BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF043P15

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           315   2e-99   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       264   5e-80   Ipomoea batatas [batate]
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   261   9e-79   Ipomoea nil [qian niu]
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             261   1e-78   Nicotiana sylvestris
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       261   1e-78   Nicotiana tabacum [American tobacco]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             258   1e-77   Nicotiana tomentosiformis
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       258   1e-77   Nicotiana tabacum [American tobacco]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           255   1e-76   Nicotiana attenuata
dbj|BAA95629.1|  phenylalanine ammonia lyase                            254   4e-76   Catharanthus roseus [chatas]
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       250   1e-74   Ipomoea batatas [batate]
gb|AIY26016.1|  PAL                                                     250   1e-74   Jasminum sambac [Arabian jasmine]
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             249   2e-74   Plectranthus scutellarioides
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                249   7e-74   Erythranthe guttata [common monkey flower]
gb|ACF94719.1|  phenylalanine ammonia lyase                             234   1e-73   Robinia pseudoacacia [black locust]
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            248   1e-73   Lactuca sativa [cultivated lettuce]
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           246   3e-73   Platycodon grandiflorus [balloon-flower]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             246   6e-73   Sesamum indicum [beniseed]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             245   1e-72   Scutellaria viscidula [zhan mao huang qin]
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           244   1e-72   Scutellaria baicalensis [Baikal skullcap]
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            244   1e-72   Melissa officinalis [sweet balm]
gb|ABL14039.1|  phenylalanine ammonia lyase                             233   2e-72   Astragalus mongholicus
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             244   3e-72   Solanum lycopersicum
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   243   6e-72   Rehmannia glutinosa [Chinese foxglove]
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             243   7e-72   Olea europaea
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           243   1e-71   Salvia miltiorrhiza [Chinese salvia]
gb|ABD73282.1|  phenylalanine ammonia-lyase                             242   1e-71   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             242   1e-71   Nelumbo nucifera [Indian lotus]
gb|ABE03772.1|  phenylalanine ammonia-lyase                             241   3e-71   Arnebia euchroma
gb|ABR14606.1|  phenylalanine ammonia-lyase                             241   3e-71   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             241   3e-71   Nicotiana sylvestris
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             241   3e-71   Nelumbo nucifera [Indian lotus]
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    241   4e-71   Lithospermum erythrorhizon
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        241   5e-71   Cicer arietinum [garbanzo]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           240   5e-71   Scutellaria baicalensis [Baikal skullcap]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             240   5e-71   Nicotiana tomentosiformis
gb|AEH02821.1|  phenylalanine ammonia lyase                             240   6e-71   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           240   7e-71   Nicotiana attenuata
ref|XP_007162754.1|  hypothetical protein PHAVU_001G1777001g            233   7e-71   Phaseolus vulgaris [French bean]
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             239   9e-71   Sesamum indicum [beniseed]
gb|AFF60415.1|  phenylalanine ammonia lyase                             238   1e-70   Pyrus pyrifolia [sha li]
gb|AJO53274.1|  phenylalanine ammonia-lyase                             239   1e-70   Pogostemon cablin
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           239   2e-70   
gb|AGL50914.1|  phenylalanine ammonia lyase                             239   2e-70   Pyrus communis
gb|AFG30054.1|  phenylalanine ammonialyase                              239   2e-70   Malus hybrid cultivar
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           239   2e-70   
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       238   3e-70   Digitalis lanata [Grecian foxglove]
gb|AFK43896.1|  unknown                                                 230   3e-70   Medicago truncatula
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           238   3e-70   Coffea canephora [robusta coffee]
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    238   4e-70   Lithospermum erythrorhizon
emb|CAL91170.1|  phenylalanine ammonia-lyase 3                          226   4e-70   Cynara cardunculus var. scolymus [artichoke]
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     238   5e-70   Prunus avium [gean]
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             238   5e-70   Prunus persica
gb|AFP24940.1|  phenylalanine ammonia lyase                             238   5e-70   Prunus salicina [Japanese plum]
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             238   6e-70   Pyrus x bretschneideri [bai li]
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 238   6e-70   Pyrus x bretschneideri [bai li]
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             238   6e-70   Astragalus membranaceus
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        238   7e-70   Solanum tuberosum [potatoes]
gb|KJB16792.1|  hypothetical protein B456_002G248000                    237   8e-70   Gossypium raimondii
gb|AAX84839.1|  phenylalanine ammonia-lyase                             237   9e-70   Astragalus mongholicus
gb|AER12109.1|  PAL                                                     237   9e-70   Gossypium hirsutum [American cotton]
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           237   1e-69   Platycodon grandiflorus [balloon-flower]
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        237   1e-69   Solanum tuberosum [potatoes]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           237   1e-69   Coffea arabica [arabica coffee]
gb|AIL23235.1|  phenylalanine ammonia-lyase                             237   1e-69   Astragalus chrysochlorus
gb|ABB70117.2|  phenylalanine ammonia lyase                             236   2e-69   Pyrus communis
gb|AGL81344.1|  phenylalanine ammonia lyase                             236   2e-69   Pyrus communis
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    236   2e-69   Solanum lycopersicum
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     236   2e-69   Petroselinum crispum
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   236   2e-69   Agastache rugosa
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    236   2e-69   Solanum lycopersicum
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        236   2e-69   
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             236   2e-69   
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           236   2e-69   Prunus domestica
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           236   2e-69   Prunus mume [ume]
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              236   3e-69   Ricinus communis
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             236   3e-69   Perilla frutescens [beefsteak-mint]
gb|ABI33979.1|  phenylalanine ammonia lyase                             236   3e-69   Jatropha curcas
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         236   3e-69   Jatropha curcas
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    236   3e-69   
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      235   4e-69   
gb|ABD42947.1|  phenylalanine ammonia lyase                             235   6e-69   Acacia auriculiformis x Acacia mangium
gb|AGY49231.1|  phenylalanine ammonia lyase                             235   6e-69   Ricinus communis
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             235   6e-69   Gossypium arboreum [tree cotton]
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        235   7e-69   Nicotiana sylvestris
sp|O04058.2|PALY_HELAN  RecName: Full=Phenylalanine ammonia-lyase       234   8e-69   Helianthus annuus
gb|AIA66448.1|  PAL1                                                    234   8e-69   Capsicum annuum
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        235   8e-69   Solanum tuberosum [potatoes]
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    234   8e-69   Petroselinum crispum
gb|KJB36583.1|  hypothetical protein B456_006G166000                    234   8e-69   Gossypium raimondii
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    234   8e-69   Capsicum annuum
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             234   1e-68   Gossypium arboreum [tree cotton]
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            234   1e-68   Lotus japonicus
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     234   1e-68   Petroselinum crispum
gb|ACF94716.1|  phenylalanine ammonia lyase                             234   1e-68   Robinia pseudoacacia [black locust]
gb|AGU91428.1|  phenylalanine ammonia-lyase                             234   1e-68   Chrysanthemum boreale
gb|AHY94892.1|  phenylalanine ammonia lyase                             234   1e-68   Prunella vulgaris
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    234   1e-68   
gb|AIA24411.1|  phenylalanine ammonia-lyase                             234   2e-68   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|AGT63063.1|  phenylalanine ammonia-lyase                             234   2e-68   Solanum tuberosum [potatoes]
gb|KGN48166.1|  hypothetical protein Csa_6G446280                       219   2e-68   
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    234   2e-68   Solanum tuberosum [potatoes]
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        233   2e-68   
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       233   2e-68   
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      233   3e-68   
emb|CAA44609.1|  phenylalanine ammonia-lyase                            221   3e-68   Arabidopsis thaliana [mouse-ear cress]
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     233   4e-68   Glycine max [soybeans]
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          233   4e-68   Cynara cardunculus var. scolymus [artichoke]
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             233   4e-68   Citrus clementina [clementine]
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             233   4e-68   Citrus clementina [clementine]
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   233   4e-68   Trifolium pratense [peavine clover]
gb|AAZ29733.1|  phenylalanine ammonia lyase                             233   4e-68   Trifolium pratense [peavine clover]
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    233   5e-68   Pyrus x bretschneideri [bai li]
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           232   6e-68   Ageratina adenophora
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             232   6e-68   
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       229   6e-68   
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    232   8e-68   
gb|ABL14040.1|  phenylalanine ammonia lyase                             221   8e-68   Astragalus mongholicus
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        232   9e-68   
gb|AGV54597.1|  phenylalanine ammonia-lyase                             232   9e-68   Phaseolus vulgaris [French bean]
gb|AHA42445.1|  phenylalanine ammonia lyase                             228   1e-67   Cannabis sativa
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    231   1e-67   
emb|CDY18463.1|  BnaA04g21240D                                          220   1e-67   Brassica napus [oilseed rape]
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        231   1e-67   Cucumis sativus [cucumbers]
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             231   1e-67   Phaseolus vulgaris [French bean]
gb|KGN52975.1|  hypothetical protein Csa_4G008780                       230   1e-67   
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            231   1e-67   Daucus carota [carrots]
ref|XP_007027354.1|  PHE ammonia lyase 1                                231   2e-67   Theobroma cacao [chocolate]
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        231   2e-67   Cucumis melo [Oriental melon]
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        231   2e-67   Medicago truncatula
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   231   3e-67   Lactuca sativa [cultivated lettuce]
dbj|BAA31258.1|  phenylalanine ammonia-lyase                            221   3e-67   Vitis vinifera
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           230   3e-67   Fragaria vesca subsp. vesca
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       224   4e-67   
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     230   4e-67   Nicotiana tomentosiformis
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              230   4e-67   Ricinus communis
gb|KGN52974.1|  hypothetical protein Csa_4G008770                       228   5e-67   
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           230   5e-67   Ageratina adenophora
gb|AJO53273.1|  phenylalanine ammonia-lyase                             229   6e-67   Pogostemon cablin
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        229   6e-67   Cucumis melo [Oriental melon]
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        229   7e-67   Cucumis melo [Oriental melon]
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        229   7e-67   
gb|AAV98199.1|  phenylalanine ammonialyase 1                            229   7e-67   Petunia x hybrida [garden petunia]
gb|AEC11891.1|  PAL1                                                    229   7e-67   Petunia exserta
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      229   7e-67   
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            229   8e-67   Vigna radiata [mung bean]
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             229   1e-66   Vitis vinifera
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           229   1e-66   Populus tomentosa [Chinese white poplar]
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     229   1e-66   Petroselinum crispum
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            229   1e-66   Daucus carota [carrots]
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             229   1e-66   Citrus clementina [clementine]
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       229   1e-66   Pisum sativum [garden pea]
prf||2001451A  Phe ammonia lyase                                        229   1e-66   Pisum sativum [garden pea]
