BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF044B14

Length=649
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011038615.1|  PREDICTED: uncharacterized protein At4g22758...    120   2e-30   Populus euphratica
ref|XP_002284639.1|  PREDICTED: uncharacterized protein At4g22758       120   2e-30   Vitis vinifera
ref|XP_007223777.1|  hypothetical protein PRUPE_ppa013143mg             120   2e-30   Prunus persica
emb|CAN65811.1|  hypothetical protein VITISV_031711                     119   3e-30   Vitis vinifera
ref|XP_008221421.1|  PREDICTED: uncharacterized protein LOC103321407    119   5e-30   Prunus mume [ume]
ref|XP_011070610.1|  PREDICTED: uncharacterized protein At4g22758...    119   6e-30   Sesamum indicum [beniseed]
ref|XP_011023710.1|  PREDICTED: uncharacterized protein At4g22758...    117   4e-29   Populus euphratica
ref|XP_002315875.1|  hypothetical protein POPTR_0010s12090g             117   4e-29   Populus trichocarpa [western balsam poplar]
emb|CDP00803.1|  unnamed protein product                                117   4e-29   Coffea canephora [robusta coffee]
gb|EPS61325.1|  hypothetical protein M569_13473                         117   4e-29   Genlisea aurea
ref|XP_007045196.1|  Uncharacterized protein isoform 2                  117   5e-29   
gb|EYU30083.1|  hypothetical protein MIMGU_mgv1a016062mg                116   6e-29   Erythranthe guttata [common monkey flower]
ref|XP_002311509.2|  hypothetical protein POPTR_0008s13080g             116   7e-29   Populus trichocarpa [western balsam poplar]
gb|ABK96329.1|  unknown                                                 115   1e-28   Populus trichocarpa x Populus deltoides
dbj|BAH56891.1|  AT1G70780                                              114   2e-28   Arabidopsis thaliana [mouse-ear cress]
gb|EYU25602.1|  hypothetical protein MIMGU_mgv1a024525mg                115   2e-28   Erythranthe guttata [common monkey flower]
ref|XP_006469193.1|  PREDICTED: uncharacterized protein LOC102613615    114   3e-28   Citrus sinensis [apfelsine]
gb|EYU33134.1|  hypothetical protein MIMGU_mgv1a016072mg                114   4e-28   Erythranthe guttata [common monkey flower]
ref|XP_004237906.1|  PREDICTED: uncharacterized protein At4g22758...    114   6e-28   Solanum lycopersicum
ref|XP_002527797.1|  conserved hypothetical protein                     114   6e-28   Ricinus communis
gb|KDP38078.1|  hypothetical protein JCGZ_04721                         113   7e-28   Jatropha curcas
ref|XP_010044204.1|  PREDICTED: uncharacterized protein At4g22758       113   8e-28   Eucalyptus grandis [rose gum]
ref|XP_009351504.1|  PREDICTED: uncharacterized protein At4g22758...    113   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_009600493.1|  PREDICTED: uncharacterized protein At4g22758...    113   1e-27   Nicotiana tomentosiformis
ref|XP_006448227.1|  hypothetical protein CICLE_v10017117mg             113   1e-27   Citrus clementina [clementine]
ref|XP_006364850.1|  PREDICTED: uncharacterized protein LOC102578189    112   1e-27   Solanum tuberosum [potatoes]
gb|KHG14735.1|  hypothetical protein F383_02623                         112   2e-27   Gossypium arboreum [tree cotton]
ref|XP_007045195.1|  Uncharacterized protein isoform 1                  113   2e-27   
ref|XP_009349522.1|  PREDICTED: uncharacterized protein At4g22758...    112   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_010264360.1|  PREDICTED: uncharacterized protein At4g22758...    112   3e-27   Nelumbo nucifera [Indian lotus]
ref|XP_004297386.1|  PREDICTED: uncharacterized protein At4g22758       111   5e-27   Fragaria vesca subsp. vesca
gb|AAL16139.1|AF428307_1  At1g70780/F5A18_4                             111   6e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565000.1|  uncharacterized protein                               110   8e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KJB15416.1|  hypothetical protein B456_002G177100                    110   1e-26   Gossypium raimondii
ref|XP_006301002.1|  hypothetical protein CARUB_v10021392mg             110   1e-26   Capsella rubella
ref|XP_009105746.1|  PREDICTED: uncharacterized protein At4g22758...    109   2e-26   Brassica rapa
ref|XP_010095717.1|  hypothetical protein L484_002689                   109   2e-26   Morus notabilis
ref|XP_008356300.1|  PREDICTED: uncharacterized protein LOC103420001    109   3e-26   
ref|XP_006390840.1|  hypothetical protein EUTSA_v10019542mg             109   3e-26   Eutrema salsugineum [saltwater cress]
ref|XP_010471079.1|  PREDICTED: uncharacterized protein At4g22758...    109   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010415767.1|  PREDICTED: uncharacterized protein At4g22758...    109   3e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002888795.1|  hypothetical protein ARALYDRAFT_894896             109   3e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_010552701.1|  PREDICTED: uncharacterized protein At4g22758       109   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_009127827.1|  PREDICTED: uncharacterized protein At4g22758...    108   3e-26   Brassica rapa
ref|XP_010274728.1|  PREDICTED: uncharacterized protein At4g22758       109   4e-26   Nelumbo nucifera [Indian lotus]
emb|CDX68330.1|  BnaA07g23700D                                          109   4e-26   
emb|CDY09482.1|  BnaC02g20240D                                          108   5e-26   Brassica napus [oilseed rape]
gb|AAC00605.1|  Unknown protein                                         108   6e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008467130.1|  PREDICTED: uncharacterized protein LOC103504558    108   6e-26   
ref|XP_004150595.1|  PREDICTED: uncharacterized protein LOC101204652    108   7e-26   Cucumis sativus [cucumbers]
ref|XP_009104937.1|  PREDICTED: uncharacterized protein At4g22758...    108   8e-26   Brassica rapa
emb|CDY23481.1|  BnaC06g24500D                                          108   9e-26   Brassica napus [oilseed rape]
gb|KFK41506.1|  hypothetical protein AALP_AA2G138600                    107   2e-25   Arabis alpina [alpine rockcress]
ref|NP_001236932.1|  uncharacterized protein LOC100499853               107   2e-25   Glycine max [soybeans]
ref|XP_006305759.1|  hypothetical protein CARUB_v10010592mg             106   4e-25   Capsella rubella
ref|XP_010477604.1|  PREDICTED: uncharacterized protein LOC104756680    106   4e-25   Camelina sativa [gold-of-pleasure]
ref|XP_007047987.1|  Uncharacterized protein TCM_001138                 108   5e-25   
ref|XP_008229194.1|  PREDICTED: uncharacterized protein LOC103328...    105   1e-24   Prunus mume [ume]
ref|XP_004236949.1|  PREDICTED: uncharacterized protein LOC101244859    105   1e-24   Solanum lycopersicum
ref|NP_173728.1|  uncharacterized protein                               105   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002890566.1|  hypothetical protein ARALYDRAFT_889841             104   2e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_006416119.1|  hypothetical protein EUTSA_v10009597mg             104   2e-24   Eutrema salsugineum [saltwater cress]
ref|XP_004504564.1|  PREDICTED: uncharacterized protein LOC101507525    103   3e-24   
gb|AGU36359.1|  hypothetical protein                                    103   4e-24   Helianthus annuus
ref|XP_010498820.1|  PREDICTED: uncharacterized protein At4g22758...    103   4e-24   Camelina sativa [gold-of-pleasure]
ref|XP_002534031.1|  conserved hypothetical protein                     103   4e-24   Ricinus communis
dbj|BAB33412.1|  putative senescence-associated protein                 105   5e-24   Pisum sativum [garden pea]
ref|XP_006355080.1|  PREDICTED: uncharacterized protein LOC102584968    103   7e-24   Solanum tuberosum [potatoes]
gb|AFK44881.1|  unknown                                                 103   7e-24   Lotus japonicus
ref|XP_008229193.1|  PREDICTED: uncharacterized protein LOC103328...    102   2e-23   Prunus mume [ume]
emb|CDY71620.1|  BnaC05g50380D                                          102   2e-23   Brassica napus [oilseed rape]
ref|XP_009115559.1|  PREDICTED: uncharacterized protein At4g22758...    102   2e-23   Brassica rapa
gb|AFK49206.1|  unknown                                                 101   3e-23   Medicago truncatula
gb|AGU36367.1|  hypothetical protein                                    100   3e-23   Helianthus annuus
gb|EPS58723.1|  hypothetical protein M569_16091                         100   4e-23   Genlisea aurea
ref|XP_010681883.1|  PREDICTED: uncharacterized protein LOC104896789    101   4e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|AGU36354.1|  hypothetical protein                                    100   4e-23   Helianthus annuus
gb|AGU36357.1|  hypothetical protein                                    100   4e-23   Helianthus annuus
gb|AGU36353.1|  hypothetical protein                                    100   4e-23   Helianthus annuus
gb|AGU36351.1|  hypothetical protein                                    100   4e-23   Helianthus argophyllus
ref|NP_001236734.1|  uncharacterized protein LOC100305791               100   5e-23   Glycine max [soybeans]
gb|ACJ84118.1|  unknown                                                 100   6e-23   Medicago truncatula
ref|XP_010460096.1|  PREDICTED: uncharacterized protein At4g22758...    100   6e-23   Camelina sativa [gold-of-pleasure]
gb|EPS67816.1|  hypothetical protein M569_06958                         100   7e-23   Genlisea aurea
ref|XP_003589658.1|  hypothetical protein MTR_1g031680                  100   7e-23   Medicago truncatula
gb|KHG22133.1|  hypothetical protein F383_27486                         100   9e-23   Gossypium arboreum [tree cotton]
gb|ACJ83930.1|  unknown                                               99.8    2e-22   Medicago truncatula
gb|KFK22025.1|  hypothetical protein AALP_AAs45940U000100             99.8    2e-22   Arabis alpina [alpine rockcress]
gb|KJB50372.1|  hypothetical protein B456_008G167200                  99.4    2e-22   Gossypium raimondii
ref|XP_008343057.1|  PREDICTED: uncharacterized protein LOC103405829  99.8    2e-22   
ref|XP_009334449.1|  PREDICTED: uncharacterized protein At4g22758...  99.0    4e-22   Pyrus x bretschneideri [bai li]
gb|KHN46081.1|  Hypothetical protein glysoja_030082                   98.2    4e-22   Glycine soja [wild soybean]
ref|XP_010554413.1|  PREDICTED: uncharacterized protein LOC104824...  97.1    5e-22   Tarenaya hassleriana [spider flower]
ref|XP_009110117.1|  PREDICTED: uncharacterized protein At4g22758...  97.8    8e-22   Brassica rapa
gb|AGV54243.1|  senescence-associated protein                         97.8    8e-22   Phaseolus vulgaris [French bean]
ref|XP_010554411.1|  PREDICTED: uncharacterized protein At4g22758...  97.4    9e-22   Tarenaya hassleriana [spider flower]
gb|KDP33166.1|  hypothetical protein JCGZ_13431                       96.7    1e-21   Jatropha curcas
ref|XP_002270144.3|  PREDICTED: uncharacterized protein At4g22758     97.8    1e-21   Vitis vinifera
ref|XP_002875078.1|  hypothetical protein ARALYDRAFT_322499           97.4    1e-21   Arabidopsis lyrata subsp. lyrata
emb|CBI33520.3|  unnamed protein product                              97.4    1e-21   Vitis vinifera
ref|XP_007033029.1|  Uncharacterized protein TCM_019175               97.4    1e-21   
ref|XP_004498287.1|  PREDICTED: uncharacterized protein LOC101497295  96.7    2e-21   Cicer arietinum [garbanzo]
gb|KHN17944.1|  hypothetical protein glysoja_017995                   95.9    6e-21   Glycine soja [wild soybean]
ref|XP_007216024.1|  hypothetical protein PRUPE_ppa014882mg           94.7    7e-21   
ref|XP_003537448.2|  PREDICTED: uncharacterized protein LOC100775979  95.5    7e-21   Glycine max [soybeans]
emb|CDX91699.1|  BnaC08g06180D                                        94.7    1e-20   
ref|XP_007153400.1|  hypothetical protein PHAVU_003G031800g           94.4    1e-20   Phaseolus vulgaris [French bean]
ref|XP_010109006.1|  hypothetical protein L484_027203                 94.7    1e-20   Morus notabilis
ref|XP_007153591.1|  hypothetical protein PHAVU_003G048500g           94.4    2e-20   Phaseolus vulgaris [French bean]
ref|XP_010032694.1|  PREDICTED: uncharacterized protein At4g22758...  94.7    2e-20   Eucalyptus grandis [rose gum]
ref|XP_010066603.1|  PREDICTED: uncharacterized protein LOC104453692  94.0    2e-20   Eucalyptus grandis [rose gum]
ref|XP_002875080.1|  hypothetical protein ARALYDRAFT_904355           92.8    4e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_010916501.1|  PREDICTED: uncharacterized protein LOC105041292  93.2    5e-20   Elaeis guineensis
gb|KDP33165.1|  hypothetical protein JCGZ_13430                       92.4    1e-19   Jatropha curcas
ref|XP_008809820.1|  PREDICTED: uncharacterized protein LOC103721401  92.0    1e-19   
gb|KFK33374.1|  hypothetical protein AALP_AA5G005100                  92.4    1e-19   Arabis alpina [alpine rockcress]
ref|XP_009586822.1|  PREDICTED: uncharacterized protein LOC104084618  90.9    2e-19   Nicotiana tomentosiformis
ref|XP_004503136.1|  PREDICTED: uncharacterized protein LOC101504281  90.9    3e-19   Cicer arietinum [garbanzo]
ref|XP_006357767.1|  PREDICTED: uncharacterized protein LOC102592157  90.5    3e-19   Solanum tuberosum [potatoes]
ref|XP_010667680.1|  PREDICTED: uncharacterized protein LOC104884693  91.7    3e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010553810.1|  PREDICTED: uncharacterized protein LOC104823786  90.5    4e-19   Tarenaya hassleriana [spider flower]
ref|XP_009586821.1|  PREDICTED: uncharacterized protein At4g22758...  90.9    4e-19   Nicotiana tomentosiformis
ref|XP_006430618.1|  hypothetical protein CICLE_v10012986mg           90.9    5e-19   Citrus clementina [clementine]
ref|XP_003552877.1|  PREDICTED: uncharacterized protein LOC100810542  89.7    8e-19   Glycine max [soybeans]
ref|XP_009586817.1|  PREDICTED: uncharacterized protein LOC104084614  89.4    1e-18   Nicotiana tomentosiformis
ref|XP_006482133.1|  PREDICTED: uncharacterized protein LOC102630256  89.7    1e-18   Citrus sinensis [apfelsine]
ref|XP_011002783.1|  PREDICTED: uncharacterized protein LOC105109699  89.4    1e-18   Populus euphratica
ref|XP_010032695.1|  PREDICTED: uncharacterized protein At4g22758     89.0    2e-18   Eucalyptus grandis [rose gum]
ref|XP_010926482.1|  PREDICTED: uncharacterized protein LOC105048744  88.6    2e-18   Elaeis guineensis
gb|KCW52148.1|  hypothetical protein EUGRSUZ_J01593                   88.6    2e-18   Eucalyptus grandis [rose gum]
ref|XP_011021386.1|  PREDICTED: uncharacterized protein At4g22758...  87.8    5e-18   Populus euphratica
gb|EYU44564.1|  hypothetical protein MIMGU_mgv1a024095mg              87.4    6e-18   Erythranthe guttata [common monkey flower]
ref|XP_006395882.1|  hypothetical protein EUTSA_v10005108mg           87.0    6e-18   Eutrema salsugineum [saltwater cress]
ref|XP_002305866.2|  hypothetical protein POPTR_0004s08870g           87.4    7e-18   Populus trichocarpa [western balsam poplar]
ref|XP_009774976.1|  PREDICTED: uncharacterized protein At4g22758...  87.0    9e-18   Nicotiana sylvestris
ref|XP_006383328.1|  hypothetical protein POPTR_0005s14530g           86.7    1e-17   
ref|XP_009114230.1|  PREDICTED: uncharacterized protein At4g22758...  85.9    2e-17   
ref|XP_008782287.1|  PREDICTED: uncharacterized protein LOC103701859  85.9    2e-17   Phoenix dactylifera
gb|AFK34092.1|  unknown                                               85.5    2e-17   Medicago truncatula
ref|XP_007163388.1|  hypothetical protein PHAVU_001G230600g           85.9    3e-17   Phaseolus vulgaris [French bean]
ref|XP_011466921.1|  PREDICTED: uncharacterized protein LOC101292530  85.1    4e-17   Fragaria vesca subsp. vesca
gb|EYU44567.1|  hypothetical protein MIMGU_mgv1a024765mg              84.7    5e-17   Erythranthe guttata [common monkey flower]
ref|XP_006405838.1|  hypothetical protein EUTSA_v10027994mg           84.0    6e-17   
ref|XP_002870559.1|  predicted protein                                84.0    7e-17   
ref|XP_009139746.1|  PREDICTED: uncharacterized protein At4g22758     84.3    7e-17   Brassica rapa
ref|XP_004231982.2|  PREDICTED: uncharacterized protein At4g22758...  82.8    1e-16   
ref|XP_010096674.1|  hypothetical protein L484_025423                 84.0    2e-16   Morus notabilis
ref|XP_010435612.1|  PREDICTED: uncharacterized protein LOC104719388  83.6    2e-16   Camelina sativa [gold-of-pleasure]
emb|CDY01710.1|  BnaC04g30420D                                        83.2    2e-16   
ref|XP_010440883.1|  PREDICTED: uncharacterized protein At4g22758...  83.2    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009101334.1|  PREDICTED: uncharacterized protein At4g22758     83.2    2e-16   Brassica rapa
ref|XP_010670141.1|  PREDICTED: uncharacterized protein At4g22758...  83.6    2e-16   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY36234.1|  BnaC07g20880D                                        82.8    2e-16   Brassica napus [oilseed rape]
gb|ABK28724.1|  unknown                                               84.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198589.1|  uncharacterized protein                             84.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62631.1|  unknown                                               84.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY17461.1|  BnaC09g20760D                                        82.8    2e-16   Brassica napus [oilseed rape]
emb|CDP02694.1|  unnamed protein product                              82.8    3e-16   Coffea canephora [robusta coffee]
gb|KGN57775.1|  hypothetical protein Csa_3G292550                     82.8    3e-16   Cucumis sativus [cucumbers]
gb|KCW64559.1|  hypothetical protein EUGRSUZ_G02164                   82.0    3e-16   Eucalyptus grandis [rose gum]
ref|XP_011099466.1|  PREDICTED: uncharacterized protein At4g22758...  82.8    3e-16   Sesamum indicum [beniseed]
gb|KGN57466.1|  hypothetical protein Csa_3G190360                     81.6    5e-16   Cucumis sativus [cucumbers]
ref|XP_003616328.1|  hypothetical protein MTR_5g078750                82.0    1e-15   
gb|AES99286.2|  senescence-associated protein, putative               81.6    1e-15   Medicago truncatula
ref|XP_006285693.1|  hypothetical protein CARUB_v10007163mg           80.5    1e-15   Capsella rubella
gb|KEH34623.1|  senescence-associated protein, putative               80.9    1e-15   Medicago truncatula
ref|XP_008457016.1|  PREDICTED: uncharacterized protein LOC103496795  81.3    1e-15   Cucumis melo [Oriental melon]
ref|XP_009774977.1|  PREDICTED: uncharacterized protein At4g22758...  80.1    2e-15   Nicotiana sylvestris
ref|XP_006830209.1|  hypothetical protein AMTR_s00130p00016510        80.9    2e-15   
ref|NP_001046699.1|  Os02g0324700                                     80.1    3e-15   
ref|XP_006647212.1|  PREDICTED: uncharacterized protein LOC102716287  79.7    4e-15   Oryza brachyantha
ref|XP_011073847.1|  PREDICTED: uncharacterized protein LOC105158703  78.6    2e-14   Sesamum indicum [beniseed]
ref|XP_009365234.1|  PREDICTED: uncharacterized protein LOC103955087  75.1    4e-14   
dbj|BAK06204.1|  predicted protein                                    76.6    5e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFW89732.1|  senescence-associated protein                         75.5    2e-13   
ref|NP_001150485.1|  senescence-associated protein                    75.5    2e-13   
ref|XP_010528538.1|  PREDICTED: uncharacterized protein LOC104805613  75.1    2e-13   Tarenaya hassleriana [spider flower]
ref|NP_001152495.1|  senescence-associated protein                    75.1    2e-13   
ref|XP_003572714.1|  PREDICTED: uncharacterized protein At4g22758...  73.6    6e-13   Brachypodium distachyon [annual false brome]
ref|XP_004952377.1|  PREDICTED: uncharacterized protein LOC101766815  73.2    9e-13   Setaria italica
gb|EMS64867.1|  hypothetical protein TRIUR3_17055                     73.6    1e-12   Triticum urartu
dbj|BAB08319.1|  unnamed protein product                              72.0    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|KJB78164.1|  hypothetical protein B456_012G181400                  69.7    3e-12   Gossypium raimondii
gb|EPS64875.1|  hypothetical protein M569_09904                       68.9    1e-11   Genlisea aurea
ref|XP_002963924.1|  hypothetical protein SELMODRAFT_28561            67.4    2e-11   
ref|XP_010445453.1|  PREDICTED: uncharacterized protein LOC104728122  67.0    8e-11   
ref|XP_002868302.1|  predicted protein                                67.8    8e-11   
ref|XP_002992399.1|  hypothetical protein SELMODRAFT_448736           67.4    1e-10   Selaginella moellendorffii
ref|XP_006830230.1|  hypothetical protein AMTR_s00130p00053590        65.9    2e-10   Amborella trichopoda
ref|XP_002967997.1|  hypothetical protein SELMODRAFT_440177           66.2    2e-10   Selaginella moellendorffii
gb|EPS58431.1|  hypothetical protein M569_16381                       65.5    2e-10   Genlisea aurea
emb|CDP17872.1|  unnamed protein product                              68.9    2e-10   Coffea canephora [robusta coffee]
ref|XP_006830208.1|  hypothetical protein AMTR_s00130p00015630        65.1    3e-10   
gb|EPS60022.1|  hypothetical protein M569_14782                       64.7    5e-10   Genlisea aurea
gb|EPS70443.1|  hypothetical protein M569_04324                       65.1    6e-10   Genlisea aurea
gb|EPS58433.1|  hypothetical protein M569_16383                       63.9    9e-10   Genlisea aurea
ref|XP_002468583.1|  hypothetical protein SORBIDRAFT_01g048430        63.5    2e-09   Sorghum bicolor [broomcorn]
ref|XP_006849084.1|  hypothetical protein AMTR_s00028p00233650        61.6    3e-09   
gb|EPS58560.1|  hypothetical protein M569_16253                       57.4    7e-08   Genlisea aurea
ref|XP_002967649.1|  hypothetical protein SELMODRAFT_18527            57.4    1e-07   
gb|KHN12462.1|  hypothetical protein glysoja_018592                   58.2    1e-07   Glycine soja [wild soybean]
gb|AFG57723.1|  hypothetical protein CL2034Contig1_03                 57.0    1e-07   Pinus taeda
ref|XP_008381505.1|  PREDICTED: 52 kDa repressor of the inhibitor...  60.5    2e-07   
gb|EPS58432.1|  hypothetical protein M569_16382                       53.5    7e-06   Genlisea aurea
ref|XP_009605387.1|  PREDICTED: uncharacterized protein LOC104099956  49.7    1e-04   Nicotiana tomentosiformis
emb|CAC09928.1|  hypothetical protein                                 50.1    2e-04   Catharanthus roseus [chatas]



