP_018524685.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    270   4e-84    
ref|WP_031155422.1|  adenosylhomocysteinase                             269   4e-84    
ref|WP_019983817.1|  S-adenosyl-L-homocysteine hydrolase                269   4e-84    
ref|WP_027357796.1|  adenosylhomocysteinase                             269   5e-84    
ref|WP_018103985.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    269   5e-84    
ref|WP_030010948.1|  adenosylhomocysteinase                             269   5e-84    
ref|WP_020207405.1|  S-adenosyl-L-homocysteine hydrolase                268   5e-84    
ref|WP_030724754.1|  adenosylhomocysteinase                             269   5e-84    
ref|WP_020880885.1|  Adenosylhomocysteinase                             269   5e-84    
ref|WP_020870822.1|  S-adenosyl-L-homocysteine hydrolase                269   5e-84    
ref|WP_019435388.1|  S-adenosyl-L-homocysteine hydrolase                268   6e-84    
ref|WP_014259438.1|  S-adenosyl-L-homocysteine hydrolase                268   7e-84    
ref|WP_033305043.1|  adenosylhomocysteinase                             269   8e-84    
ref|WP_030966311.1|  adenosylhomocysteinase                             268   8e-84    
ref|WP_033824956.1|  hypothetical protein                               268   8e-84    
ref|WP_030350966.1|  adenosylhomocysteinase                             268   8e-84    
ref|WP_030912635.1|  adenosylhomocysteinase                             268   8e-84    
ref|WP_040272134.1|  hypothetical protein                               268   8e-84    
ref|WP_030763676.1|  MULTISPECIES: adenosylhomocysteinase               268   8e-84    
ref|WP_030891029.1|  adenosylhomocysteinase                             268   8e-84    
ref|WP_014177043.1|  S-adenosyl-L-homocysteine hydrolase                268   8e-84    
ref|WP_037954273.1|  adenosylhomocysteinase                             268   9e-84    
ref|WP_030194140.1|  adenosylhomocysteinase                             268   9e-84    
ref|WP_044574415.1|  adenosylhomocysteinase                             268   1e-83    
gb|AFW60834.1|  adenosyl homocysteine hydrolase1                        261   1e-83    
ref|WP_043372348.1|  adenosylhomocysteinase                             268   1e-83    
ref|WP_031509769.1|  adenosylhomocysteinase                             268   1e-83    
ref|WP_037797703.1|  adenosylhomocysteinase                             268   1e-83    
ref|WP_004987269.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    268   1e-83    
ref|WP_030659898.1|  MULTISPECIES: adenosylhomocysteinase               268   1e-83    
ref|WP_031481867.1|  adenosylhomocysteinase                             268   1e-83    
ref|NP_001031628.1|  adenosylhomocysteinase 1                           266   1e-83    
gb|ADE22275.1|  putative adenosylhomocysteinase                         268   1e-83    
ref|WP_008682990.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    268   1e-83    
ref|WP_023410675.1|  S-adenosyl-L-homocysteine hydrolase                267   1e-83    
ref|WP_019527109.1|  S-adenosyl-L-homocysteine hydrolase                268   1e-83    
ref|WP_030700076.1|  adenosylhomocysteinase                             268   2e-83    
ref|WP_028959699.1|  adenosylhomocysteinase                             268   2e-83    



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   393 bits (1010),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 208/213 (98%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G +PDPSSTDNAEFQ+VLTIIRDGLK DP+KYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFKKSGKLPDPSSTDNAEFQLVLTIIRDGLKTDPEKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   392 bits (1008),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 201/213 (94%), Positives = 207/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K+G +PDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCAAALKQAGARV+VTEIDPI
Sbjct  264  VGVVCGYGDVGKGCAAALKQAGARVVVTEIDPI  296



>gb|KJB72027.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=423

 Score =   389 bits (999),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  22   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDA  81

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS
Sbjct  82   TLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  141

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  142  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  201

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  202  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  234



>gb|AAF19001.1|AF212157_1 S-adenosylhomocysteine hydrolase [Allium cepa]
Length=312

 Score =   385 bits (989),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY KNGT+PDPSSTDNAEFQIVLTIIRDGLK DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKNGTLPDPSSTDNAEFQIVLTIIRDGLKVDPTKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA V GYGDVGKGCAAALKQAGARVIV+EIDPI
Sbjct  264  VAFVAGYGDVGKGCAAALKQAGARVIVSEIDPI  296



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK G +PDPSSTDNAEFQIVLTIIRDGLKADP KY +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKTGKLPDPSSTDNAEFQIVLTIIRDGLKADPMKYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQAAGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK G +PDPSSTDNAEFQIVLTIIRDGLKADP KY +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKTGKLPDPSSTDNAEFQIVLTIIRDGLKADPMKYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQAAGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|KJB72029.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=456

 Score =   389 bits (1000),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  55   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDA  114

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS
Sbjct  115  TLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  174

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  175  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  234

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  235  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  267



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   390 bits (1003),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS
Sbjct  144  TLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|KJB37872.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=446

 Score =   389 bits (999),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLKADPKKY RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRDGLKADPKKYRRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   390 bits (1002),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS
Sbjct  144  TLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   390 bits (1002),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLKADPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   390 bits (1002),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 202/213 (95%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS
Sbjct  144  TLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   390 bits (1001),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLKADPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   390 bits (1001),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+ALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEKALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLKADPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKADPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>dbj|BAA03710.1| cytokinin binding protein CBP57 [Nicotiana sylvestris]
Length=450