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    228   1e-66   Solanum lycopersicum
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     229   1e-66   Nicotiana sylvestris
gb|AAR31107.1|  phenylalanine ammonia-lyase                             228   1e-66   Quercus suber [cork oak]
gb|ACT32033.1|  phenylalanine ammonia-lyase                             228   2e-66   Glycine soja [wild soybean]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             228   2e-66   Hibiscus cannabinus [bimli-jute]
gb|AIB06732.1|  phenylalanine ammonia lyase                             228   2e-66   Mangifera indica
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   228   2e-66   Citrus sinensis [apfelsine]
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            228   2e-66   Gynura bicolor
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       228   2e-66   Citrus limon [lemon]
gb|AHA42443.1|  phenylalanine ammonia lyase                             228   2e-66   Cannabis sativa
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    228   2e-66   Solanum tuberosum [potatoes]
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           228   2e-66   Astragalus membranaceus
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     228   2e-66   Nicotiana tomentosiformis
emb|CBI31445.3|  unnamed protein product                                226   2e-66   Vitis vinifera
gb|AER58180.1|  phenylalanine ammonia lyase                             228   3e-66   Cucumis sativus [cucumbers]
gb|AEA72280.1|  phenylalanine ammonia-lyase                             228   3e-66   Angelica gigas
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    228   3e-66   
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        228   3e-66   
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        228   3e-66   
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             228   3e-66   Gossypium arboreum [tree cotton]
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             228   3e-66   Cucumis melo [Oriental melon]
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      227   4e-66   
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       227   4e-66   
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    228   4e-66   
emb|CDX91331.1|  BnaC04g08190D                                          220   4e-66   
emb|CDX74991.1|  BnaA05g07370D                                          219   5e-66   
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            227   5e-66   Lotus japonicus
gb|ADO64252.1|  PAL                                                     226   7e-66   Epimedium sagittatum
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                227   7e-66   Medicago truncatula
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         226   9e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          226   1e-65   Vitis vinifera
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                226   1e-65   Medicago truncatula
gb|AAA34179.2|  phenylalanine ammonia lyase                             226   1e-65   Solanum lycopersicum
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   226   1e-65   Populus tremuloides
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         226   1e-65   Jatropha curcas
gb|AEX32784.1|  phenylalanine ammonia-lyase                             226   2e-65   Vitis vinifera
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        226   2e-65   Cucumis melo [Oriental melon]
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            225   2e-65   Lotus japonicus
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             226   2e-65   Vitis vinifera
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    226   2e-65   Rubus idaeus [European raspberry]
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                226   2e-65   Erythranthe guttata [common monkey flower]
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             225   2e-65   Populus tomentosa [Chinese white poplar]
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      225   2e-65   Cucumis melo [Oriental melon]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             225   2e-65   Euphorbia pulcherrima
gb|ACT21093.1|  phenylalanine ammonia-lyase                             225   2e-65   Camellia oleifera [abura-tsubaki]
gb|ACM44926.1|  phenylalanine ammonia-lyase                             225   2e-65   Euphorbia pulcherrima
gb|ABM67591.1|  phenylalanin ammonia-lyase                              225   2e-65   Vitis vinifera
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     225   3e-65   Daucus carota [carrots]
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        225   3e-65   Cucumis melo [Oriental melon]
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 225   3e-65   Rubus idaeus [European raspberry]
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       225   3e-65   Populus trichocarpa [western balsam poplar]
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            225   3e-65   Lotus japonicus
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             225   3e-65   Populus tomentosa [Chinese white poplar]
gb|ACE95170.1|  phenylalanine ammonia-lyase                             225   3e-65   Populus tomentosa [Chinese white poplar]
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         224   4e-65   Populus trichocarpa [western balsam poplar]
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             224   4e-65   Vitis vinifera
gb|AFU90757.1|  phenylalanine ammonia-lyase                             224   5e-65   Epimedium sagittatum
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      224   5e-65   Cucumis sativus [cucumbers]
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    224   5e-65   Populus sieboldii x Populus grandidentata
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       224   6e-65   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             224   7e-65   Vitis vinifera
gb|AJO53272.1|  phenylalanine ammonia-lyase                             224   7e-65   Pogostemon cablin
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        224   7e-65   
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        224   8e-65   Vitis vinifera
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        224   9e-65   Cicer arietinum [garbanzo]
gb|ACM62741.1|  phenylalanine ammonia-lyase                             224   1e-64   Garcinia mangostana [mangosteen]
ref|XP_004173742.1|  PREDICTED: phenylalanine ammonia-lyase-like        208   1e-64   
gb|AEJ88223.1|  phenylalanine ammonia lyase                             223   1e-64   Prunus persica
emb|CBI26455.3|  unnamed protein product                                223   2e-64   Vitis vinifera
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             223   2e-64   Gossypium arboreum [tree cotton]
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             223   2e-64   Vitis vinifera
gb|KJB62426.1|  hypothetical protein B456_009G416300                    223   2e-64   Gossypium raimondii
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        223   2e-64   Vitis vinifera
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 223   2e-64   Manihot esculenta [manioc]
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        223   2e-64   Vitis vinifera
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         223   2e-64   Populus trichocarpa [western balsam poplar]
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   223   2e-64   Populus tremuloides
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 223   2e-64   Manihot esculenta [manioc]
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          223   2e-64   Populus euphratica
gb|KJB46525.1|  hypothetical protein B456_007G373600                    223   2e-64   Gossypium raimondii
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        223   2e-64   Populus euphratica
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      223   2e-64   Citrus sinensis [apfelsine]
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      223   3e-64   
gb|AGH13333.1|  phenylalanine ammonia-lyase                             222   3e-64   Rhus chinensis
gb|AAW78932.1|  phenylalanine-ammonia lyase                             222   3e-64   Rhodiola sachalinensis
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    222   3e-64   
gb|ACC63889.1|  phenylalanine ammonia-lyase                             222   3e-64   Populus trichocarpa [western balsam poplar]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             222   3e-64   Populus szechuanica
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         222   3e-64   Populus trichocarpa [western balsam poplar]
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       222   3e-64   Trifolium subterraneum
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           222   3e-64   Manihot esculenta [manioc]
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       222   4e-64   Camellia sinensis [black tea]
gb|ADD12041.1|  phenylalanine ammonia lyase                             222   4e-64   Cistanche deserticola
gb|AGE10589.1|  phenylalanine amononia-lyase                            222   4e-64   Lonicera japonica [Japanese honeysuckle]
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     222   4e-64   Solanum tuberosum [potatoes]
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         222   4e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAC18870.1|  phenylalanine ammonia lyase                             222   4e-64   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ29735.1|  phenylalanine ammonia lyase                             222   4e-64   Trifolium pratense [peavine clover]
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         222   5e-64   Populus euphratica
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             221   5e-64   Phaseolus vulgaris [French bean]
gb|ADY02661.1|  phenylalanine ammonia lyase                             221   6e-64   Parrya nudicaulis
sp|P31426.1|PAL2_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 2     219   7e-64   Solanum tuberosum [potatoes]
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             221   7e-64   Camellia japonica [common camellia]
gb|AAU08174.1|  phenylalanine ammonia-lyase                             221   8e-64   Camellia sinensis [black tea]
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        221   8e-64   
gb|ADY02662.1|  phenylalanine ammonia lyase                             221   8e-64   Parrya nudicaulis
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          221   9e-64   Cynara cardunculus var. scolymus [artichoke]
emb|CAN77065.1|  hypothetical protein VITISV_009233                     221   9e-64   Vitis vinifera
gb|ADT63058.1|  phenylalanine ammonia-lyase                             221   9e-64   Fagopyrum esculentum
gb|ADY02660.1|  phenylalanine ammonia lyase                             221   9e-64   Parrya nudicaulis
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        221   1e-63   Cucumis melo [Oriental melon]
gb|AEX32790.1|  phenylalanine ammonia-lyase                             221   1e-63   Vitis vinifera
gb|ABN79671.2|  phenylalanine ammonia-lyase                             221   1e-63   Rudbeckia hirta
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            221   1e-63   Populus sieboldii x Populus grandidentata
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             220   1e-63   Populus euphratica
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        220   1e-63   Phoenix dactylifera
gb|ACA30407.1|  phenylalanine ammonia-lyase                             220   1e-63   Stylosanthes guianensis [stylo]
gb|AAZ29732.1|  phenylalanine ammonia lyase                             220   2e-63   Trifolium pratense [peavine clover]
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        220   2e-63   Vitis vinifera
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             220   2e-63   
gb|AAQ74878.1|  phenylalanine ammonia lyase                             220   2e-63   Populus trichocarpa x Populus deltoides
gb|ABC69916.1|  phenylalanine ammonia-lyase                             220   3e-63   Brassica napus [oilseed rape]
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      220   3e-63   Camelina sativa [gold-of-pleasure]
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    220   3e-63   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|ACG56648.1|  phenylalanine ammonia lyase                             219   3e-63   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      220   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           219   3e-63   Brassica rapa
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           219   3e-63   
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    219   3e-63   
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       219   3e-63   
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           219   3e-63   
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             219   3e-63   
gb|ACG56647.1|  phenylalanine ammonia lyase                             219   3e-63   
gb|AAZ29734.1|  phenylalanine ammonia lyase                             219   3e-63   
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           219   4e-63   
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             219   4e-63   
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       219   5e-63   
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        219   6e-63   
gb|ADA81868.1|  phenylalanine ammonia-lyase                             219   6e-63   
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            218   7e-63   
gb|ABC69917.1|  phenylalanine ammonia-lyase                             219   7e-63   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             219   8e-63   
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            218   9e-63   
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        218   1e-62   
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             218   1e-62   
gb|ACR15762.1|  phenylalanine ammonia-lyase                             218   1e-62   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    218   1e-62   
gb|AEE81750.1|  phenylalanine ammonia lyase                             218   1e-62   
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             218   2e-62   
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    218   2e-62   
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      218   2e-62   
prf||2006271A  Phe ammonia lyase                                        218   2e-62   
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             218   2e-62   
gb|AID16077.1|  phenylalanine ammonium lyase                            218   2e-62   
emb|CDO99754.1|  unnamed protein product                                216   2e-62   
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      217   3e-62   
gb|ABI93975.1|  putative phenylalanine ammonia-lyase                    214   3e-62   
gb|KJB73539.1|  hypothetical protein B456_011G238400                    216   4e-62   
gb|AGE10591.1|  phenylalanine amononia-lyase                            216   4e-62   