>ref|XP_011038615.1| PREDICTED: uncharacterized protein At4g22758-like [Populus euphratica]
Length=133

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN AA G R L+S+TVLGSAGPIRFV +E DLV AVIDTALKSYAREGRLPIL
Sbjct  1    MVLYKQKKNQAAKGNRFLISVTVLGSAGPIRFVVNEEDLVVAVIDTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLN+F+LYCPNAA++
Sbjct  61   GSDLNDFLLYCPNAASD  77



>ref|XP_002284639.1| PREDICTED: uncharacterized protein At4g22758 [Vitis vinifera]
 emb|CBI26875.3| unnamed protein product [Vitis vinifera]
Length=139

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 2/78 (3%)
 Frame = +2

Query  359  MFVCKAKKNPAAGK--RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M + K KKN +AGK  RLL+SI VLGSAGPIRFV SE++LVAAVIDTALKSYAREGRLPI
Sbjct  1    MLLYKQKKNQSAGKANRLLISINVLGSAGPIRFVVSEDELVAAVIDTALKSYAREGRLPI  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSDLNNF+LYC NA ++
Sbjct  61   LGSDLNNFLLYCSNAGSD  78



>ref|XP_007223777.1| hypothetical protein PRUPE_ppa013143mg [Prunus persica]
 gb|EMJ24976.1| hypothetical protein PRUPE_ppa013143mg [Prunus persica]
Length=138

 Score =   120 bits (301),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +2

Query  359  MFVCKAKKNP--AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M + K KKNP  A G RLL+SITVLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+
Sbjct  1    MLLYKQKKNPNSAKGNRLLISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPV  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSDLN+F+LYCPNA  +
Sbjct  61   LGSDLNDFLLYCPNAGPD  78



>emb|CAN65811.1| hypothetical protein VITISV_031711 [Vitis vinifera]
Length=137

 Score =   119 bits (299),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/78 (77%), Positives = 68/78 (87%), Gaps = 2/78 (3%)
 Frame = +2

Query  359  MFVCKAKKNPAAGK--RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M + K KKN +AGK  RLL+SI VLGSAGPIRFV SE++LVAAVIDTALKSYAREGRLPI
Sbjct  1    MLLYKQKKNQSAGKANRLLISINVLGSAGPIRFVVSEDELVAAVIDTALKSYAREGRLPI  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSDLNNF+LYC NA ++
Sbjct  61   LGSDLNNFLLYCSNAGSD  78



>ref|XP_008221421.1| PREDICTED: uncharacterized protein LOC103321407 [Prunus mume]
Length=138

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 67/78 (86%), Gaps = 2/78 (3%)
 Frame = +2

Query  359  MFVCKAKKNP--AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M + K KKNP  A G RLL+SITVLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+
Sbjct  1    MLLYKQKKNPNSAKGNRLLISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPV  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSDLN+F+LYCPN+  +
Sbjct  61   LGSDLNDFLLYCPNSGPD  78



>ref|XP_011070610.1| PREDICTED: uncharacterized protein At4g22758-like [Sesamum indicum]
Length=136

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKN-PAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN P  G R L+S+TVLGSAGPIRFV +E++LVAAVIDTALKSYAREGRLPIL
Sbjct  1    MLLYKQKKNQPFKGNRFLISVTVLGSAGPIRFVVNEDELVAAVIDTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLNNF+LYCP A TE
Sbjct  61   GSDLNNFMLYCPIAGTE  77



>ref|XP_011023710.1| PREDICTED: uncharacterized protein At4g22758-like [Populus euphratica]
Length=138

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN  A GKR L+S+TVLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLPIL
Sbjct  1    MLLYKQKKNQVAKGKRFLISVTVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLN+F+LYC NAA++
Sbjct  61   GSDLNDFLLYCRNAASD  77



>ref|XP_002315875.1| hypothetical protein POPTR_0010s12090g [Populus trichocarpa]
 gb|EEF02046.1| hypothetical protein POPTR_0010s12090g [Populus trichocarpa]
Length=133

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/77 (74%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN AA G R L+S+TVLGSAGPIRFV +E DLV AVI+TALKSYAREGRLPIL
Sbjct  1    MVLYKQKKNQAAKGNRFLISVTVLGSAGPIRFVVNEEDLVVAVINTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLN+F+LYCPNA ++
Sbjct  61   GSDLNDFLLYCPNAGSD  77



>emb|CDP00803.1| unnamed protein product [Coffea canephora]
Length=138

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   K  +  A G RLL+SITV+GSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+L
Sbjct  1    MLLQKKKTQGAAKGNRLLISITVMGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            G+DLNNF+LYCP A TE
Sbjct  61   GTDLNNFMLYCPCATTE  77



>gb|EPS61325.1| hypothetical protein M569_13473, partial [Genlisea aurea]
Length=167

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 12/109 (11%)
 Frame = +2

Query  266  FFSFLILPNSPVFLEKKRRFV*lllllAKKMMFVCKAKKN-PAAGKRLLVSITVLGSAGP  442
            FF FL LP +  +L+K R          KKM+   K KKN P+  +R L+S+TVLGSAGP
Sbjct  17   FFLFLSLPLN--YLKKTR---------TKKMLLYNKQKKNVPSNARRFLISVTVLGSAGP  65

Query  443  IRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATEG  589
            IRF+ +E++LVA+VI TALKSYAREGRLP+LGSD+NNF+LYCP + +E 
Sbjct  66   IRFIVNEDELVASVITTALKSYAREGRLPVLGSDMNNFMLYCPVSGSEA  114



>ref|XP_007045196.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY01028.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=145

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 66/78 (85%), Gaps = 1/78 (1%)
 Frame = +2

Query  377  KKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNN  553
            KKN  A G RLL+SITVLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+LGSDLN+
Sbjct  2    KKNQGAKGNRLLISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVLGSDLND  61

Query  554  FVLYCPNAATEGTFTKLF  607
            F LYCP A ++G F ++ 
Sbjct  62   FHLYCPCAGSDGRFIQIH  79



>gb|EYU30083.1| hypothetical protein MIMGU_mgv1a016062mg [Erythranthe guttata]
Length=136

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 62/77 (81%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   + K  P+ G R LV +TVLGSAGPIRFV +EN+LVA VIDTALKSYAREGRLPIL
Sbjct  1    MLLYKQKKSQPSKGNRFLVCVTVLGSAGPIRFVVNENELVATVIDTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLN F+LYCP A TE
Sbjct  61   GSDLNKFMLYCPIAGTE  77



>ref|XP_002311509.2| hypothetical protein POPTR_0008s13080g [Populus trichocarpa]
 gb|EEE88876.2| hypothetical protein POPTR_0008s13080g [Populus trichocarpa]
Length=146

 Score =   116 bits (291),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 67/77 (87%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN  A GKR L+S+TVLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLPIL
Sbjct  1    MLLYKQKKNQVAKGKRFLLSVTVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLN+F+LYC NAA++
Sbjct  61   GSDLNDFLLYCRNAASD  77



>gb|ABK96329.1| unknown [Populus trichocarpa x Populus deltoides]
Length=133

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN AA G R L+S+TVLGSAGPIRFV +E DLV AVI+TALKSYAREGRLPIL
Sbjct  1    MVLYKQKKNQAAKGNRFLISVTVLGSAGPIRFVVNEEDLVVAVINTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLN+F+LYCP+A ++
Sbjct  61   GSDLNDFLLYCPDAGSD  77



>dbj|BAH56891.1| AT1G70780 [Arabidopsis thaliana]
Length=93

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E+DLVA+VIDTALK YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKGYAREGRLPL  60

Query  533  LGSDLNNFVLYCPNAATEGTFTKLFIWF  616
            LGSD N+F+LYCP    EG    + + F
Sbjct  61   LGSDFNDFLLYCPMVGPEGKLNSIPMSF  88



>gb|EYU25602.1| hypothetical protein MIMGU_mgv1a024525mg [Erythranthe guttata]
Length=135

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKN-PAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            MF+ K KKN P+ GKR L+SITVLGSAGPIRFV +E+DLV AV+DTA+KSYAR+GRLP+L
Sbjct  1    MFIHKQKKNLPSKGKRFLISITVLGSAGPIRFVVNEDDLVGAVMDTAMKSYARQGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLN F+LY P A T+
Sbjct  61   GSDLNAFMLYSPFAGTQ  77



>ref|XP_006469193.1| PREDICTED: uncharacterized protein LOC102613615 [Citrus sinensis]
 gb|KDO64605.1| hypothetical protein CISIN_1g032525mg [Citrus sinensis]
Length=139

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KK  AA G R+L+SITVLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+L
Sbjct  1    MLLYKQKKAQAAKGNRILISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAAT  583
            GSDLN+FVLYC NA +
Sbjct  61   GSDLNDFVLYCSNAGS  76



>gb|EYU33134.1| hypothetical protein MIMGU_mgv1a016072mg [Erythranthe guttata]
Length=135

 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKN-PAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            MF+ K KKN P+ GKR L+SITVLGSAGPIRFV +E+DLV AV+DTA+KSYAR+GRLP+L
Sbjct  1    MFIRKQKKNLPSKGKRFLISITVLGSAGPIRFVVNEDDLVGAVMDTAMKSYARQGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLN F+LY P A T+
Sbjct  61   GSDLNAFMLYSPFAGTQ  77



>ref|XP_004237906.1| PREDICTED: uncharacterized protein At4g22758-like [Solanum lycopersicum]
Length=155

 Score =   114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
 Frame = +2

Query  350  KKMMFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRL  526
            K  M + K KKN    G R+L+SITVLGSAGPIRFV +E +LVA VIDTA+K+YAREGRL
Sbjct  17   KNKMLLYKPKKNQTGKGNRILISITVLGSAGPIRFVVNEEELVADVIDTAMKAYAREGRL  76

Query  527  PILGSDLNNFVLYCPNAATE  586
            P+LGSD +NFVLYCP+A TE
Sbjct  77   PVLGSDFSNFVLYCPSAGTE  96



>ref|XP_002527797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34607.1| conserved hypothetical protein [Ricinus communis]
Length=138

 Score =   114 bits (284),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 65/78 (83%), Gaps = 2/78 (3%)
 Frame = +2

Query  359  MFVCKAKKNPAA--GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M + K KKN AA  G R L+S+TVLGSAGPIRFV +E +LVA+VIDTALKSYAREGRLPI
Sbjct  1    MLLYKPKKNQAAAKGNRFLISVTVLGSAGPIRFVVNEEELVASVIDTALKSYAREGRLPI  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSDLN+F LYC NA +E
Sbjct  61   LGSDLNDFFLYCANAGSE  78