 Score =   388 bits (997),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  49   CSCNIFSTQDHAAAAIARDSRAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  108

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQ+VLTIIRDGLK DP KYT+MKERLVGVS
Sbjct  109  TLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQLVLTIIRDGLKTDPLKYTKMKERLVGVS  168

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  169  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  228

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  229  VALVAGYGDVGKGCAAALKQAGARVIVTEIDPI  261



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQIVLTIIRDGLK DPK+Y +MK RLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVLTIIRDGLKTDPKRYHKMKGRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK+G +PDP+STDNAEFQIVLTIIRDGLK DPKKYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKSGKMPDPTSTDNAEFQIVLTIIRDGLKVDPKKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VGVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQ+HAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY KNG +PDPSSTDNAEFQIVLTIIRDGLK+DP KYTRMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVLTIIRDGLKSDPTKYTRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVAGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   388 bits (996),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK+G +PDP+STDNAEFQIVLTIIRDGLK DPKKYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKSGKMPDPTSTDNAEFQIVLTIIRDGLKVDPKKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VGVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLK+DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTIIRDGLKSDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQSSGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K G VPDP+STDNAEFQIVLTII+DGLKADPKKY +M++RLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKTGKVPDPASTDNAEFQIVLTIIKDGLKADPKKYRKMRDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLK+DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTIIRDGLKSDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQSSGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   390 bits (1003),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  173  CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  232

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ KNGTVPDP+STDNAEFQIVLTIIRDGLK DPK+YT+MKERLVGVS
Sbjct  233  TLLIHEGVKAEEEFEKNGTVPDPNSTDNAEFQIVLTIIRDGLKTDPKRYTKMKERLVGVS  292

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  293  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  352

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCA +LKQAGARVIVTEIDPI
Sbjct  353  VGVVCGYGDVGKGCAISLKQAGARVIVTEIDPI  385



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   387 bits (995),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLK+DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVLTIIRDGLKSDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQSSGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   387 bits (994),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 199/213 (93%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQ+VLTIIRDGLK DP KYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQLVLTIIRDGLKTDPLKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VALVAGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   387 bits (994),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLKADPKKY RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRDGLKADPKKYRRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   387 bits (993),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLKADPKKY RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRDGLKADPKKYRRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   387 bits (993),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVLTIIRDGLK DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYKKSGKLPDPASTDNAEFQIVLTIIRDGLKTDPTKYAKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VGVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   386 bits (991),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAKNGT+PDP+STDNAEFQ+VLTII++ LK DP KYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKNGTIPDPNSTDNAEFQLVLTIIKESLKTDPLKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VALVAGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   386 bits (991),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAKNGT+PDP+STDNAEFQ+VLTII++ LK DP KYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKNGTIPDPNSTDNAEFQLVLTIIKESLKTDPLKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VALVAGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   386 bits (991),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVLTIIRDGLK DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGQLPDPSSTDNAEFQIVLTIIRDGLKTDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQVNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK+GT+PDPSSTDN EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKSGTLPDPSSTDNQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V+VVCGYGDVGKGCAAALKQAG+RV+VTEIDPI
Sbjct  264  VSVVCGYGDVGKGCAAALKQAGSRVVVTEIDPI  296



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK+G +PDPSSTDN EFQ+VLTIIRDGLK DP KYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKSGKLPDPSSTDNVEFQLVLTIIRDGLKTDPLKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VALVAGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK+GT+PDPSSTDN EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKSGTLPDPSSTDNQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V+VVCGYGDVGKGCAAALKQAG+RV+VTEIDPI
Sbjct  264  VSVVCGYGDVGKGCAAALKQAGSRVVVTEIDPI  296



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   385 bits (988),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  78   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  137

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK+G +PDPSSTDN EFQ+VLTIIRDGLK DP KYT+MKERLVGVS
Sbjct  138  TLLIHEGVKAEEEYAKSGKLPDPSSTDNVEFQLVLTIIRDGLKTDPLKYTKMKERLVGVS  197

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  198  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  257

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  258  VALVAGYGDVGKGCAAALKQAGARVIVTEIDPI  290



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   385 bits (989),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGQVPDPTSTDNAEFQIVLTIIRDGLKTDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPI
Sbjct  264  VSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPI  296



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   385 bits (988),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 206/213 (97%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII++ LK DP KYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLKTDPLKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VALVAGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   385 bits (988),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGEGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K+G +PDP STDNAEF+IVLTIIRDGLK+DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKSGKIPDPESTDNAEFKIVLTIIRDGLKSDPKKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   384 bits (987),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G VPDPSSTDNAEFQIVLTIIRDGLK DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGKVPDPSSTDNAEFQIVLTIIRDGLKEDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQLNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCA +LKQAGARVIVTEIDPI
Sbjct  264  VGVVCGYGDVGKGCAISLKQAGARVIVTEIDPI  296



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   384 bits (987),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   384 bits (986),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGEGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G +PDP STDNAEF+IVLTIIRDGLKADPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKIPDPESTDNAEFKIVLTIIRDGLKADPKKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   384 bits (986),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AKNGT+PDPSSTDN EFQ+VLTII++ LK DP KYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKNGTIPDPSSTDNVEFQLVLTIIKESLKTDPLKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VALVAGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   384 bits (986),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+GT+PDPSSTDN EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGTLPDPSSTDNQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPI
Sbjct  264  VSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPI  296