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             216   4e-62   
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           216   4e-62   
gb|ABF50788.1|  phenylalanine ammonia-lyase                             216   5e-62   
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           216   5e-62   
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        216   5e-62   
gb|AFP49806.1|  phenylalanine ammonialyase 1                            216   5e-62   
emb|CAB42793.1|  phenylalanine-ammonia lyase                            216   6e-62   
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        216   6e-62   
gb|AHB18375.1|  phenylalanine ammonia-lyase 3                           215   7e-62   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             216   7e-62   
gb|AAM12956.1|  phenylalanine ammonia-lyase                             216   7e-62   
ref|XP_004173741.1|  PREDICTED: phenylalanine ammonia-lyase-like        201   9e-62   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        215   1e-61   
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    215   1e-61   
gb|KCW65428.1|  hypothetical protein EUGRSUZ_G02848                     215   1e-61   
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             215   1e-61   
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             215   1e-61   
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            214   1e-61   
ref|XP_004173912.1|  PREDICTED: phenylalanine ammonia-lyase-like        204   2e-61   
gb|AFI71896.1|  phenylalanine ammonia-lyase                             214   2e-61   
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           214   2e-61   
gb|ADN32766.1|  phenylalanine ammonia-lyase                             214   2e-61   
gb|AAC18871.1|  phenylalanine ammonia lyase                             214   3e-61   
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         214   3e-61   
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           214   3e-61   
gb|AFP49807.1|  phenylalanine ammonialyase 4                            213   6e-61   
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      213   6e-61   
gb|ADP88940.1|  phenylalanine ammonia-lyase                             198   6e-61   
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             213   7e-61   
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   213   8e-61   
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             213   9e-61   
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      213   1e-60   
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             211   1e-60   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           212   2e-60   
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           212   2e-60   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             212   2e-60   
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      212   2e-60   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        212   2e-60   
gb|ADI40166.1|  phenylalanine ammonia-lyase                             212   2e-60   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        211   3e-60   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             211   3e-60   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           211   3e-60   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             211   4e-60   
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 211   4e-60   
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      211   5e-60   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           211   5e-60   
ref|XP_008449235.1|  PREDICTED: phenylalanine ammonia-lyase-like        211   6e-60   
emb|CDY66761.1|  BnaCnng52250D                                          207   7e-60   
emb|CDX76219.1|  BnaA04g04830D                                          207   7e-60   
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      210   8e-60   
ref|XP_009384657.1|  PREDICTED: phenylalanine ammonia-lyase-like        210   1e-59   
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             209   1e-59   
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        209   2e-59   
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             209   2e-59   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           209   2e-59   
gb|AAX22055.1|  phenylalanine ammonia-lyase                             209   3e-59   
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            209   3e-59   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            209   3e-59   
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             208   4e-59   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        208   6e-59   
ref|XP_006424536.1|  hypothetical protein CICLE_v10029946mg             193   6e-59   
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            208   7e-59   
gb|AAX22053.1|  phenylalanine ammonia-lyase                             208   7e-59   
emb|CAN61378.1|  hypothetical protein VITISV_032212                     207   7e-59   
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 207   8e-59   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    207   9e-59   
ref|XP_004143260.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    205   1e-58   
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            207   1e-58   
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        207   1e-58   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             206   2e-58   
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    206   2e-58   
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    206   2e-58   
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    206   2e-58   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             206   2e-58   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             206   2e-58   
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        206   3e-58   
gb|KGN48167.1|  hypothetical protein Csa_6G446290                       205   5e-58   
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           205   5e-58   
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             204   1e-57   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        204   2e-57   
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         204   2e-57   
emb|CDY00922.1|  BnaC05g42780D                                          204   2e-57   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             204   2e-57   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           204   2e-57   
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             204   2e-57   
emb|CDY08611.1|  BnaA05g28470D                                          204   2e-57   
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        204   2e-57   
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        203   2e-57   
gb|AIZ76766.1|  PAL2                                                    198   2e-57   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             204   2e-57   
gb|EMT29667.1|  Phenylalanine ammonia-lyase                             194   3e-57   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             203   3e-57   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             203   3e-57   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             203   4e-57   
ref|XP_008645952.1|  PREDICTED: phenylalanine ammonia-lyase             202   4e-57   
emb|CAA33500.1|  unnamed protein product                                189   4e-57   
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        202   5e-57   
gb|EYU39613.1|  hypothetical protein MIMGU_mgv1a019971mg                202   5e-57   
ref|XP_004953157.1|  PREDICTED: phenylalanine ammonia-lyase-like        202   6e-57   
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      202   6e-57   
ref|XP_004976241.1|  PREDICTED: phenylalanine ammonia-lyase-like        202   7e-57   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             202   8e-57   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           202   8e-57   
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    202   8e-57   
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    202   8e-57   
dbj|BAM28968.1|  phenylalanine ammonia lyase                            202   9e-57   
ref|XP_004953155.1|  PREDICTED: phenylalanine ammonia-lyase-like        202   1e-56   
ref|XP_004953156.1|  PREDICTED: phenylalanine ammonia-lyase-like        202   1e-56   
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             201   1e-56   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             201   1e-56   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             201   1e-56   
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           201   1e-56   
gb|AGZ95691.1|  phenylalanine ammonia-lyase                             201   2e-56   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        201   2e-56   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              201   2e-56   
ref|NP_001168086.1|  phenylalanine ammonia-lyase                        201   2e-56   
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      201   3e-56   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             200   3e-56   
gb|AEW25915.1|  phenylalanine ammonia-lyase                             186   4e-56   
gb|AEW25882.1|  phenylalanine ammonia-lyase                             186   5e-56   
ref|XP_006647543.1|  PREDICTED: phenylalanine ammonia-lyase-like        200   5e-56   
gb|AEW25883.1|  phenylalanine ammonia-lyase                             186   5e-56   
gb|AEW25886.1|  phenylalanine ammonia-lyase                             186   5e-56   
gb|AEW25884.1|  phenylalanine ammonia-lyase                             186   5e-56   
emb|CDY13306.1|  BnaC06g14510D                                          188   5e-56   
gb|AHB18376.1|  phenylalanine ammonia-lyase 4                           199   5e-56   
gb|AEW25889.1|  phenylalanine ammonia-lyase                             185   6e-56   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             199   6e-56   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        199   6e-56   
gb|AEW25888.1|  phenylalanine ammonia-lyase                             185   7e-56   
gb|AEW25885.1|  phenylalanine ammonia-lyase                             185   9e-56   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       199   1e-55   
gb|AGE10590.1|  phenylalanine amononia-lyase                            199   1e-55   
ref|XP_010112228.1|  Phenylalanine ammonia-lyase                        199   1e-55   
gb|AEW25919.1|  phenylalanine ammonia-lyase                             184   2e-55   
gb|AIC66437.1|  phenylalanine ammonia lyase                             197   5e-55   
gb|AEW25894.1|  phenylalanine ammonia-lyase                             183   5e-55   
gb|AEW25903.1|  phenylalanine ammonia-lyase                             183   5e-55   
gb|ACZ36441.1|  phenylalanine ammonialyase                              197   6e-55   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             196   6e-55   
gb|AEW25890.1|  phenylalanine ammonia-lyase                             182   7e-55   
gb|AEW25906.1|  phenylalanine ammonia-lyase                             182   7e-55   
ref|XP_006846821.1|  hypothetical protein AMTR_s00148p00088930          196   9e-55   
emb|CAA89007.1|  phenylalanine ammonia-lyase                            194   1e-54   
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    196   1e-54   
ref|XP_007143725.1|  hypothetical protein PHAVU_007G096100g             196   1e-54   
ref|XP_010662173.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      184   1e-54   
gb|AFR41032.1|  phenylalanine ammonia-lyase                             181   2e-54   
gb|AFR41029.1|  phenylalanine ammonia-lyase                             181   2e-54   
gb|AFR41033.1|  phenylalanine ammonia-lyase                             181   4e-54   
emb|CDX67566.1|  BnaA07g16060D                                          191   5e-54   
gb|AFR41030.1|  phenylalanine ammonia-lyase                             181   5e-54   
ref|XP_004953154.1|  PREDICTED: phenylalanine ammonia-lyase-like        194   7e-54   
dbj|BAJ88975.1|  predicted protein                                      194   7e-54   
ref|NP_001047482.1|  Os02g0626400                                       193   1e-53   
ref|XP_002454200.1|  hypothetical protein SORBIDRAFT_04g026530          193   2e-53   
emb|CAA44817.1|  phenylalanine ammonia-lyase                            179   2e-53   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             192   2e-53   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             192   2e-53   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          191   4e-53   
ref|XP_002452479.1|  hypothetical protein SORBIDRAFT_04g026560          191   4e-53   
gb|AFR41042.1|  phenylalanine ammonia-lyase                             178   5e-53   
gb|EMT28134.1|  Phenylalanine ammonia-lyase                             191   5e-53   
emb|CDX78161.1|  BnaA09g33560D                                          188   7e-53   
gb|AFR41018.1|  phenylalanine ammonia-lyase                             177   7e-53   
emb|CAA44818.1|  phenylalanine ammonia-lyase                            177   1e-52   
gb|ADO24189.1|  phenylalanine ammonia-lyase                             190   1e-52   
emb|CDX73567.1|  BnaC08g24360D                                          187   1e-52   
ref|XP_007016787.1|  PHE ammonia lyase 1                                190   1e-52   
ref|XP_006354305.1|  PREDICTED: phenylalanine ammonia-lyase-like        190   2e-52   
gb|AFR41056.1|  phenylalanine ammonia-lyase                             176   3e-52   
gb|AFR41020.1|  phenylalanine ammonia-lyase                             176   4e-52   
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    188   5e-52   
ref|XP_002454199.1|  hypothetical protein SORBIDRAFT_04g026520          188   7e-52   
gb|ADD74179.1|  phenylalanine ammonia lyase                             185   7e-52   
gb|ACZ44833.1|  phenylalanine ammonia-lyase                             188   9e-52   
gb|AFR41036.1|  phenylalanine ammonia-lyase                             174   2e-51   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            187   2e-51   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            187   2e-51   
dbj|BAF96940.1|  phenylalanine ammonia lyase                            182   2e-51   
gb|AFR41048.1|  phenylalanine ammonia-lyase                             173   3e-51   
dbj|BAM28963.1|  phenylalanine ammonia lyase                            186   3e-51   
gb|AFR41022.1|  phenylalanine ammonia-lyase                             173   3e-51   
sp|Q43210.1|PALY_WHEAT  RecName: Full=Phenylalanine ammonia-lyase       186   4e-51   
gb|ACM47229.1|  phenylalanine ammonia-lyase                             186   5e-51   
gb|EMT28136.1|  Phenylalanine ammonia-lyase                             186   5e-51   
gb|ACM45574.1|  phenylalanine ammonia-lyase                             186   5e-51   
gb|AAR24505.1|  phenylalanine ammonia-lyase                             186   5e-51   
gb|AFX98072.1|  phenylalanine ammonia lyase                             186   6e-51   