>gb|KDP38078.1| hypothetical protein JCGZ_04721 [Jatropha curcas]
Length=138

 Score =   113 bits (283),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +2

Query  359  MFVCKAKKN-PAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN PA G R L+S+TVLGSAGPIRFV +E ++VA +IDTALKSYAREGRLP+L
Sbjct  1    MLLYKPKKNQPAKGNRFLISVTVLGSAGPIRFVVNEREIVAVIIDTALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAAT  583
            GSDLN+F LYCPNA +
Sbjct  61   GSDLNDFFLYCPNAGS  76



>ref|XP_010044204.1| PREDICTED: uncharacterized protein At4g22758 [Eucalyptus grandis]
 gb|KCW86246.1| hypothetical protein EUGRSUZ_B02935 [Eucalyptus grandis]
Length=138

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 65/77 (84%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN +A G RLL+SI VLGSAGPIRFV  E +LVAAVIDTALKSYAREGRLP+L
Sbjct  1    MLLYKQKKNQSAKGNRLLISINVLGSAGPIRFVVGEEELVAAVIDTALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLN+F+LYCP + ++
Sbjct  61   GSDLNDFLLYCPTSGSD  77



>ref|XP_009351504.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=138

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/78 (72%), Positives = 64/78 (82%), Gaps = 2/78 (3%)
 Frame = +2

Query  359  MFVCKAKKNP--AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M + K KKN   A G RLL+SITVLGSAGPIRFV +E +LVAAV+DTALKSYAREGRLP+
Sbjct  1    MLLYKQKKNQSTAKGNRLLISITVLGSAGPIRFVVNEQELVAAVMDTALKSYAREGRLPV  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSDLN+F+LYCP    E
Sbjct  61   LGSDLNDFLLYCPAVGPE  78



>ref|XP_009600493.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
tomentosiformis]
 ref|XP_009757100.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
sylvestris]
Length=136

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/77 (73%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKK-NPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KK     G RLL+SITVLGSAGPIRFV  E DLVA VI+TALK+YAREGRLP+L
Sbjct  1    MLLYKTKKIQQGKGNRLLISITVLGSAGPIRFVVKEEDLVADVINTALKNYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDLNNFVLYCP   TE
Sbjct  61   GSDLNNFVLYCPAVTTE  77



>ref|XP_006448227.1| hypothetical protein CICLE_v10017117mg [Citrus clementina]
 gb|ESR61467.1| hypothetical protein CICLE_v10017117mg [Citrus clementina]
Length=139

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KK  A  G R+L+SITVLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+L
Sbjct  1    MLLYKQKKAQAVKGNRILISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAAT  583
            GSDLN+FVLYC NA +
Sbjct  61   GSDLNDFVLYCSNAGS  76



>ref|XP_006364850.1| PREDICTED: uncharacterized protein LOC102578189 [Solanum tuberosum]
Length=136

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 64/77 (83%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN    G R+L+SITVLGSAGPIRFV +E +LVA VIDTA+K+YAREGRLP+L
Sbjct  1    MLLYKPKKNQTGKGNRILISITVLGSAGPIRFVVNEEELVADVIDTAMKAYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSD +NFVLYCP+A TE
Sbjct  61   GSDFSNFVLYCPSAGTE  77



>gb|KHG14735.1| hypothetical protein F383_02623 [Gossypium arboreum]
Length=137

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 66/77 (86%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPA-AGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN    G RLL+S+TVLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+L
Sbjct  1    MLLYKQKKNQGPKGNRLLISVTVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GS+LN+F+LYCP+A ++
Sbjct  61   GSNLNDFLLYCPSAGSD  77



>ref|XP_007045195.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY01027.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=163

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +2

Query  353  KMMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            K +   K K   A G RLL+SITVLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+
Sbjct  16   KFVLFSKKKNQGAKGNRLLISITVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPV  75

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSDLN+F LYCP A ++
Sbjct  76   LGSDLNDFHLYCPCAGSD  93



>ref|XP_009349522.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=138

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 63/73 (86%), Gaps = 2/73 (3%)
 Frame = +2

Query  359  MFVCKAKKNP--AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M + K KKN   A G RLL+SITVLGSAGPIRFV +E +LVAAV+DTALKSYAREGRLP+
Sbjct  1    MLLYKQKKNQSTAKGNRLLISITVLGSAGPIRFVVNEQELVAAVMDTALKSYAREGRLPV  60

Query  533  LGSDLNNFVLYCP  571
            LGSDLN+F+LYCP
Sbjct  61   LGSDLNDFLLYCP  73



>ref|XP_010264360.1| PREDICTED: uncharacterized protein At4g22758-like [Nelumbo nucifera]
Length=137

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 2/79 (3%)
 Frame = +2

Query  356  MMFVCKAKKNPAA--GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
             M + K KKNP +  G RLL+++ VLGSAGP+RF+ +E++LVAAVIDT LKSYAREGRLP
Sbjct  2    QMLLHKQKKNPHSSKGNRLLITVNVLGSAGPLRFLVNEDELVAAVIDTTLKSYAREGRLP  61

Query  530  ILGSDLNNFVLYCPNAATE  586
            +LGSDLNNF LY  NA T+
Sbjct  62   VLGSDLNNFRLYSANAGTD  80



>ref|XP_004297386.1| PREDICTED: uncharacterized protein At4g22758 [Fragaria vesca 
subsp. vesca]
Length=138

 Score =   111 bits (278),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = +2

Query  359  MFVCKAKKNPAA--GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M + K KK+ AA  G R L+SITVLGSAGPIRFV +E  LVAAVIDTALKSYAREGRLPI
Sbjct  1    MLLYKQKKSQAAAKGNRFLISITVLGSAGPIRFVVNEEALVAAVIDTALKSYAREGRLPI  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSDLN F+LYCP A  +
Sbjct  61   LGSDLNEFMLYCPTAGPD  78



>gb|AAL16139.1|AF428307_1 At1g70780/F5A18_4 [Arabidopsis thaliana]
Length=149

 Score =   111 bits (278),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E+DLVA+VIDTALK YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKGYAREGRLPL  60

Query  533  LGSDLNNFVLYCPNAATEGTFT  598
            LGSD N+F+LYCP    E   T
Sbjct  61   LGSDFNDFLLYCPMVGPEALST  82



>ref|NP_565000.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD55493.1|AC008148_3 Unknown protein [Arabidopsis thaliana]
 gb|AAG40399.1|AF325047_1 At1g70780 [Arabidopsis thaliana]
 gb|AAG52330.1|AC011663_9 unknown protein; 8615-9128 [Arabidopsis thaliana]
 gb|AAK83590.1| At1g70780/F5A18_4 [Arabidopsis thaliana]
 gb|AAN31119.1| At1g70780/F5A18_4 [Arabidopsis thaliana]
 gb|AEE35114.1| uncharacterized protein AT1G70780 [Arabidopsis thaliana]
Length=140

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E+DLVA+VIDTALK YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKGYAREGRLPL  60

Query  533  LGSDLNNFVLYCPNAATEGTFT  598
            LGSD N+F+LYCP    E   T
Sbjct  61   LGSDFNDFLLYCPMVGPEALST  82



>gb|KJB15416.1| hypothetical protein B456_002G177100 [Gossypium raimondii]
Length=137

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 64/77 (83%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   + K     G RLL+S+TVLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+L
Sbjct  1    MLLYKQKKSQGPKGNRLLISVTVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GS+LN+F+LYCP+A ++
Sbjct  61   GSNLNDFLLYCPSAGSD  77



>ref|XP_006301002.1| hypothetical protein CARUB_v10021392mg [Capsella rubella]
 gb|EOA33900.1| hypothetical protein CARUB_v10021392mg [Capsella rubella]
Length=137

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E DLVA+VIDTALK+YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVIDTALKNYAREGRLPL  60

Query  533  LGSDLNNFVLYCPNAATEGTFT  598
            LGSD N+F+LYCP    E   T
Sbjct  61   LGSDFNDFLLYCPMVGPEALNT  82



>ref|XP_009105746.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
 emb|CDY11545.1| BnaC06g31940D [Brassica napus]
 emb|CDX96277.1| BnaA07g28880D [Brassica napus]
Length=131

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   K KKN A G R+L+S+TVLGSAGPIRFVA E+DLVA+VIDTALK YAREGRLP+L
Sbjct  1    MLLYNKQKKN-AKGNRILISVTVLGSAGPIRFVAYEDDLVASVIDTALKCYAREGRLPLL  59

Query  536  GSDLNNFVLYCPNAATE  586
            GSD N+F+LYCP    E
Sbjct  60   GSDFNDFLLYCPMVGPE  76



>ref|XP_010095717.1| hypothetical protein L484_002689 [Morus notabilis]
 gb|EXB62017.1| hypothetical protein L484_002689 [Morus notabilis]
Length=130

 Score =   109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   + K   A G R+L+S+TVLGSAGPIRFV +E +LVA VIDTALK YAREGRLP+L
Sbjct  1    MLLYKQKKSQNAKGNRILISVTVLGSAGPIRFVVNEKELVATVIDTALKCYAREGRLPLL  60

Query  536  GSDLNNFVLYCPNAATEG  589
             SDLN+F+LYCPN++ E 
Sbjct  61   SSDLNDFLLYCPNSSIEA  78



>ref|XP_008356300.1| PREDICTED: uncharacterized protein LOC103420001 [Malus domestica]
Length=138

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 63/78 (81%), Gaps = 2/78 (3%)
 Frame = +2

Query  359  MFVCKAKKNP--AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M + K KKN   A G RLL+SITVLGSAGPIRFV +E +++AAV+DTALKSYAREGR P+
Sbjct  1    MLLYKQKKNQSTAKGNRLLISITVLGSAGPIRFVVNEQEVIAAVMDTALKSYAREGRFPV  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSDLN+F+LYCP    E
Sbjct  61   LGSDLNDFLLYCPAVGPE  78



>ref|XP_006390840.1| hypothetical protein EUTSA_v10019542mg [Eutrema salsugineum]
 dbj|BAJ34604.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ28126.1| hypothetical protein EUTSA_v10019542mg [Eutrema salsugineum]
Length=141

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E DLVA+VIDTALK YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVIDTALKCYAREGRLPL  60

Query  533  LGSDLNNFVLYCPNAATEGTFT  598
            LGSD N+F+LYCP    E   T
Sbjct  61   LGSDFNDFLLYCPMVGPEALST  82



>ref|XP_010471079.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=140

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E DLVA+VIDTALK YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVIDTALKCYAREGRLPL  60

Query  533  LGSDLNNFVLYCPNAATEGTFT  598
            LGSD N+F+LYCP    E   T
Sbjct  61   LGSDFNDFLLYCPMVGPEALST  82



>ref|XP_010415767.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
 ref|XP_010427868.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=140

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E DLVA+VIDTALK YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVIDTALKCYAREGRLPL  60

Query  533  LGSDLNNFVLYCPNAATEGTFT  598
            LGSD N+F+LYCP    E   T
Sbjct  61   LGSDFNDFLLYCPMVGPEALST  82



>ref|XP_002888795.1| hypothetical protein ARALYDRAFT_894896 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65054.1| hypothetical protein ARALYDRAFT_894896 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E+DLVA+VIDTALK YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAFEDDLVASVIDTALKCYAREGRLPL  60

Query  533  LGSDLNNFVLYCPNAATEGTFT  598
            LGSD N+F+LYCP    E   T
Sbjct  61   LGSDFNDFLLYCPMVGPEALTT  82



>ref|XP_010552701.1| PREDICTED: uncharacterized protein At4g22758 [Tarenaya hassleriana]
Length=142

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 63/78 (81%), Gaps = 1/78 (1%)
 Frame = +2

Query  356  MMFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  + G R+L+S+TVLGSAGPIRFVA E DLVA++IDTALK YAREGRLPI
Sbjct  1    MLLYNKHKKNHTSKGNRILISVTVLGSAGPIRFVAYEGDLVASIIDTALKCYAREGRLPI  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSD N+F+LYCP A  E
Sbjct  61   LGSDFNDFLLYCPVAGPE  78



>ref|XP_009127827.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
 emb|CDY03721.1| BnaA02g15160D [Brassica napus]
Length=131

 Score =   108 bits (271),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   K KKN A G R+L+S+TVLGSAGPIRF+A E DLVA+VIDTALK YAREGRLP+L
Sbjct  1    MLLYNKQKKN-AKGNRILISVTVLGSAGPIRFLAYEEDLVASVIDTALKCYAREGRLPLL  59

Query  536  GSDLNNFVLYCPNAATE  586
            GSD N+F+LYCP    E
Sbjct  60   GSDFNDFILYCPMVGPE  76



>ref|XP_010274728.1| PREDICTED: uncharacterized protein At4g22758 [Nelumbo nucifera]
Length=146

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 64/76 (84%), Gaps = 1/76 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILG  538
            M + K KKN A G RLL+S+ VLGSAGP+RF+ ++ +LVAAVIDTALKSYAREGRLP+LG
Sbjct  1    MLLQKPKKN-AKGNRLLISVNVLGSAGPLRFLVNDEELVAAVIDTALKSYAREGRLPVLG  59

Query  539  SDLNNFVLYCPNAATE  586
            SDLNNF+LY  NA T+
Sbjct  60   SDLNNFLLYSANAGTD  75



>emb|CDX68330.1| BnaA07g23700D [Brassica napus]
Length=142

 Score =   109 bits (272),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E DLVA+VIDTALK YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVIDTALKCYAREGRLPL  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSD N+F+LYCP    E
Sbjct  61   LGSDFNDFLLYCPMVGPE  78



>emb|CDY09482.1| BnaC02g20240D [Brassica napus]
Length=135

 Score =   108 bits (270),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 62/77 (81%), Gaps = 1/77 (1%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   K KKN A G R+L+S+TVLGSAGPIRF+A E DLVA+VIDTALK YAREGRLP+L
Sbjct  1    MLLYNKQKKN-AKGNRILISVTVLGSAGPIRFLAYEEDLVASVIDTALKCYAREGRLPLL  59

Query  536  GSDLNNFVLYCPNAATE  586
            GSD N+F+LYCP    E
Sbjct  60   GSDFNDFILYCPMVGPE  76



>gb|AAC00605.1| Unknown protein [Arabidopsis thaliana]
Length=151

 Score =   108 bits (271),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 65/91 (71%), Gaps = 6/91 (7%)
 Frame = +2

Query  359  MFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILG  538
            M + K K     G R+L+S+T LGSAGPIRFVA+E DLVA+VIDTALK YAREGRLPILG
Sbjct  1    MLLYKKKNQIVKGNRILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAREGRLPILG  60

Query  539  SDLNNFVLYCP------NAATEGTFTKLFIW  613
            SD N+FV YCP      N +   +F+ +F W
Sbjct  61   SDFNDFVFYCPMVGPGGNLSNTQSFSSVFPW  91



>ref|XP_008467130.1| PREDICTED: uncharacterized protein LOC103504558 [Cucumis melo]
Length=139

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN    G RLL+SI VLGSAGPIRF+ +E  LVAAVIDTALKSYAREGRLPIL
Sbjct  1    MLLYKQKKNQNVKGNRLLISINVLGSAGPIRFIVNEEQLVAAVIDTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDL +F LYCPN   +
Sbjct  61   GSDLRDFQLYCPNTGPD  77



>ref|XP_004150595.1| PREDICTED: uncharacterized protein LOC101204652 [Cucumis sativus]
 ref|XP_004161989.1| PREDICTED: uncharacterized protein LOC101229683 [Cucumis sativus]
 gb|KGN51491.1| hypothetical protein Csa_5G569870 [Cucumis sativus]
Length=139

 Score =   108 bits (270),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN    G RLL+SI VLGSAGPIRF+ +E  LVAAVIDTALKSYAREGRLPIL
Sbjct  1    MLLYKQKKNQNVKGNRLLISINVLGSAGPIRFIVNEEQLVAAVIDTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSDL +F LYCPN   +
Sbjct  61   GSDLRDFQLYCPNTGPD  77



>ref|XP_009104937.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
Length=142

 Score =   108 bits (270),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E DLVA+VIDTALK YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAFEEDLVASVIDTALKCYAREGRLPL  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSD N+F+LYCP    E
Sbjct  61   LGSDFNDFLLYCPMVGPE  78



>emb|CDY23481.1| BnaC06g24500D [Brassica napus]
Length=140

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 52/73 (71%), Positives = 61/73 (84%), Gaps = 1/73 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIRFVA E DLVA+V+DTALK YAREGRLP+
Sbjct  1    MLLYNKQKKNQNAKGNRILISVTVLGSAGPIRFVAYEEDLVASVVDTALKCYAREGRLPL  60

Query  533  LGSDLNNFVLYCP  571
            LGSD N+F+LYCP
Sbjct  61   LGSDFNDFLLYCP  73



>gb|KFK41506.1| hypothetical protein AALP_AA2G138600 [Arabis alpina]
Length=143

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 62/78 (79%), Gaps = 1/78 (1%)
 Frame = +2

Query  356  MMFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K KKN  A G R+L+S+TVLGSAGPIR +A+E DLVA+VID ALK+YAREGRLPI
Sbjct  1    MLLYNKQKKNQTAKGNRILISVTVLGSAGPIRILANEEDLVASVIDVALKNYAREGRLPI  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSD N+F+LYCP    E
Sbjct  61   LGSDFNDFLLYCPMVGPE  78



>ref|NP_001236932.1| uncharacterized protein LOC100499853 [Glycine max]
 gb|ACU13908.1| unknown [Glycine max]
Length=135