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   384 bits (986),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGEGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G VPDP STDNAEF+IVLTIIRDGLK+DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKVPDPESTDNAEFKIVLTIIRDGLKSDPKRYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   384 bits (986),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 198/213 (93%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK+DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKSDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   384 bits (986),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTER LDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSVAVFAWKGETLQEYWWCTERCLDWGPAGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRD LK DPKKYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLIRDSLKVDPKKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+GT+PDPSSTDN EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGTLPDPSSTDNQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ S TLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASSTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPI
Sbjct  264  VSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPI  296



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  106  CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  165

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  166  TLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  225

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  226  EETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  285

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  286  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  318



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   383 bits (983),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/213 (94%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+A DSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIAHDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAE+ Y K G +PDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS
Sbjct  144  TLLIHEGVKAEQVYEKTGQLPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VLTII++ LK DP +YT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVLTIIKESLKTDPLRYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VALVAGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER LDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERCLDWGPAGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G VPDP+STDNAEFQIVL +IRD +K DPKKY RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKVPDPASTDNAEFQIVLGLIRDSIKVDPKKYRRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   384 bits (987),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  146  CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  205

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K G +PDPSSTDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  206  TLLIHEGVKAEEEFEKTGKLPDPSSTDNAEFQIVLTIIRDGLKTDPKRYAKMKERLVGVS  265

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  266  EETTTGVKRLYQMQLNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  325

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCA +LKQAGARVIVTEIDPI
Sbjct  326  VGVVCGYGDVGKGCAISLKQAGARVIVTEIDPI  358



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VLTII++ LK DP +YT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVLTIIKESLKTDPLRYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VALVAGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTIIRDGLK DP++Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTIIRDGLKTDPQRYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERALDWGPSGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K G  PDPSST+NAEFQIVLT+I+DGLK DPKKY +M+ERLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKTGKFPDPSSTNNAEFQIVLTLIKDGLKTDPKKYHKMQERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQSAGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            +AVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  IAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG  GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGEAGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G +PDP STDNAEF+IVLTIIRDGLKADPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKIPDPESTDNAEFKIVLTIIRDGLKADPKKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (980),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (980),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   382 bits (980),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (980),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (980),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   382 bits (980),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   382 bits (982),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERALDWGPTGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLK D KKYTRMK RLVGVS
Sbjct  144  TLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVLTIIRDGLKTDRKKYTRMKNRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (980),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   382 bits (980),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|ABG22475.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
Length=392

 Score =   378 bits (971),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  49   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDA  108

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  109  TLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTIIRDGLKSDPSKYRKMKERLVGVS  168

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  169  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  228

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  229  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  261



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (980),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   382 bits (980),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   382 bits (980),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   382 bits (980),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   381 bits (979),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   381 bits (979),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 197/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G  PDP+STDNAEFQIVLTIIRDGLK+DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGASPDPASTDNAEFQIVLTIIRDGLKSDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   381 bits (979),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   381 bits (979),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   381 bits (979),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLL+HEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLVHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK G  PDP+STDN EFQ+VLTII+DGLK+DP KYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKTGKFPDPNSTDNVEFQLVLTIIKDGLKSDPLKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA++ GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VALIAGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|KCW59951.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=517

 Score =   382 bits (981),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VLTIIRDGLK DP++Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVLTIIRDGLKTDPQRYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGV+AEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVRAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDG MRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGFMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   381 bits (978),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK G  PDP STDN EFQ+VLTII+DGLK+DP KYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKTGKFPDPHSTDNVEFQLVLTIIKDGLKSDPLKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA++ GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VALIAGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPI
Sbjct  264  VSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPI  296



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDS TKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSATKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER LDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERCLDWGPAGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G +PDP+STDN+EFQIVL +IRD LK DPKKYT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKMPDPTSTDNSEFQIVLGLIRDSLKVDPKKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
             LLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  ALLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPI
Sbjct  264  VSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPI  296



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   383 bits (984),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  166  CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  225

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAE EY K G +PDP+STDNAEFQ+VL +IRDGLK DPK+YT+MKERLVGVS
Sbjct  226  TLLIHEGVKAEAEYEKTGKLPDPNSTDNAEFQLVLGLIRDGLKTDPKRYTKMKERLVGVS  285

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  286  EETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  345

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            + VVCGYGDVGKGCAAALKQAGARV+VTEIDPI
Sbjct  346  IGVVCGYGDVGKGCAAALKQAGARVVVTEIDPI  378



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   383 bits (983),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  160  CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  219

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVLTIIRDGLK DPKKY +M++RLVGVS
Sbjct  220  TLLIHEGVKAEEEYEKSGKIPDPASTDNAEFQIVLTIIRDGLKTDPKKYRKMRDRLVGVS  279

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  280  EETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  339

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  340  VAVVLGYGDVGKGCAAAMKQAGARVIVTEIDPI  372