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 150/152 (99%), Positives = 151/152 (99%), Gaps = 0/152 (0%)
 Frame = +1

Query  187  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            MEGAIENGH+NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ
Sbjct  1    MEGAIENGHTNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  60

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAAIAARDNAVKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA
Sbjct  61   VAAIAARDNAVKVELSEAARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  120

Query  547  LQQELIRFLNAGIFGTGTGHTLPHSATRAAML  642
            LQQELIRFLNAGIFGTGTGHTLPHSATRAAML
Sbjct  121  LQQELIRFLNAGIFGTGTGHTLPHSATRAAML  152



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 136/154 (88%), Gaps = 3/154 (2%)
 Frame = +1

Query  187  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            MEGAI NGH+NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  +
Sbjct  1    MEGAIANGHTNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTSLR  60

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
               IAARDNA K   S    A  ++SSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA
Sbjct  61   SPPIAARDNASKWS-SPRLPARRESSSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  119

Query  547  LQQELIRFLNAGIFGTGTG--HTLPHSATRAAML  642
            LQQELIRFLNAGIFGTGTG  HTLPHSATRAAML
Sbjct  120  LQQELIRFLNAGIFGTGTGASHTLPHSATRAAML  153



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   261 bits (667),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 135/148 (91%), Gaps = 2/148 (1%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            NGH N FC+KVDPLNWE+AADSL+GSHLDEVK MVAEFR PAVK+GG+TLTVAQVAAIA+
Sbjct  9    NGHQNGFCVKVDPLNWEVAADSLRGSHLDEVKVMVAEFRKPAVKLGGETLTVAQVAAIAS  68

Query  385  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
            RDNAV VELSE +RAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  69   RDNAVTVELSEESRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELI  128

Query  565  RFLNAGIFGTGT--GHTLPHSATRAAML  642
            RFLNAGIFG GT   HTLPHSATRAAML
Sbjct  129  RFLNAGIFGNGTESCHTLPHSATRAAML  156



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 139/157 (89%), Gaps = 5/157 (3%)
 Frame = +1

Query  187  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  364  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            QVAAIAA+DNA  VKVELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAML
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAML  157



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 139/157 (89%), Gaps = 5/157 (3%)
 Frame = +1

Query  187  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  364  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            QVAAIAA+DNA  VKVELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAML
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAML  157



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 137/157 (87%), Gaps = 5/157 (3%)
 Frame = +1

Query  187  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCMKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  364  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            QVAAIAA+DN   VKVELSEGARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKN  120

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAML
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAML  157



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/157 (82%), Positives = 137/157 (87%), Gaps = 5/157 (3%)
 Frame = +1

Query  187  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCMKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  364  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            QVAAIAA+DN   VKVELSEGARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKN  120

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAML
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAML  157



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   255 bits (652),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 137/157 (87%), Gaps = 5/157 (3%)
 Frame = +1

Query  187  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK MVAE+R P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKIMVAEYRKPVVKLGGETLTVA  60

Query  364  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            QVAAIAA+DNA  V VELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNAKTVTVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLNAG+FG GT   HTLP S TRAAML
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQSGTRAAML  157



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 137/158 (87%), Gaps = 9/158 (6%)
 Frame = +1

Query  193  GAIENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            G+ ENGH N     DFC+K DPLNW MAADSLKGSHLDEVKRMVAEFR P VK+GG+TLT
Sbjct  5    GSTENGHINNGEVLDFCLK-DPLNWGMAADSLKGSHLDEVKRMVAEFRKPVVKLGGETLT  63

Query  358  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            ++QVAAIAARD NAVKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  64   ISQVAAIAARDYNAVKVELSEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  123

Query  535  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  124  QGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAML  161



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/150 (83%), Positives = 132/150 (88%), Gaps = 5/150 (3%)
 Frame = +1

Query  208  GHSNDFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  378
             + N FCIK   VDPLNWEMAA+SL+GSHLDEVKRMVAEFR PAVK+GG+TLTVAQVA I
Sbjct  2    ANQNGFCIKKQQVDPLNWEMAAESLRGSHLDEVKRMVAEFRKPAVKLGGETLTVAQVARI  61

Query  379  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  558
            A+RDNAV VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  62   ASRDNAVAVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  121

Query  559  LIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LIRFLNAGIFG  T   HTLPHSATRAAML
Sbjct  122  LIRFLNAGIFGNATESCHTLPHSATRAAML  151



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 135/158 (85%), Gaps = 7/158 (4%)
 Frame = +1

Query  187  MEGAIENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            ME A++N  SN    DFC+K DPLNW MAA++LKGSHLDEVKRMV EFR P VK+GG+TL
Sbjct  1    MEIALQNSDSNGKSMDFCVK-DPLNWGMAAEALKGSHLDEVKRMVEEFRKPVVKLGGETL  59

Query  355  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            TV+QVAAIAARDNAV VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60   TVSQVAAIAARDNAVTVELSETARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  119

Query  535  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAML  157



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 134/156 (86%), Gaps = 4/156 (3%)
 Frame = +1

Query  187  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            M  A ENGH SN FC+K  DPLNW  AA++L+GSHLDEVK+MV EFR PAVK+GG+TLT+
Sbjct  1    MAAATENGHQSNGFCVKQNDPLNWAAAAEALQGSHLDEVKKMVEEFRKPAVKLGGETLTI  60

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            AQVAAIAARDNAV VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIAARDNAVAVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  541  HALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
             ALQ ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  GALQTELIRFLNAGIFGKGTETCHTLPHSATRAAML  156