 Score =   107 bits (266),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/77 (68%), Positives = 63/77 (82%), Gaps = 1/77 (1%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+ + K KKN  A KRLL+SI VLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+L
Sbjct  1    MLTMSKQKKNQNA-KRLLISINVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVL  59

Query  536  GSDLNNFVLYCPNAATE  586
            G++   FVLYCP+  ++
Sbjct  60   GNNTTGFVLYCPHLGSD  76



>ref|XP_006305759.1| hypothetical protein CARUB_v10010592mg [Capsella rubella]
 gb|EOA38657.1| hypothetical protein CARUB_v10010592mg [Capsella rubella]
Length=142

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/71 (72%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  359  MFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILG  538
            M + K K     G R+L+S+T LGSAGPIRFVA+E DLVAAVIDTALK YAREGRLPILG
Sbjct  1    MLLYKKKNQMVKGNRILISVTFLGSAGPIRFVANEGDLVAAVIDTALKCYAREGRLPILG  60

Query  539  SDLNNFVLYCP  571
            SD N+FV YCP
Sbjct  61   SDFNDFVFYCP  71



>ref|XP_010477604.1| PREDICTED: uncharacterized protein LOC104756680 [Camelina sativa]
 ref|XP_010477605.1| PREDICTED: uncharacterized protein LOC104756680 [Camelina sativa]
Length=145

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  359  MFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILG  538
            M +CK K     G R+L+S+T LGSAGPIRFVA+E DLVAAVIDTALK YA+EGRLPILG
Sbjct  1    MVLCKKKSQIVKGNRILISVTFLGSAGPIRFVANEGDLVAAVIDTALKCYAKEGRLPILG  60

Query  539  SDLNNFVLYCP  571
            SD  +FV YCP
Sbjct  61   SDFKDFVFYCP  71



>ref|XP_007047987.1| Uncharacterized protein TCM_001138 [Theobroma cacao]
 gb|EOX92144.1| Uncharacterized protein TCM_001138 [Theobroma cacao]
Length=228

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +2

Query  353  KMMFVCKAKKNPA-AGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
            + M V + KKN    G RLL+SIT LGSAGPIRF+ +E +LVAAVIDTALKSYAREGRLP
Sbjct  89   ECMAVYRQKKNQDPKGNRLLISITFLGSAGPIRFIVNEEELVAAVIDTALKSYAREGRLP  148

Query  530  ILGSDLNNFVLYCPNAATE  586
            +LGS+LN+F+LYCP+A ++
Sbjct  149  VLGSNLNDFLLYCPSAGSD  167



>ref|XP_008229194.1| PREDICTED: uncharacterized protein LOC103328575 isoform X2 [Prunus 
mume]
Length=145

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +2

Query  314  KRRFV*lllllAKKMMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDT  493
            KRR V     L +K   +   + +     R L+++ V+GSAGPIRFV +E+DLVA VIDT
Sbjct  3    KRRNVLERTTLQQKHKKINNNEVHSVKKNRFLITVNVVGSAGPIRFVVNEDDLVAGVIDT  62

Query  494  ALKSYAREGRLPILGSDLNNFVLYCPNAATEGTF  595
            ALKSYAREGRLP+LGSD+ +F+LYC NA ++G+ 
Sbjct  63   ALKSYAREGRLPLLGSDVKDFLLYCANAGSDGSH  96



>ref|XP_004236949.1| PREDICTED: uncharacterized protein LOC101244859 [Solanum lycopersicum]
Length=144

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/77 (69%), Positives = 61/77 (79%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KK  A  G RLL+SITV+GSAGPIRFV +E +LVA VID ALK+YARE RLP+L
Sbjct  1    MVLYKTKKIQAGKGNRLLISITVVGSAGPIRFVVNEKELVADVIDIALKNYAREERLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GS+ NNFVLYCP A TE
Sbjct  61   GSNFNNFVLYCPTAVTE  77



>ref|NP_173728.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAO22759.1| unknown protein [Arabidopsis thaliana]
 gb|AAO42426.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30348.1| uncharacterized protein AT1G23150 [Arabidopsis thaliana]
Length=141

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  359  MFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILG  538
            M + K K     G R+L+S+T LGSAGPIRFVA+E DLVA+VIDTALK YAREGRLPILG
Sbjct  1    MLLYKKKNQIVKGNRILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAREGRLPILG  60

Query  539  SDLNNFVLYCP  571
            SD N+FV YCP
Sbjct  61   SDFNDFVFYCP  71



>ref|XP_002890566.1| hypothetical protein ARALYDRAFT_889841 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66825.1| hypothetical protein ARALYDRAFT_889841 [Arabidopsis lyrata subsp. 
lyrata]
Length=141

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 59/72 (82%), Gaps = 1/72 (1%)
 Frame = +2

Query  359  MFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K K N    G R+L+S+T LGSAGPIRFVA+E+DLVAAVIDTALK YAREGRLPIL
Sbjct  1    MLLYKKKNNQIVKGNRILISVTFLGSAGPIRFVANESDLVAAVIDTALKCYAREGRLPIL  60

Query  536  GSDLNNFVLYCP  571
            GSD N+FV YCP
Sbjct  61   GSDFNDFVFYCP  72



>ref|XP_006416119.1| hypothetical protein EUTSA_v10009597mg [Eutrema salsugineum]
 gb|ESQ34472.1| hypothetical protein EUTSA_v10009597mg [Eutrema salsugineum]
Length=142

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            +++  + KK    G R+L+S+T LGSAGPIRFVA+E DLVA+VIDTALK YAREGRLPIL
Sbjct  2    LLYNKQKKKEMVKGNRILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAREGRLPIL  61

Query  536  GSDLNNFVLYCPNAATE  586
            GSD N+F+ YCP    E
Sbjct  62   GSDFNDFLFYCPMVGPE  78



>ref|XP_004504564.1| PREDICTED: uncharacterized protein LOC101507525 [Cicer arietinum]
Length=137

 Score =   103 bits (258),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN  A   RLL+SI VLGSAGPIRFV +E +LVA VIDTALKSYAREGRLP+L
Sbjct  1    MLLTKQKKNHNANATRLLISINVLGSAGPIRFVVNEEELVATVIDTALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            G+D+  F LYCP+  ++
Sbjct  61   GNDIRTFALYCPHVGSD  77



>gb|AGU36359.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            RLL+SITV+GSAGPIRFV +E ++VA+V+DTALKSYAREGRLP+LGS++N FVLYCP A 
Sbjct  1    RLLISITVIGSAGPIRFVVNEEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  581  TE  586
            TE
Sbjct  61   TE  62



>ref|XP_010498820.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
 ref|XP_010498821.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=146

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/71 (70%), Positives = 57/71 (80%), Gaps = 0/71 (0%)
 Frame = +2

Query  359  MFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILG  538
            M + K K     G R+L+S+T LGSAGPIRFVA+E DLVAAVIDTALK YA+EGRLPILG
Sbjct  1    MLLYKKKSQIVKGNRILISVTFLGSAGPIRFVANEGDLVAAVIDTALKCYAKEGRLPILG  60

Query  539  SDLNNFVLYCP  571
            SD  +FVLYCP
Sbjct  61   SDFKDFVLYCP  71



>ref|XP_002534031.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28351.1| conserved hypothetical protein [Ricinus communis]
Length=152

 Score =   103 bits (258),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 66/89 (74%), Gaps = 9/89 (10%)
 Frame = +2

Query  347  AKKMMFVCKAKKNPAAGK---------RLLVSITVLGSAGPIRFVASENDLVAAVIDTAL  499
            ++K+M   + KK+    K         R L+SI VLGSAGP+RFV +E++LVA VIDTAL
Sbjct  7    SQKLMLYKQKKKDDDHTKTNHNKKNISRFLISINVLGSAGPLRFVVNEDELVAGVIDTAL  66

Query  500  KSYAREGRLPILGSDLNNFVLYCPNAATE  586
            K+Y+REGRLP+LGSD+NNF+LYC NA ++
Sbjct  67   KTYSREGRLPVLGSDVNNFLLYCANAGSD  95



>dbj|BAB33412.1| putative senescence-associated protein [Pisum sativum]
Length=221

 Score =   105 bits (263),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 72/127 (57%), Gaps = 12/127 (9%)
 Frame = +2

Query  209  PRFRFFVLFDLIPHFLKFVFFSFLILPNSPVFLEKKRRFV*lllllAKKMMFVCKAKKNP  388
            P    F +  L   F  F FF  LI P+   +L            L +KM+     K   
Sbjct  1    PDAILFSVTSLEIQFWTFRFFHCLISPDRWFYL------------LIEKMLMNKHKKNQN  48

Query  389  AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYC  568
            A  KRLL+SI V GSAGPIRFV  E +LVAAVIDTALKSYAREGRLP+LG D+  F LYC
Sbjct  49   ANAKRLLISINVFGSAGPIRFVVKEEELVAAVIDTALKSYAREGRLPVLGGDIRTFALYC  108

Query  569  PNAATEG  589
            P   ++ 
Sbjct  109  PLVGSDA  115



>ref|XP_006355080.1| PREDICTED: uncharacterized protein LOC102584968 [Solanum tuberosum]
Length=143

 Score =   103 bits (257),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 59/77 (77%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKK-NPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KK     G RLL+SITV+GSAGPIRFV +E +LVA VID ALK+YARE RLP+L
Sbjct  1    MLLYKTKKIQSGKGNRLLISITVVGSAGPIRFVVNEKELVANVIDIALKNYAREERLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GS+ NNFVLYCP   TE
Sbjct  61   GSNFNNFVLYCPTVVTE  77



>gb|AFK44881.1| unknown [Lotus japonicus]
Length=138

 Score =   103 bits (256),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKN-PAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KKN  A   RLL+SI VLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+L
Sbjct  1    MLMNKQKKNLNANAMRLLISINVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            G+D   F LYCP+  ++
Sbjct  61   GTDTTGFALYCPHVGSD  77



>ref|XP_008229193.1| PREDICTED: uncharacterized protein LOC103328575 isoform X1 [Prunus 
mume]
Length=153

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = +2

Query  314  KRRFV*lllllAKKMMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDT  493
            KRR V     L +K   +   + +     R L+++ V+GSAGPIRFV +E+DLVA VIDT
Sbjct  3    KRRNVLERTTLQQKHKKINNNEVHSVKKNRFLITVNVVGSAGPIRFVVNEDDLVAGVIDT  62

Query  494  ALKSYAREGRLPILGSDLNNFVLYCPNAATE  586
            ALKSYAREGRLP+LGSD+ +F+LYC NA ++
Sbjct  63   ALKSYAREGRLPLLGSDVKDFLLYCANAGSD  93



>emb|CDY71620.1| BnaC05g50380D [Brassica napus]
Length=138

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = +2

Query  377  KKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNF  556
            K+    G R+L+S+T LGS GPIRFVA+E DLVAAVIDTALK YAREGRLPILGSD N+F
Sbjct  7    KREVVKGNRILISVTFLGSPGPIRFVANEGDLVAAVIDTALKCYAREGRLPILGSDFNDF  66

Query  557  VLYCPNAATE  586
            + YCP    E
Sbjct  67   LFYCPMVGPE  76



>ref|XP_009115559.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
 emb|CDY21419.1| BnaA09g30080D [Brassica napus]
Length=138

 Score =   102 bits (253),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 0/70 (0%)
 Frame = +2

Query  377  KKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNF  556
            K+    G R+L+S+T LGS GPIRFVA E DLVAAVIDTALK YAREGRLPILGSD N+F
Sbjct  7    KREVVKGNRILISVTFLGSPGPIRFVAYEGDLVAAVIDTALKCYAREGRLPILGSDFNDF  66

Query  557  VLYCPNAATE  586
            + YCP    E
Sbjct  67   IFYCPMVGPE  76



>gb|AFK49206.1| unknown [Medicago truncatula]
Length=138

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   K  +N    ++LL++I VLGSAGPIRFV SE DLVA VIDTALKSYAREGRLPIL
Sbjct  1    MLIKQKKNQNAKDARKLLININVLGSAGPIRFVVSEGDLVATVIDTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            G D+ +F LYC +  ++
Sbjct  61   GKDVTSFALYCQHVGSD  77



>gb|AGU36367.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score =   100 bits (249),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            RLL+SITV+GSAGPIRFV +  ++VA+V+DTALKSYAREGRLP+LGS++N FVLYCP A 
Sbjct  1    RLLISITVIGSAGPIRFVVNAEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  581  TE  586
            TE
Sbjct  61   TE  62



>gb|EPS58723.1| hypothetical protein M569_16091, partial [Genlisea aurea]
Length=100

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +2

Query  389  AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYC  568
             AG+R+LVS+TV+GSAGPIRFV  E++ V+AVI TALK YAREGRLP+LG+D+NNF+LYC
Sbjct  2    TAGRRILVSLTVIGSAGPIRFVVDEDETVSAVIRTALKLYAREGRLPLLGTDINNFMLYC  61

Query  569  PNAATE  586
            P + +E
Sbjct  62   PVSGSE  67



>ref|XP_010681883.1| PREDICTED: uncharacterized protein LOC104896789 [Beta vulgaris 
subsp. vulgaris]
Length=138

 Score =   101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   + K   + G RLL+++ VLGSAGP+RFV +E ++VAAVID ALKSYAREGRLP+L
Sbjct  1    MLLSKQKKAQNSKGNRLLITVNVLGSAGPLRFVVNEKEIVAAVIDMALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GS+ N+F LYCP A ++
Sbjct  61   GSNFNDFQLYCPTAGSD  77



>gb|AGU36354.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36362.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36363.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36364.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36368.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36369.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36370.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36371.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36372.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36373.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36374.1| hypothetical protein, partial [Helianthus annuus]
Length=109

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            RLL+SITV+GSAGPIRFV +  ++VA+V+DTALKSYAREGRLP+LGS++N FVLYCP A 
Sbjct  1    RLLISITVIGSAGPIRFVVNAEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  581  TE  586
            TE
Sbjct  61   TE  62



>gb|AGU36357.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            RLL+SITV+GSAGPIRFV +  ++VA+V+DTALKSYAREGRLP+LGS++N FVLYCP A 
Sbjct  1    RLLISITVIGSAGPIRFVVNAEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  581  TE  586
            TE
Sbjct  61   TE  62



>gb|AGU36353.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36355.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36356.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36358.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36360.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36361.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36365.1| hypothetical protein, partial [Helianthus annuus]
 gb|AGU36366.1| hypothetical protein, partial [Helianthus annuus]
Length=108

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            RLL+SITV+GSAGPIRFV +  ++VA+V+DTALKSYAREGRLP+LGS++N FVLYCP A 
Sbjct  1    RLLISITVIGSAGPIRFVVNAEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  581  TE  586
            TE
Sbjct  61   TE  62



>gb|AGU36351.1| hypothetical protein, partial [Helianthus argophyllus]
 gb|AGU36352.1| hypothetical protein, partial [Helianthus argophyllus]
Length=109

 Score =   100 bits (248),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            RLL+SITV+GSAGPIRFV +  ++VA+V+DTALKSYAREGRLP+LGS++N FVLYCP A 
Sbjct  1    RLLISITVIGSAGPIRFVVNAEEVVASVMDTALKSYAREGRLPVLGSNINEFVLYCPIAG  60

Query  581  TE  586
            TE
Sbjct  61   TE  62



>ref|NP_001236734.1| uncharacterized protein LOC100305791 [Glycine max]
 gb|ACU13651.1| unknown [Glycine max]
Length=137

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/77 (64%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M + K KK+     KRLL+SI VLGSAGPIRFV +E +LVAAVIDTALKSYAREGRLP+L
Sbjct  1    MLMSKQKKSQIQNAKRLLISINVLGSAGPIRFVVNEEELVAAVIDTALKSYAREGRLPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            G++   F LYCP+  ++
Sbjct  61   GNNTTGFALYCPHLGSD  77



>gb|ACJ84118.1| unknown [Medicago truncatula]
Length=141

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = +2

Query  359  MFVCKAKKNPAAG---KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
            M + K KKN  A    +RLL+SI VLGSAGPIRFV +E +LV AVIDT LKSYAREGRLP
Sbjct  1    MLLSKQKKNQNANNAKRRLLISINVLGSAGPIRFVVNEEELVEAVIDTTLKSYAREGRLP  60

Query  530  ILGSDLNNFVLYCPNAATEGTFT  598
            +LG+D + F LYCP+  ++   +
Sbjct  61   VLGNDHSAFFLYCPHLGSDAALS  83



>ref|XP_010460096.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
 ref|XP_010460097.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=143

 Score =   100 bits (250),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +2

Query  359  MFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILG  538
            M + K K     G R+L+S+T LGSAGPIRFVA+E DLVA+VIDTALK YA+EGRLPIL 
Sbjct  1    MLLYKKKSQIVKGNRILISVTFLGSAGPIRFVANEGDLVASVIDTALKCYAKEGRLPILA  60

Query  539  SDLNNFVLYCP  571
            SD  +FVLYCP
Sbjct  61   SDFKDFVLYCP  71



>gb|EPS67816.1| hypothetical protein M569_06958, partial [Genlisea aurea]
Length=134