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAA +ARD AAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAATIARDCAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDT  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+  +GT+PDP+STDNAEFQIVLTIIRDGLK DP KYT+MKER+VGVS
Sbjct  144  TLLIHEGVKAEEEFKTSGTMPDPNSTDNAEFQIVLTIIRDGLKTDPTKYTKMKERIVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVFGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG  GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGEAGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE+Y K G +PDP STDNAEF+IVLTIIRDGLKADPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEDYEKTGKIPDPESTDNAEFKIVLTIIRDGLKADPKKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 205/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK+G +PDP+STDNAEFQIVL+II++GL  DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKSGKLPDPTSTDNAEFQIVLSIIKEGLSTDPLKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCA+A+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCASAMKQAGARVIVTEIDPI  296



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVL+IIRDGLK+DP KY +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVLSIIRDGLKSDPMKYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA++ GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VALIAGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTIIRDGLKSDPSKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   380 bits (976),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDPSSTDN EFQ+VLTIIRDGLK DP++Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEELYEKTGEVPDPSSTDNVEFQLVLTIIRDGLKTDPQRYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCA ALKQAGARVIVTEIDPI
Sbjct  264  VGVVCGYGDVGKGCAVALKQAGARVIVTEIDPI  296



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER LDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERCLDWGPAGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRDGLK DPKKY RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKLPDPASTDNAEFQIVLGLIRDGLKVDPKKYRRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AK G VPDPSSTDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKTGQVPDPSSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|ABA93500.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABA93501.1| Adenosylhomocysteinase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG93815.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   379 bits (973),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  49   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDA  108

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  109  TLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTIIRDGLKSDPSKYRKMKERLVGVS  168

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  169  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  228

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  229  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  261



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAW+GETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWEGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYYKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K GT PDP+STDN EFQIVL IIRDGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGTFPDPTSTDNPEFQIVLAIIRDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLK DP +Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTIIRDGLKTDPTRYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVAGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   380 bits (976),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y  MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHEMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EET TGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETATGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score =   379 bits (974),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKR YQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRSYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY ++KERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKVKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>emb|CDY53211.1| BnaC03g74050D [Brassica napus]
Length=476

 Score =   379 bits (974),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AK G VPDPSSTDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKTGQVPDPSSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFD+LYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDSLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDPSSTDNAEFQ+VLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEELYEKTGEVPDPSSTDNAEFQLVLTIIRDGLKTDPKRYRKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VV GYGDVGKGCA ALKQAGARVIVTEIDPI
Sbjct  264  VGVVAGYGDVGKGCAVALKQAGARVIVTEIDPI  296



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGA VIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGASVIVTEIDPI  296



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score =   379 bits (972),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLK DP +Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTIIRDGLKTDPTRYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVAGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ  GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIA  
Sbjct  204  EETTTGVKRLYQMQIDGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIASK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|NP_001078387.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83348.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=325

 Score =   374 bits (960),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   379 bits (974),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFS+QDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLI DDGGDA
Sbjct  84   CSCNIFSSQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPSGGPDLIFDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            ++LIHEGVKAEEE+AKNGTVPDP ST N +FQIVLTIIRDGLK DP++Y ++K+RLVGVS
Sbjct  144  SMLIHEGVKAEEEFAKNGTVPDPHSTTNPDFQIVLTIIRDGLKTDPQRYHKIKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   379 bits (974),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDS TKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSATKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>dbj|BAH19670.1| AT4G13940 [Arabidopsis thaliana]
Length=325

 Score =   374 bits (959),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEVFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   379 bits (974),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAE  +AKNGT PDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEAIFAKNGTFPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   379 bits (974),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AK G  PDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKTGQFPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   379 bits (974),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+K+AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKRAGARVIVTEIDPI  296



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   379 bits (974),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDW PGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWSPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   379 bits (974),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER LDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERCLDWGPNGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL IIRDGLK DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKLPDPASTDNAEFQIVLGIIRDGLKVDPKKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   379 bits (974),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV CGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVACGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   379 bits (974),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPSGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGL++DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLRSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   379 bits (973),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINV+DSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVSDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   379 bits (973),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDNAEFQIVLTIIRDGLK DP +Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVLTIIRDGLKTDPTRYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVAGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   379 bits (973),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDL VDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLTVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   379 bits (973),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAA +ARDSA+VFAWKGETLQEYWWCTE++LDWG GGGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAVIARDSASVFAWKGETLQEYWWCTEKSLDWGAGGGPDLIVDDGGDV  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            T+LIHEGVKAEE Y K G VPDP+S+DNAEFQIVLTII+DGL A+PKKYT+MKERLVGVS
Sbjct  144  TMLIHEGVKAEEAYEKTGKVPDPTSSDNAEFQIVLTIIKDGLTANPKKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCA+ALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCASALKQAGARVIVTEIDPI  296



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   379 bits (972),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTT VKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTVVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLF AINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFLAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWW TERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWSTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQ HAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQGHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+ P KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSGPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGAGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRDGLK D +KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRDGLKTDARKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD GGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDGGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTL FPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLPFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   379 bits (972),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            T LIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TPLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   378 bits (971),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AKNGTVPDPSSTDN EFQ+VL II++ LK DP +YT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKNGTVPDPSSTDNVEFQLVLGIIKESLKVDPLRYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA + GYGDVGKGCAAA+KQAGARVIV+EIDPI
Sbjct  264  VAFIAGYGDVGKGCAAAMKQAGARVIVSEIDPI  296