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   249 bits (636),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 135/155 (87%), Gaps = 6/155 (4%)
 Frame = +1

Query  196  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            A ENGH    N FC++  DPLNW MAA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT++
Sbjct  82   AAENGHHAAGNGFCVQQNDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVKLGGETLTIS  141

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIAARDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G 
Sbjct  142  QVAAIAARDNAVAVELNESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGG  201

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  202  ALQKELIRFLNAGIFGNGTESNHTLPHSATRAAML  236



>gb|ACF94719.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=210

 Score =   234 bits (596),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 129/161 (80%), Gaps = 7/161 (4%)
 Frame = +1

Query  181  TTMEGAIENGHSNDFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGG  345
            T +      G +   C+K      DPLNW +AA+S+KGSHLDEVKRMV E+RNP V+IGG
Sbjct  4    TRVSNGYHQGQNGSLCLKSNNTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIGG  63

Query  346  QTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  525
            +TLT++QVAAIA RD    +ELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR
Sbjct  64   ETLTISQVAAIATRDQDASLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  123

Query  526  RTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            RTK G ALQ+ELIRFLNAGIFG G  + HTLPHSATRAAML
Sbjct  124  RTKQGGALQKELIRFLNAGIFGNGAVSCHTLPHSATRAAML  164



>gb|AAO13347.1| phenylalanine ammonia-lyase2 [Lactuca sativa]
Length=713

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +1

Query  202  ENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  381
            +NG   +FC+K DPLNW MAA+SLKGSHLDEVKRMVAEFR P V++GG+TLTV+QVAAIA
Sbjct  12   QNGERAEFCVKGDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVRLGGETLTVSQVAAIA  71

Query  382  ARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  558
            A DNA VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  72   ASDNAGVKVELSETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKE  131

Query  559  LIRFLNAGIFGTGTG--HTLPHSATRAAML  642
            LIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  132  LIRFLNAGIFGNGTESTHTLPHSATRAAML  161



>gb|AEM63670.1| phenylalanine ammonia lyase 1 [Platycodon grandiflorus]
Length=710

 Score =   246 bits (629),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 132/153 (86%), Gaps = 6/153 (4%)
 Frame = +1

Query  199  IENGHSND---FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            IENG  N+   FCIK DPLNW + A+SLKGSHL+EVKRMVAEFR P VK+GG+TLTV+QV
Sbjct  6    IENGQVNEAIEFCIK-DPLNWGVTAESLKGSHLNEVKRMVAEFRKPVVKLGGETLTVSQV  64

Query  370  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  549
            A IAARDN VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  65   AGIAARDNGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  550  QQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            Q+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  125  QKELIRFLNAGIFGNGTESSHTLPHSATRAAML  157



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   246 bits (627),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 134/157 (85%), Gaps = 5/157 (3%)
 Frame = +1

Query  187  MEGAIENGH-SNDFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            M  A ENGH SN FC++   DPLNW  AA++LKGSHLDEVKRMV EFR P VK+GG+TLT
Sbjct  1    MAAATENGHHSNGFCVQKQKDPLNWGAAAEALKGSHLDEVKRMVEEFRKPVVKLGGETLT  60

Query  358  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            ++QVAAIA+RDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  61   ISQVAAIASRDNAVAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  120

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  121  GGALQKELIRFLNAGIFGQGTESCHTLPHSATRAAML  157



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 135/156 (87%), Gaps = 4/156 (3%)
 Frame = +1

Query  187  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            M  A+E  H SN FC+++ DPLNW  AA++LKGSHLDEVKRMV EFRNP VKIGG+ LT+
Sbjct  1    MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTI  60

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  121  GALQKELIRFLNAGIFGKGTEGCHTLPHTATRAAML  156



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 135/156 (87%), Gaps = 4/156 (3%)
 Frame = +1

Query  187  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            M  A+E  H SN FC+++ DPLNW  AA++LKGSHLDEVKRMV EFRNP VKIGG+ LT+
Sbjct  1    MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTI  60

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  121  GALQKELIRFLNAGIFGKGTEGCHTLPHTATRAAML  156



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   244 bits (624),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 132/152 (87%), Gaps = 5/152 (3%)
 Frame = +1

Query  202  ENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            ENGH  SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++QVA
Sbjct  3    ENGHHDSNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTISQVA  62

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIAA+DNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  63   AIAAKDNAVAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  122

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLNAGIFG G  T HTLPH+ATRAAML
Sbjct  123  KELIRFLNAGIFGNGTETNHTLPHTATRAAML  154



>gb|ABL14039.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 131/163 (80%), Gaps = 11/163 (7%)
 Frame = +1

Query  187  MEGAIENGHSN------DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  339
            ME    NGH++      + CI     DPLNW +AA++LKGS LDEVKRMV E+RNP VKI
Sbjct  1    MEAVGANGHASSTANEAELCISKAGGDPLNWAVAAEALKGSLLDEVKRMVEEYRNPVVKI  60

Query  340  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  519
            GG+TLT++QVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTISQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  520  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            HRRTK G ALQ+E IRFLNAGIFG GT   +TLPHSATRAAML
Sbjct  121  HRRTKQGGALQKEFIRFLNAGIFGNGTESNYTLPHSATRAAML  163



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 132/156 (85%), Gaps = 4/156 (3%)
 Frame = +1

Query  187  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            M G I      DFCIKVDPLNWEMAA+SL+GSHLDEVK+MVAEFR P VK+GG+TLTVAQ
Sbjct  1    MAGVINGQQDLDFCIKVDPLNWEMAAESLRGSHLDEVKKMVAEFRKPVVKLGGETLTVAQ  60

Query  367  VAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            VA++AA+ N   VKVEL E ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTKNG
Sbjct  61   VASVAAKVNVENVKVELCEDARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKNG  120

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAG+FG GT   HTLP S+TRAAML
Sbjct  121  GALQKELIRFLNAGVFGNGTESCHTLPQSSTRAAML  156



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 132/154 (86%), Gaps = 6/154 (4%)
 Frame = +1

Query  199  IENGH--SNDFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            +ENGH  SN  C++   DPLNW  AA+SLKGSHLDEVKRMV EFR PAVK+GG++LT+AQ
Sbjct  1    MENGHHHSNGLCVETTRDPLNWVAAAESLKGSHLDEVKRMVEEFRKPAVKLGGESLTIAQ  60

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAAIAARDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  61   VAAIAARDNAVAVELAETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  120

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   H LPHSATRAAML
Sbjct  121  LQKELIRFLNAGIFGNGTESNHALPHSATRAAML  154



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   243 bits (619),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 133/154 (86%), Gaps = 7/154 (5%)
 Frame = +1

Query  199  IENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            +ENGHS+    +FCI+ DPLNW  AA+SLKGSHLDE+KRMV EFR P VK+GG+TLT++Q
Sbjct  6    VENGHSSGKLLNFCIE-DPLNWGTAAESLKGSHLDELKRMVEEFRKPVVKLGGETLTISQ  64

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAAIA+RDNAVKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  65   VAAIASRDNAVKVELAEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  124

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT     LPHSATRAAML
Sbjct  125  LQKELIRFLNAGIFGNGTESSQALPHSATRAAML  158



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 137/160 (86%), Gaps = 5/160 (3%)
 Frame = +1

Query  175  FNTTMEGAIENGHS-NDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  348
            F T++  A ENGHS N FC+K  DPLNW  AA++L+GSHLD VKRMV EFR PAVK+GG+
Sbjct  47   FTTSIMAA-ENGHSENGFCVKQSDPLNWAAAAEALQGSHLDAVKRMVEEFRKPAVKLGGE  105

Query  349  TLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  528
            TLT+AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRR
Sbjct  106  TLTIAQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRR  165

Query  529  TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            TK G ALQ+ELIRFLNAGIFG GT   HTLPHS+TRAAML
Sbjct  166  TKQGGALQKELIRFLNAGIFGNGTESNHTLPHSSTRAAML  205



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 133/155 (86%), Gaps = 6/155 (4%)
 Frame = +1

Query  196  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            A ENGH   SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++
Sbjct  2    AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIS  61

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIAA+DNAV VEL+E +RAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  62   QVAAIAAKDNAVAVELAESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGG  121

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  122  ALQKELIRFLNAGIFGNGTESNHTLPHTATRAAML  156



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            NG    FC++ DPLNW+MAA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA 
Sbjct  13   NGSIKSFCVQQDPLNWQMAAESLKGSHLDEVKRMVQEYRKPVVKLGGETLTISQVAAIAT  72

Query  385  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
             D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  73   HDAGVKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELI  132

Query  565  RFLNAGIFGTGT--GHTLPHSATRAAML  642
            RFLNAGIFG GT   HTLPHSATRAAML
Sbjct  133  RFLNAGIFGNGTESCHTLPHSATRAAML  160



>gb|ABE03772.1| phenylalanine ammonia-lyase [Arnebia euchroma]
Length=709

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 134/156 (86%), Gaps = 5/156 (3%)
 Frame = +1

Query  187  MEGAIE--NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            ME  +E  NG S +FC++ DPLNWEMAA+S+KGSHLDEVKRMVAEFR P V++ G+TLT+
Sbjct  1    METIVEKGNGKSMEFCMQ-DPLNWEMAAESMKGSHLDEVKRMVAEFRKPVVQLAGKTLTI  59

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
             QVA+IAA D+ VKVEL+E AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  60   GQVASIAAHDDGVKVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  119