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   + K  P+ G+R+L+S+  LGSAGPIRF+ +E++ VA+VI TALK YAREGRLPIL
Sbjct  1    MLLYKQKKVVPSTGRRILISVGFLGSAGPIRFIVNEDEPVASVITTALKLYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSD+NNF+LYCP +  E
Sbjct  61   GSDMNNFMLYCPISGYE  77



>ref|XP_003589658.1| hypothetical protein MTR_1g031680 [Medicago truncatula]
 ref|XP_003609749.1| hypothetical protein MTR_4g121810 [Medicago truncatula]
 gb|ABD32641.1| Senescence-associated protein, putative [Medicago truncatula]
 gb|AES59909.1| senescence-associated protein, putative [Medicago truncatula]
 gb|AFK43979.1| unknown [Medicago truncatula]
Length=141

 Score =   100 bits (249),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 3/83 (4%)
 Frame = +2

Query  359  MFVCKAKKNPAAG---KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
            M + K KKN  A    +RLL+SI VLGSAGPIRFV +E +LV AVIDT LKSYAREGRLP
Sbjct  1    MLLSKQKKNQNANNAKRRLLISINVLGSAGPIRFVVNEEELVEAVIDTTLKSYAREGRLP  60

Query  530  ILGSDLNNFVLYCPNAATEGTFT  598
            +LG+D + F LYCP+  ++   +
Sbjct  61   VLGNDHSAFFLYCPHLGSDAALS  83



>gb|KHG22133.1| hypothetical protein F383_27486 [Gossypium arboreum]
Length=138

 Score =   100 bits (248),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 61/77 (79%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   + K     G RLLVSITVLGSAGPIRFV +E +LV++VIDTALK+YAREGR P+L
Sbjct  1    MVLYKQKKSQGPKGNRLLVSITVLGSAGPIRFVVNEEELVSSVIDTALKAYAREGRRPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GS +++F LYCP+A ++
Sbjct  61   GSAISDFFLYCPSAGSD  77



>gb|ACJ83930.1| unknown [Medicago truncatula]
Length=139

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   K  +N    ++LL++I VLGSAGPIRFV SE DLV  VIDTALKSYAREGRLPIL
Sbjct  1    MLIKQKKNQNAKDARKLLININVLGSAGPIRFVVSEGDLVVTVIDTALKSYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            G D+ +F LYC +  ++
Sbjct  61   GKDVTSFALYCQHVGSD  77



>gb|KFK22025.1| hypothetical protein AALP_AAs45940U000100 [Arabis alpina]
Length=139

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            +++  + K+    G R+L+S+T LGS GPIRFVA E DLVA VIDTALK YAREGRLPIL
Sbjct  2    LLYNKQKKREIVKGNRILISVTFLGSPGPIRFVAYEGDLVAGVIDTALKCYAREGRLPIL  61

Query  536  GSDLNNFVLYCP  571
            GSD N+F+ YCP
Sbjct  62   GSDFNDFLFYCP  73



>gb|KJB50372.1| hypothetical protein B456_008G167200 [Gossypium raimondii]
Length=138

 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+   + K     G RLLVSITVLGSAGPIRFV +E +LV++VIDTALK+YAREGR P+L
Sbjct  1    MVLYKQKKSQGPKGNRLLVSITVLGSAGPIRFVVNEEELVSSVIDTALKAYAREGRRPVL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GS ++ F LYCP+A ++
Sbjct  61   GSAISGFFLYCPSAGSD  77



>ref|XP_008343057.1| PREDICTED: uncharacterized protein LOC103405829 [Malus domestica]
 ref|XP_008362512.1| PREDICTED: uncharacterized protein LOC103426195 [Malus domestica]
Length=153

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L+++ VLGSAGPIRFV +E+DLVA VIDTALKSYAREGRLP+LGSD+ +F+L+C NA 
Sbjct  30   RFLITVNVLGSAGPIRFVVNEDDLVARVIDTALKSYAREGRLPVLGSDVKDFLLHCANAG  89

Query  581  TE  586
            ++
Sbjct  90   SD  91



>ref|XP_009334449.1| PREDICTED: uncharacterized protein At4g22758-like [Pyrus x bretschneideri]
Length=152

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L+++ VLGSAGPIRFV +E+DLVA VIDTALKSYAREGRLP+LGSD+ +F+L+C NA 
Sbjct  30   RFLITVNVLGSAGPIRFVVNEDDLVARVIDTALKSYAREGRLPVLGSDVKDFLLHCVNAG  89

Query  581  TE  586
            ++
Sbjct  90   SD  91



>gb|KHN46081.1| Hypothetical protein glysoja_030082 [Glycine soja]
Length=133

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 61/77 (79%), Gaps = 3/77 (4%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M+ + K KKN  A KRLL+SI VLGSAGPIRFV +E +LVAAVIDTA  SYAREGRLP+L
Sbjct  1    MLTMSKQKKNQNA-KRLLISINVLGSAGPIRFVVNEEELVAAVIDTA--SYAREGRLPVL  57

Query  536  GSDLNNFVLYCPNAATE  586
            G++   FVLYCP+  ++
Sbjct  58   GNNTTGFVLYCPHLGSD  74



>ref|XP_010554413.1| PREDICTED: uncharacterized protein LOC104824136 isoform X2 [Tarenaya 
hassleriana]
Length=94

 Score = 97.1 bits (240),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K K+N    G R LVSI VLGSAGPIRFV  E++ VA V+D AL+ YAREGRLP+
Sbjct  1    MLLYSKQKRNQNPKGNRFLVSINVLGSAGPIRFVVKEDETVANVMDCALRCYAREGRLPV  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSD+N+FVLY P +A E
Sbjct  61   LGSDINDFVLYSPYSAAE  78



>ref|XP_009110117.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
 emb|CDY41461.1| BnaA08g20630D [Brassica napus]
Length=147

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = +2

Query  395  GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPN  574
            G R+L+S+  LGSAGPIRFVA E DLVA VIDTALK YAREGRLPILGSD N+F+ YCP 
Sbjct  19   GNRILISVAFLGSAGPIRFVAYEGDLVANVIDTALKCYAREGRLPILGSDFNDFLFYCPM  78

Query  575  AATE  586
               E
Sbjct  79   VGPE  82



>gb|AGV54243.1| senescence-associated protein [Phaseolus vulgaris]
Length=138

 Score = 97.8 bits (242),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILG  538
            M + K KKN    +R L+SI VLGSAGPIRF+ +E D VAAVI+TALKSYAREGRLP+LG
Sbjct  1    MLLIKQKKNQNV-RRFLISINVLGSAGPIRFLVNEEDHVAAVIETALKSYAREGRLPLLG  59

Query  539  SDLNNFVLYCPNAATE  586
            +D   F LYCP+  T+
Sbjct  60   TDNAGFSLYCPHLGTD  75



>ref|XP_010554411.1| PREDICTED: uncharacterized protein At4g22758-like isoform X1 
[Tarenaya hassleriana]
Length=135

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K K+N    G R LVSI VLGSAGPIRFV  E++ VA V+D AL+ YAREGRLP+
Sbjct  1    MLLYSKQKRNQNPKGNRFLVSINVLGSAGPIRFVVKEDETVANVMDCALRCYAREGRLPV  60

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSD+N+FVLY P +A E
Sbjct  61   LGSDINDFVLYSPYSAAE  78



>gb|KDP33166.1| hypothetical protein JCGZ_13431 [Jatropha curcas]
Length=110

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 61/86 (71%), Gaps = 5/86 (6%)
 Frame = +2

Query  350  KKMMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
            KK +   K KKN     R L+S+ V+GSAGPIRFV  E+D V++VID +LK+Y REGRLP
Sbjct  21   KKSIDEKKNKKN-----RFLISVNVIGSAGPIRFVVKEDDDVSSVIDISLKTYCREGRLP  75

Query  530  ILGSDLNNFVLYCPNAATEGTFTKLF  607
            +LGSD NNF+LYCP A  +   ++L 
Sbjct  76   VLGSDANNFLLYCPKAGFDVDMSQLM  101



>ref|XP_002270144.3| PREDICTED: uncharacterized protein At4g22758 [Vitis vinifera]
 ref|XP_010660315.1| PREDICTED: uncharacterized protein At4g22758 [Vitis vinifera]
Length=149

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L+S+ VLGS+GPIRFV +E DL+AAVIDTALKSYAR+GRLP LGSD+N F+LYC N  
Sbjct  30   RFLISVNVLGSSGPIRFVVNEGDLIAAVIDTALKSYARQGRLPHLGSDINQFLLYCANVG  89

Query  581  TE  586
             +
Sbjct  90   AD  91



>ref|XP_002875078.1| hypothetical protein ARALYDRAFT_322499 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51337.1| hypothetical protein ARALYDRAFT_322499 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 60/79 (76%), Gaps = 2/79 (3%)
 Frame = +2

Query  356  MMFVCKAKKNPAAG--KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
            M++  K KKN  +    R LVSITVLGSAGPIRFV  E++ VA VID ALK YAREGRLP
Sbjct  1    MLYNNKHKKNQKSKTTNRFLVSITVLGSAGPIRFVVKEDETVANVIDYALKCYAREGRLP  60

Query  530  ILGSDLNNFVLYCPNAATE  586
            +LGSD + F+LYCP +A+E
Sbjct  61   LLGSDSSFFLLYCPYSASE  79



>emb|CBI33520.3| unnamed protein product [Vitis vinifera]
Length=145

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L+S+ VLGS+GPIRFV +E DL+AAVIDTALKSYAR+GRLP LGSD+N F+LYC N  
Sbjct  26   RFLISVNVLGSSGPIRFVVNEGDLIAAVIDTALKSYARQGRLPHLGSDINQFLLYCANVG  85

Query  581  TE  586
             +
Sbjct  86   AD  87



>ref|XP_007033029.1| Uncharacterized protein TCM_019175 [Theobroma cacao]
 gb|EOY03955.1| Uncharacterized protein TCM_019175 [Theobroma cacao]
Length=148

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +2

Query  380  KNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFV  559
            KN     R L++I VLGSAGP+RF+ +E+DLVAAVID ALKSYAREGRLP+LG D N F+
Sbjct  23   KNVKKSTRFLITINVLGSAGPLRFLVNEDDLVAAVIDVALKSYAREGRLPVLGLDPNKFL  82

Query  560  LYCPNAATE  586
            LYC NA ++
Sbjct  83   LYCANAGSD  91



>ref|XP_004498287.1| PREDICTED: uncharacterized protein LOC101497295 [Cicer arietinum]
Length=140

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 56/74 (76%), Gaps = 3/74 (4%)
 Frame = +2

Query  359  MFVCKAKKNPAAG---KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
            M + K KK        +RLL+SI V+GSAGPIRFV +E +LVAAVI+T LKSYAREGRLP
Sbjct  1    MLMNKQKKTQITNNNKRRLLISINVMGSAGPIRFVVNEEELVAAVIETTLKSYAREGRLP  60

Query  530  ILGSDLNNFVLYCP  571
            +LGSD N F LYCP
Sbjct  61   VLGSDNNAFCLYCP  74



>gb|KHN17944.1| hypothetical protein glysoja_017995 [Glycine soja]
Length=155

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 7/84 (8%)
 Frame = +2

Query  350  KKMMFVCKAKKNPAA-------GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSY  508
            +KM+ + K  KN  +        KR LV+I ++GSAGPIRFV +E +LV+ VIDTALKSY
Sbjct  9    EKMVMLQKNNKNKGSYDDEKPRSKRFLVNINIMGSAGPIRFVVNEKELVSGVIDTALKSY  68

Query  509  AREGRLPILGSDLNNFVLYCPNAA  580
            +REGRLP+LG D  NF+LYC NA 
Sbjct  69   SREGRLPVLGFDATNFLLYCANAG  92



>ref|XP_007216024.1| hypothetical protein PRUPE_ppa014882mg, partial [Prunus persica]
 gb|EMJ17223.1| hypothetical protein PRUPE_ppa014882mg, partial [Prunus persica]
Length=121

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  407  LVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATE  586
            L+++ V+GS GPIRFV +E+DLVA VIDTALKSYAREGRLP+LGSD+ +F+LYC NA ++
Sbjct  2    LITVNVVGSTGPIRFVVNEDDLVAGVIDTALKSYAREGRLPLLGSDVKDFLLYCANAGSD  61



>ref|XP_003537448.2| PREDICTED: uncharacterized protein LOC100775979 [Glycine max]
Length=155

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 7/84 (8%)
 Frame = +2

Query  350  KKMMFVCKAKKNPAA-------GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSY  508
            +KM+ + K  KN  +        KR LV+I ++GSAGPIRFV +E +LV+ VIDTALKSY
Sbjct  9    EKMVMLQKNNKNKGSYDDEKPRSKRFLVNINIMGSAGPIRFVVNEKELVSGVIDTALKSY  68

Query  509  AREGRLPILGSDLNNFVLYCPNAA  580
            +REGRLP+LG D  NF+LYC NA 
Sbjct  69   SREGRLPVLGFDATNFLLYCANAG  92



>emb|CDX91699.1| BnaC08g06180D [Brassica napus]
Length=147

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
             R+L+S+  LGSAGPIRFVA E DLVA VIDTALK YAREGRLP+LGSD N+F+ YCP  
Sbjct  21   NRILISVAFLGSAGPIRFVAYEGDLVANVIDTALKCYAREGRLPVLGSDFNDFLFYCPMV  80

Query  578  ATE  586
              E
Sbjct  81   GPE  83



>ref|XP_007153400.1| hypothetical protein PHAVU_003G031800g [Phaseolus vulgaris]
 gb|ESW25394.1| hypothetical protein PHAVU_003G031800g [Phaseolus vulgaris]
Length=138

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILG  538
            M + K KKN    +R L+SI VLGSAGPIRF+ +E D VAAVI+TALKSYAREGRLP+LG
Sbjct  1    MLLIKQKKNQNV-RRFLISINVLGSAGPIRFLVNEEDHVAAVIETALKSYAREGRLPLLG  59

Query  539  SDLNNFVLYCPN  574
            +D   F LYCP+
Sbjct  60   TDNAGFSLYCPH  71



>ref|XP_010109006.1| hypothetical protein L484_027203 [Morus notabilis]
 gb|EXC20646.1| hypothetical protein L484_027203 [Morus notabilis]
Length=149

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            +RLL+++ VLGSAGP+RFV +E+D+V++VI+TAL+SYAREGRLP+LG+  N+F+LYC NA
Sbjct  28   RRLLITVNVLGSAGPMRFVVNEDDVVSSVIETALRSYAREGRLPLLGTHSNDFLLYCANA  87

Query  578  ATE  586
             ++
Sbjct  88   GSD  90



>ref|XP_007153591.1| hypothetical protein PHAVU_003G048500g [Phaseolus vulgaris]
 gb|ESW25585.1| hypothetical protein PHAVU_003G048500g [Phaseolus vulgaris]
Length=147

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M   K KK+  A  +RLL+SI VLGS+GPIRFV +E + V AV+ TALK YAREGRLPIL
Sbjct  1    MLTSKQKKSQKANARRLLISINVLGSSGPIRFVVNEEEHVGAVVGTALKFYAREGRLPIL  60

Query  536  GSDLNNFVLYCPNAATE  586
            G D   F LYCP+ A++
Sbjct  61   GKDTTGFALYCPHLASD  77



>ref|XP_010032694.1| PREDICTED: uncharacterized protein At4g22758-like [Eucalyptus 
grandis]
 gb|KCW52147.1| hypothetical protein EUGRSUZ_J01592 [Eucalyptus grandis]
Length=155

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 5/90 (6%)
 Frame = +2

Query  314  KRRFV*lllllAKKMMFVCKAKKNPAAGK-----RLLVSITVLGSAGPIRFVASENDLVA  478
            KR+      L  K ++     KKN +  +     R LV++ VLGSAGPIRFV  E+DLV+
Sbjct  3    KRQEKMKRNLSEKSLLMQKHKKKNSSDDQGSKKNRFLVTVNVLGSAGPIRFVVKEDDLVS  62

Query  479  AVIDTALKSYAREGRLPILGSDLNNFVLYC  568
            AVI TALK+YAREGRLP+LG+D+NNFVL+ 
Sbjct  63   AVIQTALKTYAREGRLPVLGTDVNNFVLHA  92



>ref|XP_010066603.1| PREDICTED: uncharacterized protein LOC104453692 [Eucalyptus grandis]
Length=140

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            RLL+SI V+GS GPIRFV SE++LV++VIDTAL++YA +GRLPILGSD  +F+LYC NA 
Sbjct  21   RLLISINVMGSPGPIRFVVSEDELVSSVIDTALRTYAHQGRLPILGSDPGDFLLYCANAE  80

Query  581  TE  586
            ++
Sbjct  81   SD  82



>ref|XP_002875080.1| hypothetical protein ARALYDRAFT_904355 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51339.1| hypothetical protein ARALYDRAFT_904355 [Arabidopsis lyrata subsp. 
lyrata]
Length=134

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 57/80 (71%), Gaps = 2/80 (3%)
 Frame = +2

Query  356  MMFVCKAKKNPA--AGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
            M+   K K+N      KR LVSI VLGSAGPIRFV  E++ VA VID ALK YAREGRLP
Sbjct  1    MLLYNKQKRNQKLKTTKRFLVSINVLGSAGPIRFVVKEDETVANVIDYALKCYAREGRLP  60