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score =   378 bits (970),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   378 bits (971),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERALDWGP GGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERALDWGPTGGPDLIVDDGGDV  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y KNG +PDPSSTDNAEFQI+LTIIRDGLK DPK+Y +MK+R+VGVS
Sbjct  144  TLLIHEGVKAEELYEKNGQLPDPSSTDNAEFQIILTIIRDGLKTDPKRYHKMKDRIVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            +AVVCGYGDVGKGCAAALKQ GARVIVTEIDPI
Sbjct  264  IAVVCGYGDVGKGCAAALKQGGARVIVTEIDPI  296



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVLTIIRDGLKTDPKRYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPI
Sbjct  264  VSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPI  296



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   379 bits (974),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  114  CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDA  173

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  174  TLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVLTIIRDGLKSDPSKYRKMKERLVGVS  233

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  234  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  293

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  294  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  326



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C  NIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSRNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>emb|CAB09795.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
Length=467

 Score =   377 bits (969),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHA AA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  66   CSCNIFSTQDHARAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  125

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  126  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  185

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  186  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  245

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  246  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  278



>emb|CAJ01706.1| S-adenosyl-L-homocysteine hydrolase [Hordeum vulgare subsp. vulgare]
Length=450

 Score =   377 bits (967),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  49   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGAGGGPDLIVDDGGDA  108

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRDGLK D  KY +MKERLVGVS
Sbjct  109  TLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRDGLKTDASKYRKMKERLVGVS  168

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  169  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  228

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  229  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  261



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDS TKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSATKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCG+GDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGHGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYG RHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGRRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER LDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERCLDWGPTGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K G +PDP+STDNAEFQIVL IIRDGLK DPKKY RMK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKTGKLPDPASTDNAEFQIVLGIIRDGLKVDPKKYRRMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G +PDP+STDNAEFQIVLTII+DGLK+DP +Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEELFEKTGELPDPTSTDNAEFQIVLTIIKDGLKSDPTRYRKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVAGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGAGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRDGLK D  KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRDGLKTDAHKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIR GLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRGGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGAR+IVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARMIVTEIDPI  296



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALD GPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDRGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G +PDP+STDN EFQ+VLTIIRDGLK+DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVLTIIRDGLKSDPMKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLL PAINVNDSVTKSKFDNLYGCRHSLPDGL RATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLLPAINVNDSVTKSKFDNLYGCRHSLPDGLTRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERALDWGPGGGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERALDWGPGGGPDLIVDDGGDV  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G +PDPSSTDNAE QIVLTIIRDGLK DPK+Y +MK R+VGVS
Sbjct  144  TLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDGLKTDPKRYQKMKTRIVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQ GARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQGGARVIVTEIDPI  296



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   377 bits (968),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   377 bits (967),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQENGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   377 bits (967),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDV  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDPSSTDNAEFQIVL+IIR+GLK DP++Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEELFEKTGEVPDPSSTDNAEFQIVLSIIREGLKTDPQRYRKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCA ALKQAGARVIVTEIDPI
Sbjct  264  VGVVCGYGDVGKGCAVALKQAGARVIVTEIDPI  296



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   377 bits (967),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   376 bits (966),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   376 bits (966),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFS+QDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G VPDP STDN EF+IVLTIIRDGLK D  KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVLTIIRDGLKTDASKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>emb|CDY58805.1| BnaC08g46780D [Brassica napus]
Length=475

 Score =   376 bits (965),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_009107496.1| PREDICTED: adenosylhomocysteinase 1-like [Brassica rapa]
Length=478

 Score =   376 bits (965),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   376 bits (966),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   376 bits (966),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   376 bits (966),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   376 bits (966),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K GT+PDP+STDN EFQIVL II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGTLPDPTSTDNPEFQIVLAIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER L+WGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERCLEWGPAGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRD LK +PKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLIRDSLKVNPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER L+WG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERCLEWGAGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY KNG +PDP+STDNAEFQIVL +IRD L  DPKKY RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVLGLIRDSLSVDPKKYRRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQYSGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVG GCAAALK AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGLGCAAALKTAGARVIVTEIDPI  296



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G  PDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGVFPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   379 bits (974),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  187  CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  246

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  247  TLLIHEGVKAEEIFEKTGQVPDPNSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  306

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  307  EETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  366

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  367  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  399



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 204/213 (96%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVF  +GETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFRVEGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLI+EGVKAEEE+AKNGT+PDP+STDNAEFQ+VLTII++ LK DP KYT+MKERLVGVS
Sbjct  144  TLLIYEGVKAEEEFAKNGTIPDPNSTDNAEFQLVLTIIKESLKTDPLKYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VALVAGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>emb|CDY50106.1| BnaC01g43540D [Brassica napus]
 emb|CDY18090.1| BnaA01g23510D [Brassica napus]
Length=508

 Score =   377 bits (967),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AK G +PDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKTGQLPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K GT PDP+STDN EFQIVL II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGTFPDPTSTDNPEFQIVLAIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPNSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 196/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQD AAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   375 bits (963),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K GT+PDP+STDN EFQIVL II++GL  DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGTLPDPTSTDNPEFQIVLAIIKEGLPVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   375 bits (963),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VVVVCGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   375 bits (962),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VVVVCGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   375 bits (962),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDT  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G +PDP+STDNAEFQIVL+II++GLK DPK+Y +MK+R+VGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQLPDPTSTDNAEFQIVLSIIKEGLKTDPKRYRKMKDRIVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQNSGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V+VVCGYGDVGKGCAAALKQAG+RVIVTEIDPI
Sbjct  264  VSVVCGYGDVGKGCAAALKQAGSRVIVTEIDPI  296