Query  541  HALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
             ALQ+ELIRFL+AGIFG G  T HTLPHSATRAAML
Sbjct  120  GALQKELIRFLDAGIFGNGTETSHTLPHSATRAAML  155



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 132/155 (85%), Gaps = 6/155 (4%)
 Frame = +1

Query  196  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            A ENGH   SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++
Sbjct  2    AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIS  61

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIAA+DNAV VEL E +RAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  62   QVAAIAAKDNAVAVELVESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGG  121

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  122  ALQKELIRFLNAGIFGNGTESNHTLPHTATRAAML  156



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 133/159 (84%), Gaps = 13/159 (8%)
 Frame = +1

Query  205  NGHSN-----DFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            NGH N     + C K    DPLNWEMAA+SL+GSHLDEVK+MV+EFR P VK+GG+TLTV
Sbjct  4    NGHVNGGENFELCKKSSATDPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGETLTV  63

Query  361  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            AQVAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  64   AQVAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  123

Query  532  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            KNG ALQ+ELIRFLNAG+FG G  T HTLPHSATRAAML
Sbjct  124  KNGGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAML  162



>ref|XP_010253912.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=713

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 130/158 (82%), Gaps = 6/158 (4%)
 Frame = +1

Query  187  MEGAIENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            ME A EN + N     FCI+ DPLNWE AA+SLKGSHLDEVKRMV EFR P V++GGQTL
Sbjct  1    MEFAQENCNGNGSLKSFCIQQDPLNWEKAAESLKGSHLDEVKRMVQEFRKPVVRLGGQTL  60

Query  355  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            T++QVAAIA  D  VKV LSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61   TISQVAAIATHDAGVKVVLSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  120

Query  535  NGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG G  + HTLPHSATRAAML
Sbjct  121  QGGALQKELIRFLNAGIFGNGVESCHTLPHSATRAAML  158



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   241 bits (614),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 133/156 (85%), Gaps = 5/156 (3%)
 Frame = +1

Query  187  MEGAIENGHSN--DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            ME  +ENG+    +FC+K DPLNWEMA++S+KGSHLDEVK MVAEFR P V++ G+TLT+
Sbjct  1    METIVENGNGKTMEFCMK-DPLNWEMASESMKGSHLDEVKNMVAEFRKPVVQLAGKTLTI  59

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
             QVAAIAARD+ V VEL+E AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  60   GQVAAIAARDDGVTVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  119

Query  541  HALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  120  GALQKELIRFLNAGIFGNGTETSHTLPHSATRAAML  155



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   241 bits (614),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 134/158 (85%), Gaps = 6/158 (4%)
 Frame = +1

Query  187  MEGAIENGHSND-FCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            MEGA+ NGH+   FC+     DPLNW +AADS+KGSHLDEVKRMV E+RNP V+IGG+TL
Sbjct  3    MEGALSNGHAQPTFCLTKTLPDPLNWGVAADSMKGSHLDEVKRMVEEYRNPIVRIGGETL  62

Query  355  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  63   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  122

Query  535  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAML
Sbjct  123  QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAML  160



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 131/153 (86%), Gaps = 5/153 (3%)
 Frame = +1

Query  199  IENGHSND--FCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            +ENGH N   FC+K  DPLNW  AA++L+GSHLDEVKRMVAEFR P VK+GG+TLT++QV
Sbjct  1    MENGHKNGNGFCVKQNDPLNWGAAAEALQGSHLDEVKRMVAEFRKPVVKLGGETLTISQV  60

Query  370  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  549
            AAIAARDN V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  61   AAIAARDNGVVVELAEAARPGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  120

Query  550  QQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            Q+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  121  QKELIRFLNAGIFGKGTESEHTLPHTATRAAML  153



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   240 bits (613),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 133/157 (85%), Gaps = 11/157 (7%)
 Frame = +1

Query  205  NGHSN-----DFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            NGH N     + C K  DPLNWEMAA+SL+GSHLDEVK+MV+EFR P VK+GG++LTVAQ
Sbjct  4    NGHVNGGENFELCKKSADPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGESLTVAQ  63

Query  367  VAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            VAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTKN
Sbjct  64   VAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKN  123

Query  538  GHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            G ALQ+ELIRFLNAG+FG G  T HTLPHSATRAAML
Sbjct  124  GGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAML  160



>gb|AEH02821.1| phenylalanine ammonia lyase [Chrysanthemum x morifolium]
Length=717

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 130/149 (87%), Gaps = 4/149 (3%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            NGH ND CIK DPLNW +AA++L GSHL+EVK+MV EF+NP VKIGG+TLTV+QVA IAA
Sbjct  15   NGHINDLCIK-DPLNWGVAAEALTGSHLNEVKKMVKEFKNPIVKIGGETLTVSQVAGIAA  73

Query  385  RDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  561
             DNA VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+EL
Sbjct  74   SDNASVKVELSESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGGALQKEL  133

Query  562  IRFLNAGIFGTGT--GHTLPHSATRAAML  642
            IRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  134  IRFLNAGIFGNGTEASHTLPHSATRAAML  162



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   240 bits (613),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 133/159 (84%), Gaps = 13/159 (8%)
 Frame = +1

Query  205  NGHSN-----DFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            NGH N     + C K    DPLNWEMA++SL+GSHLDEVK+MV+EFR P VK+GG+TLTV
Sbjct  4    NGHVNGGEDFELCKKSSATDPLNWEMASESLRGSHLDEVKKMVSEFRKPMVKLGGETLTV  63

Query  361  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            AQVAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  64   AQVAAIAVRDKSANGVKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  123

Query  532  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            KNG ALQ+ELIRFLNAG+FG G  T HTLPHSATRAAML
Sbjct  124  KNGGALQKELIRFLNAGVFGNGTETNHTLPHSATRAAML  162



>ref|XP_007162754.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
 gb|ESW34748.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
Length=411

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 128/155 (83%), Gaps = 7/155 (5%)
 Frame = +1

Query  199  IENGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            + N H N  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+A
Sbjct  6    LTNAHQNCSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIA  65

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAA++  D  V+VELSE AR GVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  66   QVAAVSGHDQGVRVELSESAREGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  125

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  126  ALQKELIRFLNAGIFGNGTESSHTLPHTATRAAML  160



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   239 bits (611),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 133/156 (85%), Gaps = 4/156 (3%)
 Frame = +1

Query  187  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            M  ++EN H SN FC++  DPLNW +AA++LKGSHLDEVK+MVAEFR P VK+GG+TLT+
Sbjct  1    MAPSLENDHHSNGFCVQQKDPLNWGVAAEALKGSHLDEVKKMVAEFRKPVVKLGGETLTI  60

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            +QVAAIAARDN V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   SQVAAIAARDNGVAVELAEAARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG  T   HTLPHSATRAAML
Sbjct  121  GALQKELIRFLNAGIFGNATESCHTLPHSATRAAML  156



>gb|AFF60415.1| phenylalanine ammonia lyase, partial [Pyrus pyrifolia]
Length=639

 Score =   238 bits (608),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
             CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVAAIA  D  VK
Sbjct  4    LCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDTGVK  63

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  64   VELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAG  123

Query  583  IFGTGT--GHTLPHSATRAAML  642
            +FG+ T  GHTLPH ATRAAML
Sbjct  124  VFGSATESGHTLPHQATRAAML  145



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 133/160 (83%), Gaps = 8/160 (5%)
 Frame = +1

Query  187  MEGAIENGHSND----FCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  348
            M  A ENGH N     FC+K   DPLNW  AA++LKGSHL+EVKRMV EFR P VK+GG+
Sbjct  1    MAAATENGHRNGAVNGFCVKAQGDPLNWGAAAEALKGSHLEEVKRMVEEFRKPVVKLGGE  60

Query  349  TLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  528
            +LT++QVAAIAARDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRR
Sbjct  61   SLTISQVAAIAARDNAVAVELAEPARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  120

Query  529  TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            TK G ALQ+ELIR LNAGIFG+GT   HTLPHSATRAAML
Sbjct  121  TKQGGALQKELIRSLNAGIFGSGTESCHTLPHSATRAAML  160



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 129/155 (83%), Gaps = 8/155 (5%)
 Frame = +1

Query  202  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGA  130

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAML  165



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 129/155 (83%), Gaps = 8/155 (5%)
 Frame = +1

Query  202  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGA  130

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAML  165



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 129/152 (85%), Gaps = 6/152 (4%)
 Frame = +1

Query  193  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            GA+E+      CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVA
Sbjct  18   GAVES----PLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVA  73

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  74   AIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQ  133

Query  553  QELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            +ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  134  KELIRFLNAGVFGSATESGHTLPHQATRAAML  165



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   239 bits (609),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 129/152 (85%), Gaps = 6/152 (4%)
 Frame = +1

Query  193  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            GA+E+      CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVA
Sbjct  18   GAVES----PLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVA  73

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  74   AIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQ  133

Query  553  QELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            +ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  134  KELIRFLNAGVFGSATESGHTLPHQATRAAML  165



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 131/157 (83%), Gaps = 5/157 (3%)
 Frame = +1

Query  187  MEGAIENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            M   +ENGH  +N FC+K  DPLNW  AA+ LKGSHLDEVKRMV EFR   VK+GG+TLT
Sbjct  1    MAAVVENGHHGNNGFCVKQNDPLNWVAAAEELKGSHLDEVKRMVEEFRKTVVKLGGETLT  60