Query  530  ILGSDLNNFVLYCPNAATEG  589
            +LGSD + F+LYCP  A++ 
Sbjct  61   LLGSDSSFFLLYCPYYASQA  80



>ref|XP_010916501.1| PREDICTED: uncharacterized protein LOC105041292 [Elaeis guineensis]
Length=149

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 56/66 (85%), Gaps = 0/66 (0%)
 Frame = +2

Query  389  AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYC  568
             A KR L+++ VLGSAGP+RF+ ++ +LVA VI+TALKSYAREGRLP+LGSDLNNF+LY 
Sbjct  27   GASKRFLITVNVLGSAGPLRFLVNDGELVATVINTALKSYAREGRLPVLGSDLNNFLLYY  86

Query  569  PNAATE  586
             N+ ++
Sbjct  87   ANSESD  92



>gb|KDP33165.1| hypothetical protein JCGZ_13430 [Jatropha curcas]
Length=153

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 57/77 (74%), Gaps = 5/77 (6%)
 Frame = +2

Query  350  KKMMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
            KK +   K KKN     R L+S+ V+GSAGPI+FV  E+D VA+VID +LK+Y REGRLP
Sbjct  21   KKSIDEKKNKKN-----RFLISVNVIGSAGPIKFVVKEDDDVASVIDISLKTYCREGRLP  75

Query  530  ILGSDLNNFVLYCPNAA  580
            +LGSD +NF+LYCP A 
Sbjct  76   VLGSDAHNFLLYCPKAG  92



>ref|XP_008809820.1| PREDICTED: uncharacterized protein LOC103721401 [Phoenix dactylifera]
Length=147

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  392  AGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCP  571
            A  R L+++ VLGSAGP+RF+ ++ +LV  VI TALKSYAREGRLP+LGSD NNF+LYC 
Sbjct  26   ANTRFLITVNVLGSAGPLRFLVNDGELVTNVIHTALKSYAREGRLPVLGSDFNNFLLYCA  85

Query  572  NAATE  586
            N+ ++
Sbjct  86   NSGSD  90



>gb|KFK33374.1| hypothetical protein AALP_AA5G005100 [Arabis alpina]
Length=170

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +2

Query  314  KRRFV*lllllAK-KMMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVID  490
            + RF+      +K +  F+    K      R LVSIT LGSAGPIRF+  E++ V+ VID
Sbjct  19   ENRFLVTTHKKSKTENRFLVTTHKKSKTENRFLVSITFLGSAGPIRFLVKEDETVSNVID  78

Query  491  TALKSYAREGRLPILGSDLNNFVLYCPNAATE  586
             ALKSYAREGRLP+LGSD + F+LYCP +A E
Sbjct  79   YALKSYAREGRLPLLGSDSSFFLLYCPYSAPE  110



>ref|XP_009586822.1| PREDICTED: uncharacterized protein LOC104084618 [Nicotiana tomentosiformis]
Length=133

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +2

Query  371  KAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLN  550
            K+ + P    R L++I VLGSAGP+RFV SEND VA V++TAL  YAREGRLPILGS++N
Sbjct  4    KSLQKPIKNTRFLITINVLGSAGPLRFVVSENDKVAGVVETALNQYAREGRLPILGSEVN  63

Query  551  NFVLYCPNAATEG  589
            +F  Y  +A  +G
Sbjct  64   DFFFYSASAGLDG  76



>ref|XP_004503136.1| PREDICTED: uncharacterized protein LOC101504281 [Cicer arietinum]
Length=142

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            KR LV+I ++GS+GPIRFV +E +LV+ VIDTALKSYAREGRLP+LG + +NF+LY PNA
Sbjct  22   KRFLVTINIMGSSGPIRFVVNEKELVSGVIDTALKSYAREGRLPVLGFNASNFLLYHPNA  81



>ref|XP_006357767.1| PREDICTED: uncharacterized protein LOC102592157 [Solanum tuberosum]
Length=127

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = +2

Query  395  GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPN  574
            G RLL+++ VLGSAGP+RFV +END VA V+DTALK Y REGRLPIL S++N+F+LY  +
Sbjct  8    GTRLLITVNVLGSAGPLRFVVNENDKVAKVVDTALKQYGREGRLPILTSNVNDFLLYSAS  67

Query  575  AATE  586
            A  +
Sbjct  68   AGMD  71



>ref|XP_010667680.1| PREDICTED: uncharacterized protein LOC104884693 [Beta vulgaris 
subsp. vulgaris]
Length=169

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  383  NPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVL  562
            N +  KRLLV I VLGSAGP++FV +E D V  VIDT+LK YA+E RLP+LGSD  NF+L
Sbjct  46   NNSNNKRLLVVINVLGSAGPLKFVVNEEDFVGGVIDTSLKLYAKERRLPVLGSDSTNFLL  105

Query  563  YCPNAATE  586
            YC NAA++
Sbjct  106  YCANAASD  113



>ref|XP_010553810.1| PREDICTED: uncharacterized protein LOC104823786 [Tarenaya hassleriana]
Length=140

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = +2

Query  356  MMFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            M+   K K+N  + G R LVSI VLGSAGPIRFV  E++ VA V+  ALKSY RE RLP+
Sbjct  2    MLLYNKQKRNQNSKGNRFLVSINVLGSAGPIRFVVKEDETVANVMVYALKSYTRERRLPV  61

Query  533  LGSDLNNFVLYCPNAATE  586
            LGSD+++FVLY P +A E
Sbjct  62   LGSDIHDFVLYSPYSAAE  79



>ref|XP_009586821.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
tomentosiformis]
Length=153

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            RLL+++ VLGSAGP+RFV SEND VA V++TALK YAREGRLPIL S++N+F LY  NA 
Sbjct  34   RLLITVNVLGSAGPLRFVVSENDKVAVVVNTALKQYAREGRLPILSSNVNDFFLYTTNAG  93

Query  581  TE  586
             +
Sbjct  94   ID  95



>ref|XP_006430618.1| hypothetical protein CICLE_v10012986mg [Citrus clementina]
 gb|ESR43858.1| hypothetical protein CICLE_v10012986mg [Citrus clementina]
 gb|KDO50842.1| hypothetical protein CISIN_1g031575mg [Citrus sinensis]
Length=157

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +2

Query  383  NPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVL  562
            N     R L+++ VLGSAGPIRF+ + NDLVA+VIDTALK++AREGRLP+LG D++ F+L
Sbjct  31   NNVKKSRFLITVNVLGSAGPIRFLVNGNDLVASVIDTALKTFAREGRLPVLGFDVDKFLL  90

Query  563  YCPNAATE  586
            YC N  ++
Sbjct  91   YCANEGSD  98



>ref|XP_003552877.1| PREDICTED: uncharacterized protein LOC100810542 [Glycine max]
 gb|KHN07549.1| hypothetical protein glysoja_019656 [Glycine soja]
Length=150

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R LV+I ++GSAGPIRFV +E +LV+ VIDTALKSYA EGRLP+LG D  NF+LYC NA 
Sbjct  31   RFLVNINIMGSAGPIRFVVNEKELVSGVIDTALKSYAGEGRLPVLGFDATNFLLYCANAG  90



>ref|XP_009586817.1| PREDICTED: uncharacterized protein LOC104084614 [Nicotiana tomentosiformis]
Length=144

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 53/63 (84%), Gaps = 3/63 (5%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L+++ VLGSAGP+RFV SEND VA+V+DTALK YAREGRLPIL S++N+F LY   +A
Sbjct  26   RFLITVNVLGSAGPLRFVVSENDKVASVVDTALKQYAREGRLPILSSNINDFFLY---SA  82

Query  581  TEG  589
            T+G
Sbjct  83   TDG  85



>ref|XP_006482133.1| PREDICTED: uncharacterized protein LOC102630256 [Citrus sinensis]
Length=157

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = +2

Query  383  NPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVL  562
            N     R L+++ VLGSAGPIRF+ + NDLVA+VIDTALK++AREGRLP+LG D++ F+L
Sbjct  31   NNVKKSRFLITVNVLGSAGPIRFLVNGNDLVASVIDTALKTFAREGRLPVLGFDVDKFLL  90

Query  563  YCPNAAT  583
            YC N  +
Sbjct  91   YCANEGS  97



>ref|XP_011002783.1| PREDICTED: uncharacterized protein LOC105109699 [Populus euphratica]
Length=148

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R LVS+  LGSAGPIRFV + +DLV+ VIDTALK+YAR GRLP+LG D+N F+LYC N A
Sbjct  29   RFLVSVNFLGSAGPIRFVVNGDDLVSGVIDTALKTYARGGRLPVLGFDVNKFLLYCANPA  88

Query  581  TE  586
            ++
Sbjct  89   SD  90



>ref|XP_010032695.1| PREDICTED: uncharacterized protein At4g22758 [Eucalyptus grandis]
Length=150

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 5/78 (6%)
 Frame = +2

Query  347  AKKMMFVCKAKKNPAAGK-----RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYA  511
            ++K + + K KKN    +     R LV I VLGS GPIRFV  ++DLV+ VI TALK+YA
Sbjct  13   SEKSLLMQKRKKNSDDNQSTNKNRFLVIINVLGSTGPIRFVVKKDDLVSGVIQTALKTYA  72

Query  512  REGRLPILGSDLNNFVLY  565
            REGRLP+LG+D+NNF+L+
Sbjct  73   REGRLPVLGTDVNNFILH  90



>ref|XP_010926482.1| PREDICTED: uncharacterized protein LOC105048744 [Elaeis guineensis]
Length=147

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +2

Query  392  AGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCP  571
            A  R L+++TVLGSAGPIRF+ +E ++V  VI TALKSYAREGRLP+LGSD NNF+LY  
Sbjct  30   ASNRFLITVTVLGSAGPIRFLVNEGEVVTTVISTALKSYAREGRLPVLGSDFNNFLLYSG  89

Query  572  NAA  580
            + A
Sbjct  90   SDA  92



>gb|KCW52148.1| hypothetical protein EUGRSUZ_J01593 [Eucalyptus grandis]
Length=143

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 5/78 (6%)
 Frame = +2

Query  347  AKKMMFVCKAKKNPAAGK-----RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYA  511
            ++K + + K KKN    +     R LV I VLGS GPIRFV  ++DLV+ VI TALK+YA
Sbjct  6    SEKSLLMQKRKKNSDDNQSTNKNRFLVIINVLGSTGPIRFVVKKDDLVSGVIQTALKTYA  65

Query  512  REGRLPILGSDLNNFVLY  565
            REGRLP+LG+D+NNF+L+
Sbjct  66   REGRLPVLGTDVNNFILH  83



>ref|XP_011021386.1| PREDICTED: uncharacterized protein At4g22758-like [Populus euphratica]
Length=143

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L+SI+ LGSAGPIR V + +DLV+ +I TALK YAREGRLP+LG D++NF+LYC NAA
Sbjct  29   RFLISISFLGSAGPIRVVVNGDDLVSGIISTALKIYAREGRLPVLGFDVSNFLLYCVNAA  88

Query  581  TE  586
            ++
Sbjct  89   SD  90



>gb|EYU44564.1| hypothetical protein MIMGU_mgv1a024095mg [Erythranthe guttata]
Length=138

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M    K + N + G+R L+SI V+GSAGPIRFV S+ND   +VI+T LK Y REGRLPIL
Sbjct  1    MTTKGKKRPNSSGGERFLISINVIGSAGPIRFVVSKNDKADSVIETVLKKYGREGRLPIL  60

Query  536  GSDLNNFVLYCPNAA  580
            GS + +F LY  NAA
Sbjct  61   GSVVTSFFLYPANAA  75



>ref|XP_006395882.1| hypothetical protein EUTSA_v10005108mg [Eutrema salsugineum]
 gb|ESQ33168.1| hypothetical protein EUTSA_v10005108mg [Eutrema salsugineum]
Length=137

 Score = 87.0 bits (214),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R LVSI+ LGSAGPIRFV  E++ VA VID AL+ YAREGRLP+LGSD + F+LYCP +A
Sbjct  18   RFLVSISFLGSAGPIRFVVREDETVANVIDYALRCYAREGRLPLLGSDSSFFLLYCPYSA  77

Query  581  TE  586
             E
Sbjct  78   AE  79



>ref|XP_002305866.2| hypothetical protein POPTR_0004s08870g [Populus trichocarpa]
 gb|EEE86377.2| hypothetical protein POPTR_0004s08870g [Populus trichocarpa]
Length=148

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R LVS+  LGSAGPIRFV + +DLV+ VIDTALK+YAR GRLP+LG D+N F+LYC N  
Sbjct  29   RFLVSVNFLGSAGPIRFVVNGDDLVSGVIDTALKTYARGGRLPVLGFDVNKFLLYCANPP  88

Query  581  TE  586
            ++
Sbjct  89   SD  90



>ref|XP_009774976.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
sylvestris]
Length=153

 Score = 87.0 bits (214),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 3/65 (5%)
 Frame = +2

Query  371  KAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLN  550
            K KKN     RLL+++ VLGSAGP+RFV SEND VA V+DTALK YAREGRLPIL SD  
Sbjct  27   KMKKNST---RLLITVNVLGSAGPLRFVVSENDKVAVVVDTALKLYAREGRLPILSSDAK  83

Query  551  NFVLY  565
            +F LY
Sbjct  84   HFFLY  88



>ref|XP_006383328.1| hypothetical protein POPTR_0005s14530g [Populus trichocarpa]
 gb|ERP61125.1| hypothetical protein POPTR_0005s14530g [Populus trichocarpa]
Length=134

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L+SI+ LGSAGPIR V + +DLV+ +I TALK YAREGRLP+LG D +NF+LYC NAA
Sbjct  19   RFLISISFLGSAGPIRVVVNGDDLVSGIISTALKIYAREGRLPVLGFDASNFLLYCVNAA  78

Query  581  TE  586
            ++
Sbjct  79   SD  80



>ref|XP_009114230.1| PREDICTED: uncharacterized protein At4g22758-like [Brassica rapa]
 emb|CDY04091.1| BnaA09g18690D [Brassica napus]
Length=134

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M++  + K + +   + LVSI+ +GSAGPIRFV  E++ V+ VI+ ALK YAREGRLP+L
Sbjct  1    MVYNKQKKAHKSKINKFLVSISFIGSAGPIRFVVKEDETVSHVIEYALKCYAREGRLPLL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSD + F+LYCP  A E
Sbjct  61   GSDSSYFLLYCPYCAAE  77



>ref|XP_008782287.1| PREDICTED: uncharacterized protein LOC103701859 [Phoenix dactylifera]
Length=147

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L+++ VLGSAGPIRF+ +E ++V  VI TALKSYAREGRLP+LGSD NNF+LY  + A
Sbjct  33   RCLITVNVLGSAGPIRFLVNEGEMVGTVISTALKSYAREGRLPVLGSDFNNFLLYSGSDA  92



>gb|AFK34092.1| unknown [Medicago truncatula]
 gb|KEH34622.1| senescence-associated protein, putative [Medicago truncatula]
Length=138

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R LV+I ++GS+GP+RFV +E +LV+ VIDTALKSYAR+GRLP+LG +  NF LY PN+ 
Sbjct  22   RFLVTINIMGSSGPLRFVVNEKELVSGVIDTALKSYARQGRLPVLGFEATNFFLYHPNSG  81



>ref|XP_007163388.1| hypothetical protein PHAVU_001G230600g [Phaseolus vulgaris]
 gb|ESW35382.1| hypothetical protein PHAVU_001G230600g [Phaseolus vulgaris]
Length=147

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R LV+I ++GSAGPIRFV +E ++V+ VI+TALKSYAREGRLP+LG D  NF LY  NA 
Sbjct  28   RFLVTINIMGSAGPIRFVVNEKEVVSEVIETALKSYAREGRLPVLGFDATNFFLYSANAG  87



>ref|XP_011466921.1| PREDICTED: uncharacterized protein LOC101292530 [Fragaria vesca 
subsp. vesca]
Length=142

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            +++  K+K+       +L+ I+V+GS GPIRFV ++ +LV  VI  ALKSY R+GRLP+L
Sbjct  2    LLYKQKSKEVKGDNNMMLIRISVVGSTGPIRFVVNKKELVGVVIQRALKSYERDGRLPVL  61

Query  536  GSDLNNFVLYCPNAA  580
            GSDL +FVLYC  AA
Sbjct  62   GSDLKDFVLYCTTAA  76



>gb|EYU44567.1| hypothetical protein MIMGU_mgv1a024765mg [Erythranthe guttata]
Length=138

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 55/83 (66%), Gaps = 4/83 (5%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M    K + N + G+R L+S+ V+GSAGPIRFV S N+   +VI+T LK Y REGRLPIL
Sbjct  1    MTTKGKKRPNSSGGERFLISVNVIGSAGPIRFVVSRNEKADSVIETVLKKYGREGRLPIL  60

Query  536  GSDLNNFVLYCPNAAT----EGT  592
            GS + +F LY  NAA     EGT
Sbjct  61   GSVVTSFFLYPANAAGFYALEGT  83



>ref|XP_006405838.1| hypothetical protein EUTSA_v10027994mg [Eutrema salsugineum]
 gb|ESQ47291.1| hypothetical protein EUTSA_v10027994mg [Eutrema salsugineum]
Length=121

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            K+LLV++ VLGS GPIRF+A+E+D V++VI+TALK+YAR+GR+P+LG D++NF+ Y  N 
Sbjct  6    KKLLVNVKVLGSVGPIRFLANEDDKVSSVINTALKTYARQGRIPVLGFDVDNFIFYSING  65