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   375 bits (962),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLI DDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIGDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AK G +PDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKTGQLPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   375 bits (962),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 195/213 (92%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQD AAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTIIRDGLK DPK+Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVLTIIRDGLKTDPKRYHKMKQRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   374 bits (961),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDT  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G  PDP+S+DNAEFQIVL+IIRDGLK DPK+Y +MK+R+VGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQFPDPASSDNAEFQIVLSIIRDGLKTDPKRYHKMKDRIVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCA+A+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCASAMKQAGARVIVTEIDPI  296



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   374 bits (960),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGAGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY KNGT+PDP+STDN EFQ+VL +IRD LK DPK+Y +MK RLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVLGLIRDSLKVDPKRYHKMKTRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQATGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCA ALK AGARVIVTEIDPI
Sbjct  264  VGVVCGYGDVGKGCALALKAAGARVIVTEIDPI  296



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   374 bits (959),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C C IFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG GGGPDLIVDDGGDA
Sbjct  84   CSCXIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G +PDP STDN EF+IVLTIIRDGLK D +KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGKIPDPESTDNPEFKIVLTIIRDGLKTDARKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCA+ALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCASALKQAGARVIVTEIDPI  296



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   374 bits (959),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDP+STDNAEFQIVLTII  GLK DPK+Y +M ERLVGVS
Sbjct  144  TLLIHEGVKAEEIYDKTGAVPDPASTDNAEFQIVLTIITHGLKTDPKRYHKMVERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQINGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   373 bits (958),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G +PDP+ST N EFQIVL II+DGLKADPKKY +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEFEKSGKLPDPASTTNPEFQIVLGIIKDGLKADPKKYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQM  +GTLLF AINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMHANGTLLFSAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCA+ALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCASALKQAGARVIVTEIDPI  296



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   373 bits (958),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY ++G +PDP+STDNAEFQIVL II++GL  DP KY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYERSGKLPDPASTDNAEFQIVLGIIKEGLSVDPCKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLF AINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFAAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGA+VIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGAQVIVTEIDPI  296



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   373 bits (958),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MK RLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKGRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQESG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQESGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   373 bits (958),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 193/213 (91%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDPSSTDN EFQIVL II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGQVPDPSSTDNPEFQIVLQIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCA ALK AGARVIVTEIDPI
Sbjct  264  VGVVCGYGDVGKGCALALKAAGARVIVTEIDPI  296



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   373 bits (958),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+LDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERSLDWGPEGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K GT+PDPSST N+E QIV TIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGTLPDPSSTTNSELQIVFTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCA ALKQ GARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAFALKQGGARVIVTEIDPI  296



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   373 bits (958),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDPSSTDN EFQIVL II+DGL  DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGQVPDPSSTDNPEFQIVLQIIKDGLPVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQVNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCA ALK AGARVIVTEIDPI
Sbjct  264  VGVVCGYGDVGKGCALALKAAGARVIVTEIDPI  296



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   373 bits (957),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGTGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEVFEKTGQVPDPNSTDNPEFQIVLSIIKEGLQVDPKKYRKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ++GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQQNGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+CGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVICGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   373 bits (957),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPG GPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGAGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G VPDP+STDN EFQIVL+II++GL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVLSIIKEGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQEAGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VVVVCGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   373 bits (957),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERALDWG GGGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERALDWGTGGGPDLIVDDGGDV  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G +PDPSSTDNAE QIVLTIIRDGLK DPK+Y +MK R+VGVS
Sbjct  144  TLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVLTIIRDGLKTDPKRYQKMKTRIVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQATGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQ GARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQGGARVIVTEIDPI  296



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   372 bits (956),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER LDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERCLDWGPAGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G +PDP+STDN EFQIVL +IRD +K +P KY RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKMPDPTSTDNVEFQIVLGLIRDSIKVNPSKYRRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCA+A+KQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCASAMKQAGARVIVTEIDPI  296



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   372 bits (955),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 194/213 (91%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWG  GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGSEGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G +PDPSST+NAEFQIVL IIRDGLK DPKKY +MK RLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKLPDPSSTENAEFQIVLGIIRDGLKVDPKKYHKMKGRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLF AINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFSAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALK AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKSAGARVIVTEIDPI  296



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   372 bits (954),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+LDWGP GGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERSLDWGPEGGPDLIVDDGGDV  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K GT+PDPSST N+E QIV TIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKTGTLPDPSSTTNSELQIVFTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCA ALKQ GARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAFALKQGGARVIVTEIDPI  296



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   372 bits (955),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  86   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  145

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VL +I++ LK DPK+Y +MKERLVGVS
Sbjct  146  TLLIHEGVKAEEEFEKSGKIPDPTSTDNVEFQLVLGLIKESLKVDPKRYHKMKERLVGVS  205

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  206  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  265

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCA ALK AGARVIVTEIDPI
Sbjct  266  VGVVCGYGDVGKGCALALKAAGARVIVTEIDPI  298



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   372 bits (954),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +K DP +Y RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESMKVDPLRYHRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALK AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKVAGARVIVTEIDPI  296



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   372 bits (954),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 192/213 (90%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K G VPDPS TDN EFQIVL II+DGL+ DPKKY +M+ERLVGVS
Sbjct  144  TLLIHEGVKAEELYEKTGQVPDPSCTDNPEFQIVLQIIKDGLQVDPKKYRKMRERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            V VVCGYGDVGKGCA ALK AGARVIVTEIDPI
Sbjct  264  VGVVCGYGDVGKGCALALKAAGARVIVTEIDPI  296



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   372 bits (954),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDT  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL +I++ LK DP +Y RMK+R+VGVS
Sbjct  144  TLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVLALIKESLKVDPLRYHRMKDRIVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQNSGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKVAGARVIVTEIDPI  296



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   372 bits (954),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDT  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL +I++ LK DP +Y RMK+R+VGVS
Sbjct  144  TLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVLALIKESLKVDPLRYHRMKDRIVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQNSGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAAMKVAGARVIVTEIDPI  296



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   372 bits (954),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDT  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL+II++GLK DPK+Y +MK+R+VGVS
Sbjct  144  TLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEGLKTDPKRYHKMKDRVVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVAGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   372 bits (954),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGD 
Sbjct  87   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDT  146

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL+II++GLK DPK+Y +MK+R+VGVS
Sbjct  147  TLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVLSIIKEGLKTDPKRYHKMKDRVVGVS  206

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  207  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  266

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  267  VAVVAGYGDVGKGCAAALKQAGARVIVTEIDPI  299



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   371 bits (953),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+LDWGP GGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERSLDWGPEGGPDLIVDDGGDV  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE Y K GT+PDPSST N+E QIV TIIRDGLK DPK+Y +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIYEKXGTLPDPSSTTNSELQIVFTIIRDGLKTDPKRYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCA ALKQ GARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAFALKQGGARVIVTEIDPI  296



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   371 bits (952),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK G VPDP+ST N EFQ+VL +I+D +K DP +Y +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKTGKVPDPASTTNLEFQMVLGLIKDSIKVDPLRYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALK AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKVAGARVIVTEIDPI  296



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +K DP +Y RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESMKVDPLRYHRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGC+AALK AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCSAALKVAGARVIVTEIDPI  296



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +K DP +Y RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESMKVDPLRYHRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGC+AALK AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCSAALKVAGARVIVTEIDPI  296



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   370 bits (951),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/213 (89%), Positives = 202/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AKNGTVPDP+STDN EFQ+VLTII++ LK DP +YT+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKNGTVPDPTSTDNVEFQLVLTIIKESLKTDPLRYTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVK+LYQM  +G+LLF  INVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKKLYQMPANGSLLFLPINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VA+V GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VALVAGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>gb|ABR16616.1| unknown [Picea sitchensis]
Length=450

 Score =   369 bits (948),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  49   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  108

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +K DP +Y RMKERLVGVS
Sbjct  109  TLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESMKVDPLRYHRMKERLVGVS  168

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  169  EETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  228

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGC+AALK AGARVIVTEIDPI
Sbjct  229  VAVVCGYGDVGKGCSAALKVAGARVIVTEIDPI  261



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   370 bits (950),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIV+DGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVNDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +K DP +Y RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESMKVDPLRYHRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALK AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKVAGARVIVTEIDPI  296



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   370 bits (950),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTE+ LDWG  GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTEQCLDWGAAGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL +IRD LK DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVLGLIRDSLKVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG LL PAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGALLIPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCA+ALKQAGARVI+TEIDPI
Sbjct  264  VAVVCGYGDVGKGCASALKQAGARVIITEIDPI  296



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   370 bits (950),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE +AK G VPDP+STDN EFQIVL+II+DGL+ DPKKY +MKERLVGVS
Sbjct  144  TLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCR SLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRPSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+ GYGDVGKGCAAA+K AGARVIVTEIDPI
Sbjct  264  VAVIWGYGDVGKGCAAAMKTAGARVIVTEIDPI  296



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   370 bits (949),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL +I++ +K DP +Y RMKERLVGVS
Sbjct  144  TLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVLGLIKESMKVDPLRYHRMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SGTLLFPA NVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQASGTLLFPATNVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALK AGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKVAGARVIVTEIDPI  296



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   369 bits (948),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 188/213 (88%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGD 
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDT  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAE+ + K G  PDPSS+DNAEFQIVL+II++GLK+DPKKY +MK+RLVGVS
Sbjct  144  TLLIHEGVKAEQVFEKTGQSPDPSSSDNAEFQIVLSIIKEGLKSDPKKYHKMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+ GYGDVGKGCAAA+KQAGARVIVTEIDPI
Sbjct  264  VAVIFGYGDVGKGCAAAMKQAGARVIVTEIDPI  296



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   365 bits (937),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/213 (89%), Positives = 198/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWW TER LDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWGTERCLDWGVGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+ K G VP+P STDNAEF+IVLTIIRDGLK+DP KY +MKERLVG S
Sbjct  144  TLLIHEGVKAEEEFEKTGKVPNPDSTDNAEFKIVLTIIRDGLKSDPSKYRKMKERLVGGS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
              TTTGVKRLYQMQE+G LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  AGTTTGVKRLYQMQETGALLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI
Sbjct  264  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  296