Query  358  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            ++QVAAIAARDN V V+L+E +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  61   ISQVAAIAARDNEVAVQLAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  120

Query  538  GHALQQELIRFLNAGIFGTGTG--HTLPHSATRAAML  642
            G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  121  GGALQKELIRFLNAGIFGNGTESTHTLPHSATRAAML  157



>gb|AFK43896.1| unknown [Medicago truncatula]
Length=374

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 130/158 (82%), Gaps = 7/158 (4%)
 Frame = +1

Query  187  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  355  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  119

Query  535  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAML
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAML  157



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 131/156 (84%), Gaps = 8/156 (5%)
 Frame = +1

Query  199  IENGHS-----NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +ENGH      ++FC+K DPLNW +AA+SL GSHLDEVKRMVAEFR P VK GG++LTVA
Sbjct  1    MENGHDECVKVSEFCLKSDPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKFGGESLTVA  60

Query  364  QVAAIAAR-DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            QVAAIAA+ D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRT  G
Sbjct  61   QVAAIAAKGDQGVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQG  120

Query  541  HALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  GALQKELIRFLNAGIFGNGTETCHTLPHSATRAAML  156



>sp|O49836.1|PAL2_LITER RecName: Full=Phenylalanine ammonia-lyase 2; Short=PAL-2 [Lithospermum 
erythrorhizon]
 dbj|BAA24929.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=705

 Score =   238 bits (607),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +1

Query  199  IENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  375
            +ENG+   +FC+K DPLNW MAA+S+KGSHLDEVK+MVAEFR P V++ G+TLT+AQVAA
Sbjct  1    MENGNGKMEFCMK-DPLNWGMAAESMKGSHLDEVKKMVAEFRKPVVQLAGKTLTIAQVAA  59

Query  376  IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  555
            IAARD+ V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  60   IAARDDGVTVELAEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  119

Query  556  ELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  120  ELIRFLNAGIFGNGTETSHTLPHSATRAAML  150



>emb|CAL91170.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=264

 Score =   226 bits (577),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 5/151 (3%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            NG + DFCI  DPLNW +AA+++ GSHLDEVKRMVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  9    NGVATDFCINKDPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVVKLGGETLTVSQVAGIAA  68

Query  385  RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  558
              ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  69   AGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKE  128

Query  559  LI-RFLNAGIFGTG--TGHTLPHSATRAAML  642
            LI RFLNAGIFG G  + HTLPHSATRAAML
Sbjct  129  LIRRFLNAGIFGNGSESCHTLPHSATRAAML  159



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 132/155 (85%), Gaps = 8/155 (5%)
 Frame = +1

Query  202  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHKNGSVELPELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  544  ALQQELIRFLNAGIFGT--GTGHTLPHSATRAAML  642
            ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAML
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAML  162



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 132/155 (85%), Gaps = 8/155 (5%)
 Frame = +1

Query  202  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNRSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  544  ALQQELIRFLNAGIFGT--GTGHTLPHSATRAAML  642
            ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAML
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAML  162



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   238 bits (607),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 132/155 (85%), Gaps = 8/155 (5%)
 Frame = +1

Query  202  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNGSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  544  ALQQELIRFLNAGIFGT--GTGHTLPHSATRAAML  642
            ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAML
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAML  162



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 127/154 (82%), Gaps = 7/154 (5%)
 Frame = +1

Query  202  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            +NGH N       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNGVSESPLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G A
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGAA  130

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  131  LQKELIRFLNAGVFGSATESGHTLPHQATRAAML  164



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 127/154 (82%), Gaps = 7/154 (5%)
 Frame = +1

Query  202  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            +NGH N       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNRVSESPLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G A
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGAA  130

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  131  LQKELIRFLNAGVFGSATESGHTLPHQATRAAML  164



>gb|ABQ63094.1| phenylalanine ammonia-lyase [Astragalus membranaceus]
Length=718

 Score =   238 bits (606),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 134/163 (82%), Gaps = 11/163 (7%)
 Frame = +1

Query  187  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  339
            MEG   NGH SN     ++CI     DPLNW +AA++LKGSHLDEVKRMV E+RNP VKI
Sbjct  1    MEGEGANGHVSNHVTEAEYCISKAGGDPLNWGVAAEALKGSHLDEVKRMVEEYRNPVVKI  60

Query  340  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  519
            GG+TLT+AQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTIAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  520  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            HRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAML
Sbjct  121  HRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAML  163



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 134/167 (80%), Gaps = 15/167 (9%)
 Frame = +1

Query  187  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  336
            M    +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MVAEFR P VK
Sbjct  1    MASIAQNGHVNGEVVAMELCKKSINVDDPLNWEMAADSLRGSHLDEVKKMVAEFRKPIVK  60

Query  337  IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  507
            +GG+TLTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  508  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            GATSHRRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAML
Sbjct  121  GATSHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAML  167



>gb|KJB16792.1| hypothetical protein B456_002G248000 [Gossypium raimondii]
Length=721

 Score =   237 bits (605),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 129/156 (83%), Gaps = 10/156 (6%)
 Frame = +1

Query  205  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  11   NGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  70

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            +QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  71   SQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  130

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  131  AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAML  166



>gb|AAX84839.1| phenylalanine ammonia-lyase [Astragalus mongholicus]
Length=718

 Score =   237 bits (605),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 133/163 (82%), Gaps = 11/163 (7%)
 Frame = +1

Query  187  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  339
            MEG   NGH SN     +FCI     DPLNW  AA++LKGSHLDEVKRMV E+RNP VKI
Sbjct  1    MEGEGANGHVSNHATEAEFCISKTGGDPLNWGAAAEALKGSHLDEVKRMVEEYRNPVVKI  60

Query  340  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  519
            GG+TLT+AQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTIAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  520  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            HRRT+ G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAML
Sbjct  121  HRRTRQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAML  163



>gb|AER12109.1| PAL [Gossypium hirsutum]
Length=721

 Score =   237 bits (605),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 129/156 (83%), Gaps = 10/156 (6%)
 Frame = +1

Query  205  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  11   NGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  70

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            +QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  71   SQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  130

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  131  AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAML  166



>gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandiflorus]
Length=708

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 130/153 (85%), Gaps = 5/153 (3%)
 Frame = +1

Query  196  AIENGHSND--FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            A  NGHS +  FC++ DPLNW  AA+ LKGSHLDEVK+MV EFR P V++GG+TLT+AQV
Sbjct  2    AYSNGHSKNGGFCVE-DPLNWGKAAEGLKGSHLDEVKKMVEEFRKPVVQLGGKTLTIAQV  60

Query  370  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  549
            AAIA  D+ VKVELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G AL
Sbjct  61   AAIATHDSGVKVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKEGGAL  120

Query  550  QQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            Q+ELIRFLNAGIFG GT   HTLPHS TRA+ML
Sbjct  121  QKELIRFLNAGIFGNGTESSHTLPHSTTRASML  153



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 132/162 (81%), Gaps = 15/162 (9%)
 Frame = +1

Query  202  ENGHSN--------DFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            +NGH N        D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  7    QNGHINGEVEEVAMDLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  66

Query  352  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  522
            LTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  67   LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  126

Query  523  RRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            RRTKNG ALQ+ELIRFLNAG+FG G  T HTLPHSATRAAML
Sbjct  127  RRTKNGGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAML  168



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 131/156 (84%), Gaps = 8/156 (5%)
 Frame = +1

Query  199  IENGHS-----NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +ENGH      ++FC+K DPLNW +AA+SL GSHLDEVKRMVAEFR P VK+GG++LTVA
Sbjct  1    MENGHDEGVKVSEFCLKSDPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKLGGESLTVA  60

Query  364  QVAAIAAR-DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            QVAAIAA+ D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRT  G
Sbjct  61   QVAAIAAKGDQGVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQG  120

Query  541  HALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG G  T H LPHSATRAAML
Sbjct  121  GALQKELIRFLNAGIFGNGTETCHMLPHSATRAAML  156



>gb|AIL23235.1| phenylalanine ammonia-lyase [Astragalus chrysochlorus]
Length=719

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 134/163 (82%), Gaps = 11/163 (7%)
 Frame = +1

Query  187  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  339
            MEG   NGH SN     +FCI     DPLNW +AA+++KGSHLDEVKRMV ++RNP VKI
Sbjct  1    MEGEGANGHVSNNVTEAEFCITKTGGDPLNWGVAAEAMKGSHLDEVKRMVEQYRNPVVKI  60

Query  340  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  519
            GG+TLTVAQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTVAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  520  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            HRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAML
Sbjct  121  HRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAML  163



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 128/155 (83%), Gaps = 8/155 (5%)
 Frame = +1

Query  202  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAML  165



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 128/155 (83%), Gaps = 8/155 (5%)
 Frame = +1

Query  202  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAML  165



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 132/161 (82%), Gaps = 13/161 (8%)
 Frame = +1

Query  199  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  355  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  525
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  526  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAML
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAML  166



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 134/156 (86%), Gaps = 6/156 (4%)
 Frame = +1

Query  193  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            GAI NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GAITNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  358  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  535  NGHALQQELIRFLNAGIFGTGTGHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG G+ +TLPHSATRAAML
Sbjct  126  QGGALQKELIRFLNAGIFGNGSDNTLPHSATRAAML  161



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 6/152 (4%)
 Frame = +1

Query  205  NGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            NGH   +N FC+K  DPLNW  AA+SLKGSHL+EVKRMV EFR P VK+GG+TLT++QVA
Sbjct  10   NGHNNGANGFCVKQNDPLNWAAAAESLKGSHLEEVKRMVEEFRKPVVKLGGETLTISQVA  69