Query  578  A  580
             
Sbjct  66   G  66



>ref|XP_002870559.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46818.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=121

 Score = 84.0 bits (206),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            K+LLVS+ VLGS GPIRF+A+E+D V+ VI+T LK+YAR+GR+P+LG D++NF+ Y  NA
Sbjct  6    KKLLVSVNVLGSVGPIRFLANEDDEVSNVINTTLKAYARQGRIPVLGFDVDNFIFYSINA  65

Query  578  A  580
             
Sbjct  66   G  66



>ref|XP_009139746.1| PREDICTED: uncharacterized protein At4g22758 [Brassica rapa]
 emb|CDX74563.1| BnaA04g08260D [Brassica napus]
Length=142

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            K++LVS+ VLGS GPIRF+ +E+D V++VI+TALK+YAR+GR+P+LG D+NNF+ Y  +A
Sbjct  6    KKILVSVNVLGSVGPIRFLVNEDDKVSSVINTALKTYARQGRIPVLGFDVNNFIFYSNSA  65

Query  578  A  580
             
Sbjct  66   G  66



>ref|XP_004231982.2| PREDICTED: uncharacterized protein At4g22758-like [Solanum lycopersicum]
Length=113

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  416  ITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATE  586
            + VLGSAGP+RFV +END+VA V+DTALK Y+REGRLP+L S++N+F+LY   A  +
Sbjct  2    VNVLGSAGPLRFVVNENDMVAKVVDTALKQYSREGRLPLLSSNVNDFLLYSATAGMD  58



>ref|XP_010096674.1| hypothetical protein L484_025423 [Morus notabilis]
 gb|EXB65342.1| hypothetical protein L484_025423 [Morus notabilis]
Length=157

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 59/89 (66%), Gaps = 8/89 (9%)
 Frame = +2

Query  347  AKKMMFVC--KAKKNPAAG------KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALK  502
            +KK+M     K KKN   G       + L++I VLG AGP+RFV +E+D+V +VIDTALK
Sbjct  9    SKKLMLASRNKQKKNNIIGYCCTPKNKFLITINVLGCAGPLRFVVNEDDVVDSVIDTALK  68

Query  503  SYAREGRLPILGSDLNNFVLYCPNAATEG  589
             YAR+ RLP+L S  N+F+LYC NA  E 
Sbjct  69   LYARQRRLPVLVSHANDFLLYCANAEFEA  97



>ref|XP_010435612.1| PREDICTED: uncharacterized protein LOC104719388 [Camelina sativa]
Length=144

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 53/72 (74%), Gaps = 4/72 (6%)
 Frame = +2

Query  365  VCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSD  544
            V K K N    K LLVS+ VLGS GPIRF+A+E D V+ VI+T LK+YAR+GR+P+LG D
Sbjct  14   VMKGKNN----KLLLVSVNVLGSVGPIRFLANEEDEVSTVINTTLKAYARQGRIPVLGFD  69

Query  545  LNNFVLYCPNAA  580
            ++NF+ Y  NA 
Sbjct  70   VDNFIFYSINAG  81



>emb|CDY01710.1| BnaC04g30420D [Brassica napus]
Length=142

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            K+ LVS+ VLGS GPIRF+ +E+D V++VI+TALK+YAR+GR+P+LG D+NNF+ Y  +A
Sbjct  6    KKFLVSVNVLGSVGPIRFLVNEDDNVSSVINTALKTYARQGRIPVLGLDVNNFIFYSNSA  65

Query  578  A  580
             
Sbjct  66   G  66



>ref|XP_010440883.1| PREDICTED: uncharacterized protein At4g22758-like [Camelina sativa]
Length=141

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 53/72 (74%), Gaps = 4/72 (6%)
 Frame = +2

Query  365  VCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSD  544
            V K K N    K LLVS+ VLGS GPIRF+A+E D V+ VI+T LK+YAR+GR+P+LG D
Sbjct  19   VMKGKNN----KLLLVSVNVLGSVGPIRFLANEEDEVSTVINTTLKAYARQGRIPVLGFD  74

Query  545  LNNFVLYCPNAA  580
            ++NF+ Y  NA 
Sbjct  75   VDNFIFYSINAG  86



>ref|XP_009101334.1| PREDICTED: uncharacterized protein At4g22758 [Brassica rapa]
 emb|CDY17663.1| BnaA06g34820D [Brassica napus]
Length=143

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  371  KAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLN  550
            + K + +   R LVSI+ LGSAGPIRFV  E++ V+ VID ALK YAREGRLP+LGSD +
Sbjct  12   QKKTHKSKINRFLVSISFLGSAGPIRFVVKEDETVSNVIDYALKCYAREGRLPLLGSDSS  71

Query  551  NFVLYCPNAATE  586
             F+LY P  A E
Sbjct  72   FFLLYSPYYAVE  83



>ref|XP_010670141.1| PREDICTED: uncharacterized protein At4g22758-like [Beta vulgaris 
subsp. vulgaris]
Length=160

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = +2

Query  350  KKMMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
            K   F C  K+N    KR L+ + VLGSAGP++FV +E DLV  VI+ ALK Y +EGRLP
Sbjct  24   KSNCFDCH-KENINNNKRFLIIVNVLGSAGPLKFVVNEEDLVGGVIEIALKIYDKEGRLP  82

Query  530  ILGSDLNNFVLYCPNAATE  586
             LGSD   F++YC NA ++
Sbjct  83   ALGSDNTKFLIYCANAGSD  101



>emb|CDY36234.1| BnaC07g20880D [Brassica napus]
Length=134

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = +2

Query  371  KAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLN  550
            + K + +   R LVSI+ LGSAGPIRFV  E++ V+ VID ALK YAREGRLP+LGSD +
Sbjct  9    QKKTHKSKINRFLVSISFLGSAGPIRFVVKEDETVSNVIDYALKCYAREGRLPLLGSDSS  68

Query  551  NFVLYCPNAATE  586
             F+LY P  A E
Sbjct  69   FFLLYSPYYAVE  80



>gb|ABK28724.1| unknown [Arabidopsis thaliana]
Length=183

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            K+LLVS+ VLGS GPIRF+A+E+D V++ I+T LK+YAR+GR+P+LG D++NF+ Y  NA
Sbjct  16   KKLLVSVNVLGSVGPIRFLANEDDEVSSAINTTLKAYARQGRIPVLGFDVDNFIFYSINA  75

Query  578  A  580
             
Sbjct  76   G  76



>ref|NP_198589.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB08318.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE66196.1| unknown [Arabidopsis thaliana]
 gb|AED94224.1| uncharacterized protein AT5G37730 [Arabidopsis thaliana]
Length=182

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            K+LLVS+ VLGS GPIRF+A+E+D V++ I+T LK+YAR+GR+P+LG D++NF+ Y  NA
Sbjct  16   KKLLVSVNVLGSVGPIRFLANEDDEVSSAINTTLKAYARQGRIPVLGFDVDNFIFYSINA  75

Query  578  A  580
             
Sbjct  76   G  76



>gb|AAM62631.1| unknown [Arabidopsis thaliana]
Length=182

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            K+LLVS+ VLGS GPIRF+A+E+D V++ I+T LK+YAR+GR+P+LG D++NF+ Y  NA
Sbjct  16   KKLLVSVNVLGSVGPIRFLANEDDEVSSAINTTLKAYARQGRIPVLGFDVDNFIFYSINA  75

Query  578  A  580
             
Sbjct  76   G  76



>emb|CDY17461.1| BnaC09g20760D [Brassica napus]
Length=134

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 55/77 (71%), Gaps = 0/77 (0%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M++  + K + +   + LVSI+ +GSAGPIRFV  E++ V+ VI+ ALK YA EGRLP+L
Sbjct  1    MVYNKQKKTHKSKINKFLVSISFIGSAGPIRFVVKEDETVSHVIEYALKCYAGEGRLPLL  60

Query  536  GSDLNNFVLYCPNAATE  586
            GSD + F+LYCP  A E
Sbjct  61   GSDSSYFLLYCPYCAAE  77



>emb|CDP02694.1| unnamed protein product [Coffea canephora]
Length=143

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +2

Query  407  LVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATE  586
            L++I VLGSAGP+RFV +END V+ VID ALK YAR+ RLP+LGSD+N+F LY  NA  +
Sbjct  25   LITINVLGSAGPVRFVVNENDTVSGVIDAALKLYARQERLPVLGSDVNSFFLYPANAGLD  84

Query  587  G  589
             
Sbjct  85   A  85



>gb|KGN57775.1| hypothetical protein Csa_3G292550 [Cucumis sativus]
Length=151

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPN  574
            R LVSI V+GS GPIRFVA+E+DLV  +I T+L  YAR+ RLPILG++++NF+L+C N
Sbjct  24   RFLVSINVIGSTGPIRFVANEDDLVCEIIKTSLTLYARQARLPILGTNVDNFILFCVN  81



>gb|KCW64559.1| hypothetical protein EUGRSUZ_G02164 [Eucalyptus grandis]
Length=112

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  425  LGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATE  586
            +GS GPIRFV SE++LV++VIDTAL++YA +GRLPILGSD  +F+LYC NA ++
Sbjct  1    MGSPGPIRFVVSEDELVSSVIDTALRTYAHQGRLPILGSDPGDFLLYCANAESD  54



>ref|XP_011099466.1| PREDICTED: uncharacterized protein At4g22758-like [Sesamum indicum]
Length=151

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L+SI V GSAGPIRFV  E+D  A VI T LK YAREGRLP+LGSD+N FV+Y  NA 
Sbjct  33   RFLISINVFGSAGPIRFVVDEDDNAAGVIQTTLKIYAREGRLPVLGSDINCFVIYPVNAG  92



>gb|KGN57466.1| hypothetical protein Csa_3G190360 [Cucumis sativus]
Length=131

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            KR+L++I V+GS+GP+RFV  E DLV  VI  ALKSYAR+ RLP+LG+D  NF+LY  N 
Sbjct  20   KRVLITINVMGSSGPLRFVVKEEDLVCEVIHIALKSYARQARLPLLGTDPTNFLLYSSNI  79

Query  578  A  580
            A
Sbjct  80   A  80



>ref|XP_003616328.1| hypothetical protein MTR_5g078750 [Medicago truncatula]
Length=180

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R+L+SI ++GS+GP+  V +E+D V  VI+ +LKSYAR+GRLPILGSD+ NF +YC N  
Sbjct  55   RILISINIVGSSGPLTMVVNEDDAVCDVIEKSLKSYARQGRLPILGSDVTNFDIYCSNDV  114

Query  581  TEG  589
            ++ 
Sbjct  115  SDA  117



>gb|AES99286.2| senescence-associated protein, putative [Medicago truncatula]
Length=166

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R+L+SI ++GS+GP+  V +E+D V  VI+ +LKSYAR+GRLPILGSD+ NF +YC N  
Sbjct  41   RILISINIVGSSGPLTMVVNEDDAVCDVIEKSLKSYARQGRLPILGSDVTNFDIYCSNDV  100

Query  581  TEG  589
            ++ 
Sbjct  101  SDA  103



>ref|XP_006285693.1| hypothetical protein CARUB_v10007163mg [Capsella rubella]
 gb|EOA18591.1| hypothetical protein CARUB_v10007163mg [Capsella rubella]
Length=123

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 53/70 (76%), Gaps = 4/70 (6%)
 Frame = +2

Query  371  KAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLN  550
            K K N    K+LLVS+ VLGS GPIRF+A+E+D V+ +I+T LK+YAR+GR+P+LG D++
Sbjct  2    KGKNN----KKLLVSVNVLGSVGPIRFLANEDDEVSRIINTTLKAYARQGRVPVLGFDVD  57

Query  551  NFVLYCPNAA  580
            NF+ Y  N  
Sbjct  58   NFIFYSINPG  67



>gb|KEH34623.1| senescence-associated protein, putative [Medicago truncatula]
Length=141

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            + LV+I ++GS+GPIRFV +E +LV+ VID ALKSYAR+GRLP+LG +  +F+LY PNA 
Sbjct  22   KFLVTINIMGSSGPIRFVVNEKELVSGVIDIALKSYARQGRLPLLGFNAADFLLYYPNAG  81



>ref|XP_008457016.1| PREDICTED: uncharacterized protein LOC103496795 [Cucumis melo]
Length=149

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLY  565
            R LVSI VLGS GP+RFVA+E+DLV  VI T+L  YAR+GRLPILG++++NF LY
Sbjct  24   RFLVSINVLGSTGPVRFVANEDDLVCEVIKTSLTLYARQGRLPILGTNVDNFFLY  78



>ref|XP_009774977.1| PREDICTED: uncharacterized protein At4g22758-like [Nicotiana 
sylvestris]
Length=131

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L+++ VLGSAGP+RFV SEND VA V++ ALK YAREGRLP+LG  +N+F  Y  +A 
Sbjct  12   RFLITVNVLGSAGPLRFVVSENDKVAGVVEIALKQYAREGRLPVLGFHVNDFFFYPASAG  71

Query  581  TE  586
             +
Sbjct  72   LD  73



>ref|XP_006830209.1| hypothetical protein AMTR_s00130p00016510 [Amborella trichopoda]
 gb|ERM97625.1| hypothetical protein AMTR_s00130p00016510 [Amborella trichopoda]
Length=174

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +2

Query  377  KKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNF  556
            KKN  A   +L+SI V  S GP+RF+   +D V +VIDTAL+SYAREGRLP+LG++ NNF
Sbjct  53   KKNQVA-NLMLISINVQESTGPLRFLVRVDDTVGSVIDTALRSYAREGRLPVLGTNFNNF  111

Query  557  VLYCPNA  577
             L+C N+
Sbjct  112  YLHCANS  118



>ref|NP_001046699.1| Os02g0324700 [Oryza sativa Japonica Group]
 dbj|BAD15683.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08613.1| Os02g0324700 [Oryza sativa Japonica Group]
 gb|EAY85624.1| hypothetical protein OsI_06997 [Oryza sativa Indica Group]
 gb|EAZ22820.1| hypothetical protein OsJ_06497 [Oryza sativa Japonica Group]
 dbj|BAG96682.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87438.1| unnamed protein product [Oryza sativa Japonica Group]
Length=152

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R+LV++TVLGSAGP+RF+  E + VA +I  AL+ YAREGR+P+LG+D   F+LY  N  
Sbjct  24   RMLVTVTVLGSAGPLRFLIDEGETVAGLIRAALRCYAREGRMPLLGADAAGFLLYTANGG  83

Query  581  TEGTFTKLFIWF---RSFL  628
            ++       I+F   RSFL
Sbjct  84   SDALSADEKIYFNGCRSFL  102



>ref|XP_006647212.1| PREDICTED: uncharacterized protein LOC102716287 [Oryza brachyantha]
Length=149

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R+LV++TVLGSAGP+RF+  E + VA +I  AL+ YAREGR+P+LG+D   F+LY  N  
Sbjct  22   RMLVTVTVLGSAGPLRFLIDEGETVAGLIRAALRCYAREGRMPLLGADAAGFLLYTANGG  81

Query  581  TEGTFTKLFIWF---RSFL  628
            ++       I+F   RSFL
Sbjct  82   SDALNADEKIYFNGCRSFL  100



>ref|XP_011073847.1| PREDICTED: uncharacterized protein LOC105158703 [Sesamum indicum]
Length=175

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R L++I V GSAGPIRFV +E++    VI+TALK YA++GRLP+LGSD+++F LY  NA 
Sbjct  57   RFLITINVFGSAGPIRFVVNEDETAQGVIETALKLYAKQGRLPVLGSDISSFFLYPVNAG  116

Query  581  TE  586
             E
Sbjct  117  FE  118



>ref|XP_009365234.1| PREDICTED: uncharacterized protein LOC103955087 [Pyrus x bretschneideri]
Length=80

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  380  KNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGR  523
            +N   G RLL+SITV+GSA PIRFV +E +LVAAVIDTALKSYAREGR
Sbjct  10   QNTTKGNRLLISITVIGSADPIRFVVNELELVAAVIDTALKSYAREGR  57



>dbj|BAK06204.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=154

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 62/96 (65%), Gaps = 4/96 (4%)
 Frame = +2

Query  353  KMMFVCKAKKNPAAG-KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLP  529
            K+  V    K  AAG  R+LV++TVLGSAGP+RF+  E + V  +I +AL+ YAREGR+P
Sbjct  12   KLRRVEPRGKAAAAGVARVLVTVTVLGSAGPLRFLVDEGESVNGLIRSALRFYAREGRMP  71

Query  530  ILGSDLNNFVLYCPNAATEGTFTKLFIWF---RSFL  628
            +LG+D  NF+LY  N  ++   +   I F   RSF+
Sbjct  72   LLGADAANFLLYTANGRSDALKSDERISFNGCRSFM  107



>gb|AFW89732.1| senescence-associated protein [Zea mays]
Length=170

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R+LV++TVLGSAGP+RF+  E D VAA+I  AL+ YAREGR+P+LG+D   FVL   N  
Sbjct  28   RVLVTVTVLGSAGPLRFIVLEGDTVAALIRGALRCYAREGRMPLLGTDPAGFVLSTANGG  87