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   363 bits (933),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 201/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+RDG+K +P+KY +M ERLVGVS
Sbjct  144  TLLIHEGVKAEDAYAKDGTLPDPESTTNAEFKIVLTILRDGMKENPQKYHKMAERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQM ++G+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMMDNGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+ GYGDVGKGCA+A+K AGARVIVTEIDPI
Sbjct  264  VAVIFGYGDVGKGCASAMKAAGARVIVTEIDPI  296



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   363 bits (932),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 199/213 (93%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGE LQEYWWCTERALDWG GGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGENLQEYWWCTERALDWGVGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAE+E+ KNGT+PDPSST N EFQIVL I+++GL+ DPK+Y +M ERLVGVS
Sbjct  144  TLLIHEGVKAEKEFEKNGTLPDPSSTTNQEFQIVLGILKEGLQVDPKRYHKMMERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +G+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQSNGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCA+A+K AGARVIVTEIDPI
Sbjct  264  VAVVAGYGDVGKGCASAMKAAGARVIVTEIDPI  296



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   362 bits (930),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+RDG+K +P KY +M ERLVGVS
Sbjct  144  TLLIHEGVKAEDVYAKDGTLPDPESTTNAEFKIVLTILRDGMKENPNKYHKMAERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQM ++G+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMMDNGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+ GYGDVGKGCA+A+K AGARVIVTEIDPI
Sbjct  264  VAVIFGYGDVGKGCASAMKAAGARVIVTEIDPI  296



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   362 bits (929),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 200/213 (94%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGP GGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPDGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVLTI+RDG+K +P KY +M ERLVGVS
Sbjct  144  TLLIHEGVKAEDVYAKDGTLPDPESTTNAEFKIVLTILRDGMKENPNKYHKMAERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQM ++G+LLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMMDNGSLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAV+ GYGDVGKGCA+A+K AGARVIVTEIDPI
Sbjct  264  VAVIFGYGDVGKGCASAMKAAGARVIVTEIDPI  296



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 195/213 (92%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEE + K G +PDP+STDNAEFQIVLTII+DGLK+DP KY +M ERLVGV 
Sbjct  144  TLLIHEGVKAEELFEKTGELPDPASTDNAEFQIVLTIIKDGLKSDPTKYRKMNERLVGVL  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGV++L+QMQ +GTL  PAI VNDSVTKSKFDNLYGCRHS PDGLMRATDVMIAG 
Sbjct  204  EETTTGVEKLFQMQANGTLFVPAIKVNDSVTKSKFDNLYGCRHSSPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYGDVGKGCAAA+K  GARVIVTEIDP 
Sbjct  264  VAVVCGYGDVGKGCAAAMKPGGARVIVTEIDPF  296



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   345 bits (885),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEEYAK+GTVPDP+STDN EFQ+VL II++ LK DP K+T+MKERLVGVS
Sbjct  144  TLLIHEGVKAEEEYAKDGTVPDPTSTDNVEFQLVLGIIKESLKTDPTKHTKMKERLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRL + +          NVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLTRCKLMELCFSQLPNVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVV GYGDVGKGCA +LKQAGARVIVTEIDPI
Sbjct  264  VAVVAGYGDVGKGCAMSLKQAGARVIVTEIDPI  296



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 185/213 (87%), Positives = 203/213 (95%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C CNIFSTQDHAA+A+ARDSAAVFAWKGETL+EYWWCTE+AL+WGPGGGPDLIVDDGGDA
Sbjct  84   CSCNIFSTQDHAASAIARDSAAVFAWKGETLEEYWWCTEKALEWGPGGGPDLIVDDGGDA  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAE EY ++G +P+P+ T+NAEFQIVL+II++GL  DPK+YTRMK+RLVGVS
Sbjct  144  TLLIHEGVKAEGEYERSGKLPNPNETENAEFQIVLSIIKEGLLIDPKRYTRMKDRLVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ +GTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQANGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            +AVVCGYGDVGKGCAAALK AGARVIVTEIDPI
Sbjct  264  IAVVCGYGDVGKGCAAALKAAGARVIVTEIDPI  296



>gb|ABR16332.1| unknown [Picea sitchensis]
Length=484

 Score =   345 bits (884),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = +1

Query  1    CYCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDA  180
            C C+ FSTQD AAAA+ARDSAAVFAWKG+TLQEYWWC ERALDWG GGGPDLIVDDGG+ 
Sbjct  84   CSCSTFSTQDQAAAAIARDSAAVFAWKGQTLQEYWWCIERALDWGSGGGPDLIVDDGGNT  143

Query  181  TLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVLTIIRDGLKADPKKYTRMKERLVGVS  360
            TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL +I++  K DP +Y RMK+R+VGVS
Sbjct  144  TLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVLALIKESFKVDPLRYHRMKDRIVGVS  203

Query  361  EETTTGVKRLYQMQESGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGX  540
            EETTTGVKRLYQMQ SG+LLFPAI+VNDSVTKSKFD+LYGCRHSLPDGLMRATDVMIAG 
Sbjct  204  EETTTGVKRLYQMQNSGSLLFPAISVNDSVTKSKFDHLYGCRHSLPDGLMRATDVMIAGK  263

Query  541  VAVVCGYGDVGKGCAAALKQAGARVIVTEIDPI  639
            VAVVCGYG+VGK CAAA+K AGARV VTEIDPI
Sbjct  264  VAVVCGYGNVGKVCAAAMKVAGARVFVTEIDPI  296



Lambda      K        H        a         alpha
   0.317    0.136    0.422    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750