Query  581  T  583
            +
Sbjct  88   S  88



>ref|NP_001150485.1| senescence-associated protein [Zea mays]
 gb|ACG38410.1| senescence-associated protein [Zea mays]
 gb|ACG39253.1| senescence-associated protein [Zea mays]
Length=170

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R+LV++TVLGSAGP+RF+  E D VAA+I  AL+ YAREGR+P+LG+D   FVL   N  
Sbjct  28   RVLVTVTVLGSAGPLRFIVLEGDTVAALIRGALRCYAREGRMPLLGTDPAGFVLSTANGG  87

Query  581  T  583
            +
Sbjct  88   S  88



>ref|XP_010528538.1| PREDICTED: uncharacterized protein LOC104805613 [Tarenaya hassleriana]
Length=147

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R LVS+ VLGSAGP+RF+  E D V+ VIDTAL++YARE R P+LG    NF+LY  ++ 
Sbjct  25   RFLVSVNVLGSAGPLRFLVDEEDEVSVVIDTALRAYAREDRFPVLGLHARNFLLYSASSG  84



>ref|NP_001152495.1| senescence-associated protein [Zea mays]
 gb|ACG47884.1| senescence-associated protein [Zea mays]
Length=175

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R+LV++TVLGSAGP+RF+  E D VAA+I  AL+ YAREGR+P+LG+D   FVL   N  
Sbjct  33   RVLVTVTVLGSAGPLRFIVFEGDTVAALIRGALRCYAREGRMPLLGTDPAGFVLSTANGG  92

Query  581  T  583
            +
Sbjct  93   S  93



>ref|XP_003572714.1| PREDICTED: uncharacterized protein At4g22758-like [Brachypodium 
distachyon]
Length=159

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 52/77 (68%), Gaps = 3/77 (4%)
 Frame = +2

Query  407  LVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATE  586
            LV++TVLGSAGP+RF+  E + V+ ++  AL+ YAREGR+P+LG+D  NF+LY  N  ++
Sbjct  34   LVTVTVLGSAGPLRFLVDEGESVSGLVRAALRCYAREGRMPLLGADAANFLLYTANGRSD  93

Query  587  GTFTKLFIWF---RSFL  628
                   I F   RSF+
Sbjct  94   ALKADERISFNGCRSFM  110



>ref|XP_004952377.1| PREDICTED: uncharacterized protein LOC101766815 [Setaria italica]
Length=161

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 52/79 (66%), Gaps = 3/79 (4%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            R+LV++TVLGSAGP+RF+  E + V  +I  AL+ YAREGR+P+LG+   +F+LY  N  
Sbjct  35   RVLVTVTVLGSAGPLRFLVDEGETVTGLIRAALRCYAREGRMPLLGAAPADFLLYTANGR  94

Query  581  TEGTFTKLFIWF---RSFL  628
            ++       I F   RSFL
Sbjct  95   SDALMADERISFNGCRSFL  113



>gb|EMS64867.1| hypothetical protein TRIUR3_17055 [Triticum urartu]
Length=189

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 3/77 (4%)
 Frame = +2

Query  407  LVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATE  586
            LV++TVLGSAGP+RF+  E + V  +I  AL+ YAREGR+P+LGSD  NF+LY  N  ++
Sbjct  34   LVTVTVLGSAGPLRFLVDEGESVNGLIRAALRCYAREGRMPLLGSDAANFLLYTANGRSD  93

Query  587  GTFTKLFIWF---RSFL  628
                   I F   RSF+
Sbjct  94   ALKADERISFNGCRSFM  110



>dbj|BAB08319.1| unnamed protein product [Arabidopsis thaliana]
Length=109

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +2

Query  389  AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILG  538
               K+LLVS+ VLGS GPIRF+A+E+D V++VI+T LK+YAR+GR+P+LG
Sbjct  3    GENKKLLVSVNVLGSVGPIRFLANEDDEVSSVINTTLKAYARQGRIPVLG  52



>gb|KJB78164.1| hypothetical protein B456_012G181400 [Gossypium raimondii]
Length=78

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +2

Query  359  MFVCKAKKNPAA-GKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPIL  535
            M   + KKN    G +LL+S++VLGS+GPIRFV +E +LV  VID ALKSYAREGR   L
Sbjct  1    MVHNEQKKNQGCKGNKLLISVSVLGSSGPIRFVVNEGELVGTVIDIALKSYAREGRYLFL  60

Query  536  GSDLNNF  556
               L +F
Sbjct  61   DRILMSF  67



>gb|EPS64875.1| hypothetical protein M569_09904 [Genlisea aurea]
Length=116

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +2

Query  371  KAKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLN  550
            K +++  A +R L+ + V GS+GP+RF+ + +D V  VID  L+ YA EGRLP LG D +
Sbjct  38   KVEEDSGASRRFLIVVNVFGSSGPLRFLVNGDDAVETVIDKTLRRYAHEGRLPALGFDSS  97

Query  551  NFVLYCPNA  577
            +F LY  +A
Sbjct  98   DFHLYPSDA  106



>ref|XP_002963924.1| hypothetical protein SELMODRAFT_28561, partial [Selaginella moellendorffii]
 gb|EFJ34257.1| hypothetical protein SELMODRAFT_28561, partial [Selaginella moellendorffii]
Length=74

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  377  KKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNF  556
            +       + LVSI+V+ SAGP+RFV   +D V +VI  AL+ Y  EGR+P LG+D   F
Sbjct  1    QSQHGGSHKFLVSISVVDSAGPLRFVVDSSDTVESVIRHALQEYEHEGRIPPLGTDPRPF  60

Query  557  VLYCPNAATEGTFT  598
             LY  +  +EG  +
Sbjct  61   ELYSAHDISEGNLS  74



>ref|XP_010445453.1| PREDICTED: uncharacterized protein LOC104728122 [Camelina sativa]
Length=135

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 42/58 (72%), Gaps = 1/58 (2%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDL-NNFVLYCP  571
            +LLVSI V GS GPIRFV +E++ V  VID  LK YAR+GRLPI  S   ++F+LY P
Sbjct  28   KLLVSIKVAGSTGPIRFVVNEDESVTNVIDITLKCYARQGRLPIFSSHFTSSFLLYTP  85



>ref|XP_002868302.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44561.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=165

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 44/63 (70%), Gaps = 1/63 (2%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNN-FVLYCPNA  577
            RLLVSI V+GS GPIRFV +E++ V  VID  L+ YAR+GRLP+  S   + F+LY P +
Sbjct  28   RLLVSIKVVGSTGPIRFVVNEDETVTNVIDITLRCYARQGRLPLFSSHSTSFFLLYSPYS  87

Query  578  ATE  586
              +
Sbjct  88   PNQ  90



>ref|XP_002992399.1| hypothetical protein SELMODRAFT_448736 [Selaginella moellendorffii]
 gb|EFJ06549.1| hypothetical protein SELMODRAFT_448736 [Selaginella moellendorffii]
Length=197

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = +2

Query  404  LLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            +LV++TVLGS GP+RF+  + D V  V+DTAL+ YAREGRLP+L   L    LYC N 
Sbjct  84   MLVTVTVLGSPGPLRFLVDKADTVGRVVDTALRVYAREGRLPLLSKQL--VELYCDNG  139



>ref|XP_006830230.1| hypothetical protein AMTR_s00130p00053590 [Amborella trichopoda]
 gb|ERM97646.1| hypothetical protein AMTR_s00130p00053590 [Amborella trichopoda]
Length=135

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 46/72 (64%), Gaps = 5/72 (7%)
 Frame = +2

Query  377  KKNPAAGKRLLVSITVLGSAG-----PIRFVASENDLVAAVIDTALKSYAREGRLPILGS  541
            KK       +L+SI +  S G     P+RF+   +D V  VI TAL+SYAR+GRLP+LG+
Sbjct  39   KKKKEVADLMLISINIHESTGHLLSCPLRFLVRVDDTVFTVIQTALRSYARQGRLPVLGN  98

Query  542  DLNNFVLYCPNA  577
            + ++F LYC N+
Sbjct  99   NSDDFFLYCANS  110



>ref|XP_002967997.1| hypothetical protein SELMODRAFT_440177 [Selaginella moellendorffii]
 gb|EFJ31344.1| hypothetical protein SELMODRAFT_440177 [Selaginella moellendorffii]
Length=167

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +2

Query  374  AKKNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNN  553
            +K       + LVSI+V+ SAGP+RFV   +D V +VI  AL+ Y  EGR+P LG+D   
Sbjct  34   SKSQYGGSHKFLVSISVVDSAGPLRFVVDSSDTVESVIRHALQEYEHEGRIPPLGTDPRP  93

Query  554  FVLYCPNAATEGTFTKLFI  610
            F LY  +  +E    KL I
Sbjct  94   FELYSAHDISEALDDKLRI  112



>gb|EPS58431.1| hypothetical protein M569_16381, partial [Genlisea aurea]
Length=124

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLY  565
            + L+ I VLGS+GP+RF+    D V  VI+ ALK Y REGR+P++G+D ++F+LY
Sbjct  4    KFLIVINVLGSSGPVRFLVRVEDNVKTVIENALKVYRREGRIPVIGTDSDDFLLY  58



>emb|CDP17872.1| unnamed protein product [Coffea canephora]
Length=410

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  407  LVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATE  586
            L++I +LGS GPIRFV +E+D V+  +D A K YA + R P+ GSD+N+F+LY  NA  +
Sbjct  314  LITINILGSTGPIRFVVNEDDTVSEGMDAAQKLYAHQERFPVFGSDVNSFLLYPANAGLD  373

Query  587  G  589
             
Sbjct  374  S  374



>ref|XP_006830208.1| hypothetical protein AMTR_s00130p00015630, partial [Amborella 
trichopoda]
 gb|ERM97624.1| hypothetical protein AMTR_s00130p00015630, partial [Amborella 
trichopoda]
Length=121

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +2

Query  380  KNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGS-DLNNF  556
            KN    + +L+SI V  SAG +R +   +D +  VI TAL+SY+R+GR P+LGS + ++F
Sbjct  39   KNDQVAELMLISIKVQESAGTLRLLVRVDDTIRTVIQTALRSYSRQGRFPVLGSNNFDDF  98

Query  557  VLYCPNA  577
             LYC N+
Sbjct  99   FLYCANS  105



>gb|EPS60022.1| hypothetical protein M569_14782 [Genlisea aurea]
Length=128

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +2

Query  386  PAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLY  565
            P    R LV I V+G  GPI+F+ + +  V +VI+ ALK Y REGR P +GSD NN  LY
Sbjct  48   PDHSNRYLVIINVVGGTGPIKFLVNRDSNVKSVIEKALKIYNREGRHPAIGSDTNNLYLY  107

Query  566  CPNAATEGTFTKLFI  610
              +       T + I
Sbjct  108  PADVIGSDGITHIII  122



>gb|EPS70443.1| hypothetical protein M569_04324 [Genlisea aurea]
Length=167

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 4/76 (5%)
 Frame = +2

Query  356  MMFVCKAKKNPAAGKRLLVSITV-LGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPI  532
            ++  C   K+     + LV+I V   S+GP+RF  S +D V AVID AL+ Y REGR+P+
Sbjct  38   LLLCCNGPKDYT---KFLVTIVVGRSSSGPMRFPVSGDDTVEAVIDKALEVYDREGRVPV  94

Query  533  LGSDLNNFVLYCPNAA  580
            +GSD N FVLY  +  
Sbjct  95   IGSDRNGFVLYSADGG  110



>gb|EPS58433.1| hypothetical protein M569_16383 [Genlisea aurea]
Length=129

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +2

Query  380  KNPAAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFV  559
            K  AAGK L+V + V G + P+RF+ S +D V  VI+  LK YAR G LPILGSD + F 
Sbjct  8    KKSAAGKFLIV-VKVCGRSWPVRFIVSGDDTVKRVIEKTLKQYARLGHLPILGSDSDCFT  66

Query  560  LYCPNAATE  586
            LY P+  T+
Sbjct  67   LY-PSDGTD  74



>ref|XP_002468583.1| hypothetical protein SORBIDRAFT_01g048430 [Sorghum bicolor]
 gb|EER95581.1| hypothetical protein SORBIDRAFT_01g048430 [Sorghum bicolor]
Length=172

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 3/70 (4%)
 Frame = +2

Query  428  GSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATEGTFTKLF  607
            GSAGP+RF+  E D VAA+I  AL+ YAREGR+P+LG+D   FVL   N  +        
Sbjct  41   GSAGPLRFIVLEGDTVAALIRAALRCYAREGRMPLLGTDPAGFVLSTANGGSGALKEDEK  100

Query  608  IWF---RSFL  628
            I F   RSFL
Sbjct  101  ITFNGCRSFL  110



>ref|XP_006849084.1| hypothetical protein AMTR_s00028p00233650 [Amborella trichopoda]
 gb|ERN10665.1| hypothetical protein AMTR_s00028p00233650 [Amborella trichopoda]
Length=101

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (66%), Gaps = 2/64 (3%)
 Frame = +2

Query  392  AGKRLLVSITVL--GSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLY  565
            + KR+ + I+ L   S GP RF+   +D V   I TAL+SY REGRLP LG++ ++F +Y
Sbjct  3    SSKRIKLQISCLFQESTGPPRFLVRVDDTVRTAIQTALRSYPREGRLPFLGNNFDDFFVY  62

Query  566  CPNA  577
            C N+
Sbjct  63   CANS  66



>gb|EPS58560.1| hypothetical protein M569_16253, partial [Genlisea aurea]
Length=70

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 1/58 (2%)
 Frame = +2

Query  407  LVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAA  580
            LV + VLGS GP+ F+ + +D V AV+  +L+ YA EGRLP+LG+D N F L C +A+
Sbjct  11   LVIVNVLGSTGPMIFMVNGDDNVKAVVGKSLRQYAAEGRLPVLGNDSNGFHL-CASAS  67



>ref|XP_002967649.1| hypothetical protein SELMODRAFT_18527, partial [Selaginella moellendorffii]
 gb|EFJ30996.1| hypothetical protein SELMODRAFT_18527, partial [Selaginella moellendorffii]
Length=82

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = +2

Query  398  KRLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLY  565
            K+ LV++TVLGS GP+R V + +  V  V+  AL  YA EGR+P LG     F LY
Sbjct  1    KKTLVTVTVLGSTGPLRMVVTSDATVKEVMKMALLKYAHEGRVPALGRSTREFELY  56



>gb|KHN12462.1| hypothetical protein glysoja_018592 [Glycine soja]
Length=151

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = +2

Query  359  MFVCKAKKNP-AAGKRLLVSITVLGSAGPIRFVASENDLVAAVIDTA  496
            M + K KK+     KRLL+SI VLGSAGPIRFV +E +LVAAVIDTA
Sbjct  1    MLMSKQKKSQIQNAKRLLISINVLGSAGPIRFVVNEEELVAAVIDTA  47



>gb|AFG57723.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57724.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57725.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57726.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57727.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57728.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57729.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57730.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57731.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57732.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57733.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57734.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57735.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57736.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57737.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57738.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
 gb|AFG57739.1| hypothetical protein CL2034Contig1_03, partial [Pinus taeda]
Length=76

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  452  VASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATE  586
            +A E++ V  +I+TALK YAREGRLP+LG +   F LYC N+ TE
Sbjct  1    LAKEDETVLKIIETALKLYAREGRLPVLGYNAKQFELYCANSGTE  45



>ref|XP_008381505.1| PREDICTED: 52 kDa repressor of the inhibitor of the protein kinase-like 
[Malus domestica]
Length=547

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  440  PIRFVASENDLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNA  577
            PIR V  E+DLVA VIDTA  S+A EGRL +LGS++ +F+L+C  A
Sbjct  502  PIRLVVREDDLVARVIDTAFNSHASEGRLRVLGSNVKDFLLHCTYA  547



>gb|EPS58432.1| hypothetical protein M569_16382 [Genlisea aurea]
Length=150

 Score = 53.5 bits (127),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 39/73 (53%), Gaps = 2/73 (3%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGS--DLNNFVLYCPN  574
            R LV I V GS GPI+F+ + +  V  VI+  LK YA EGRLP +GS    +NF L    
Sbjct  49   RFLVIINVYGSTGPIKFLVNGDSAVREVIEKTLKIYASEGRLPAIGSVASADNFSLSAAE  108

Query  575  AATEGTFTKLFIW  613
              +E       +W
Sbjct  109  NGSEVGGGDRVVW  121



>ref|XP_009605387.1| PREDICTED: uncharacterized protein LOC104099956 [Nicotiana tomentosiformis]
Length=119

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  467  DLVAAVIDTALKSYAREGRLPILGSDLNNFVLYCPNAATEGT  592
            D++A  IDTALK YAREGRL + GS++++F LY  NA  + T
Sbjct  20   DVIAGFIDTALKKYAREGRLLVPGSNVDSFFLYPVNAGPDDT  61



>emb|CAC09928.1| hypothetical protein [Catharanthus roseus]
Length=196

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +2

Query  401  RLLVSITVLGSAGPIRFVASENDLVAAVIDTALKSYAREGRLPILGS-DLNNFVLY  565
            +LL+++T++GS GPI+ + S    V  +I  AL+ Y++EGR PIL S D   F L+
Sbjct  78   KLLLNVTIMGSVGPIQVLTSPEATVEDLISAALRQYSKEGRRPILKSTDAAGFDLH  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625