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIAA+DNAV VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  70   AIAAKDNAVAVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQ  129

Query  553  QELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            +ELIRFLNAGIFG  T   HTLPH+ATRAAML
Sbjct  130  KELIRFLNAGIFGNATESNHTLPHTATRAAML  161



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 132/161 (82%), Gaps = 13/161 (8%)
 Frame = +1

Query  199  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  355  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  525
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  526  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAML
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAML  166



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 132/161 (82%), Gaps = 13/161 (8%)
 Frame = +1

Query  199  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  355  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  525
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  526  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAML
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAML  166



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 132/161 (82%), Gaps = 13/161 (8%)
 Frame = +1

Query  199  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  355  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  525
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  526  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAML
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAML  166



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 129/146 (88%), Gaps = 2/146 (1%)
 Frame = +1

Query  211  HSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  390
             S++ CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++QVAAIA  D
Sbjct  4    ESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHD  63

Query  391  NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRF  570
            + VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRF
Sbjct  64   SGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGAALQKELIRF  123

Query  571  LNAGIFGT--GTGHTLPHSATRAAML  642
            LNAG+FG+   +GHTLPH ATRAAML
Sbjct  124  LNAGVFGSTKESGHTLPHQATRAAML  149



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   236 bits (602),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 132/155 (85%), Gaps = 8/155 (5%)
 Frame = +1

Query  202  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNGSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIA  D+ VKVELSE A+AGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESAQAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  544  ALQQELIRFLNAGIFGT--GTGHTLPHSATRAAML  642
            ALQ+ELIRFLNAG+FG+   +GHTLPH ATRAAML
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQATRAAML  162



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 132/159 (83%), Gaps = 7/159 (4%)
 Frame = +1

Query  187  MEGAIENGHSND----FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            M    ENG  ND    FC +  DPL+W +AA+S+KGSHLDEVK+MVAE+R P VK+GG+T
Sbjct  1    MAAMAENGSKNDSLESFCNMGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVKLGGET  60

Query  352  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            LTVAQVAAIA+ D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  61   LTVAQVAAIASHDCGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  120

Query  532  KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            K G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAML  159



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 122/137 (89%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKG HLDEVKRMV EFR P VK+GG+TLT++QVAAIAARDNAV VEL+E
Sbjct  20   DPLNWVMAAESLKGIHLDEVKRMVEEFRKPVVKLGGETLTISQVAAIAARDNAVAVELAE  79

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  80   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  139

Query  598  T--GHTLPHSATRAAML  642
            T   HTLPHSATRAAML
Sbjct  140  TESNHTLPHSATRAAML  156



>gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 131/158 (83%), Gaps = 6/158 (4%)
 Frame = +1

Query  187  MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1    MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  355  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61   TVAQVAAIASHDAGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  120

Query  535  NGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  QGAALQRELIRFLNAGIFGNGTETCHTLPHSATRAAML  158



>gb|KDP29132.1| hypothetical protein JCGZ_16521 [Jatropha curcas]
Length=713

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 131/158 (83%), Gaps = 6/158 (4%)
 Frame = +1

Query  187  MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1    MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  355  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61   TVAQVAAIASHDAGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  120

Query  535  NGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  QGAALQRELIRFLNAGIFGNGTETCHTLPHSATRAAML  158



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   236 bits (601),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 127/155 (82%), Gaps = 8/155 (5%)
 Frame = +1

Query  202  ENGH------SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +NGH       +  CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   QNGHHQNGVSESQLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAML  165



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 127/155 (82%), Gaps = 8/155 (5%)
 Frame = +1

Query  202  ENGH------SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +NGH       +  CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   QNGHHQNGVSESQLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQATRAAML  165



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 7/150 (5%)
 Frame = +1

Query  214  SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  378
            ++ FC+       DPLNW +AA+SLKGSHLDEVKRMV EFR P V++GG+TLT++QVAAI
Sbjct  11   ADSFCLSGGVAAADPLNWGVAAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTISQVAAI  70

Query  379  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  558
            AA D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  71   AAHDQGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGAALQKE  130

Query  559  LIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  131  LIRFLNAGIFGNGTESCHTLPHSATRAAML  160



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 131/159 (82%), Gaps = 7/159 (4%)
 Frame = +1

Query  187  MEGAIENGHSND----FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            M    ENG  ND    FC    DPL+W +AA+S+KGSHLDEVK+MVAE+R P VK+GG+T
Sbjct  1    MAAMAENGSKNDSLESFCNTGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVKLGGET  60

Query  352  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            LTVAQVAAIA+ D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  61   LTVAQVAAIASHDCGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  120

Query  532  KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            K G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTESCHTLPHSATRAAML  159



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   235 bits (599),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 132/165 (80%), Gaps = 13/165 (8%)
 Frame = +1

Query  187  MEGAIENGHSN----DFCIK-------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAV  333
            ME   +NGH       FC         +DPLNW +AA+SLKGSHLDEVKRMVAE+RNP V
Sbjct  1    METITQNGHHKGSLESFCTASKGAGGAIDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLV  60

Query  334  KIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGA  513
            K+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGA
Sbjct  61   KLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  514  TSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            TSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  121  TSHRRTKQGAALQKELIRFLNAGIFGHGTESCHTLPHSATRAAML  165



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   235 bits (599),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 129/154 (84%), Gaps = 8/154 (5%)
 Frame = +1

Query  205  NGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            NGHS+ +FCIK     DPLNW MAA +L GSHLDEVK+MV EFR PAV++GG+TLTVAQV
Sbjct  9    NGHSSQEFCIKGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAVRLGGETLTVAQV  68

Query  370  AAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            AAIA R    VKVELSEGARAGVKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69   AAIAGRSGTEVKVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGFGATSHRRTKQGAA  128

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  129  LQKELIRFLNAGIFGNGTESCHTLPHSATRAAML  162



>sp|O04058.2|PALY_HELAN RecName: Full=Phenylalanine ammonia-lyase [Helianthus annuus]
 emb|CAA73065.1| phenylalanine ammonia lyase [Helianthus annuus]
Length=667

 Score =   234 bits (596),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 128/150 (85%), Gaps = 5/150 (3%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            NG +N FCIK DPLNW +AA++L GSHLDEVK+MV EFR P VK+GG+TLTV+QVA I+A
Sbjct  8    NGSANGFCIK-DPLNWGVAAEALTGSHLDEVKKMVGEFRKPVVKLGGETLTVSQVAGISA  66

Query  385  --RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  558
                N VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+E
Sbjct  67   AGDGNMVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKE  126

Query  559  LIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  127  LIRFLNAGIFGNGTESSHTLPHSATRAAML  156



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 127/148 (86%), Gaps = 7/148 (5%)
 Frame = +1

Query  220  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  393
            D C K   DPLNWEMAA+SLKGSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  15   DLCNKSIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADN  74

Query  394  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
                VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  75   KTCGVKVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELI  134

Query  565  RFLNAGIFGTGTG--HTLPHSATRAAML  642
            RFLNAG+FG GTG  HTLPHSATRAAML
Sbjct  135  RFLNAGVFGNGTGSCHTLPHSATRAAML  162



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   235 bits (599),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 127/148 (86%), Gaps = 7/148 (5%)
 Frame = +1

Query  220  DFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  393
            D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  21   DLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANVDN  80

Query  394  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
                VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  81   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELI  140

Query  565  RFLNAGIFGTGT--GHTLPHSATRAAML  642
            RFLNAG+FG GT   HTLPHSATRAAML
Sbjct  141  RFLNAGVFGNGTESSHTLPHSATRAAML  168



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 6/156 (4%)
 Frame = +1

Query  193  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  358  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  535  NGHALQQELIRFLNAGIFGTGTGHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG G+ +TLPHSATRAAML
Sbjct  126  QGGALQKELIRFLNAGIFGNGSDNTLPHSATRAAML  161



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 132/165 (80%), Gaps = 13/165 (8%)
 Frame = +1

Query  187  MEGAIENGHSN----DFCIK-------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAV  333
            ME   +NGH       FC         VDPLNW +AA+SLKGSHLDEVKRMVAE+RNP V
Sbjct  1    METITQNGHHKGSLESFCTASKGAGGAVDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLV  60

Query  334  KIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGA  513
            K+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGA
Sbjct  61   KLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  514  TSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            TSHRRTK G ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAML
Sbjct  121  TSHRRTKQGAALQKELIRFLNAGVFGHGTESCHTLPHSATRAAML  165



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   234 bits (598),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 127/148 (86%), Gaps = 7/148 (5%)
 Frame = +1

Query  220  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  393
            D C K   DPLNWEMAA+SLKGSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  15   DLCNKSIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADN  74

Query  394  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
                VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  75   KTCGVKVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELI  134

Query  565  RFLNAGIFGTGTG--HTLPHSATRAAML  642
            RFLNAG+FG GTG  HTLPHSATRAAML
Sbjct  135  RFLNAGVFGNGTGSCHTLPHSATRAAML  162



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 128/156 (82%), Gaps = 10/156 (6%)
 Frame = +1

Query  205  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  18   NGHLQSFCSATNGGVGVVVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  77

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            +QVAAIA RD  VKVELSE A AGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  78   SQVAAIATRDLGVKVELSEDAMAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  137

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  138  AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAML  173



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 128/153 (84%), Gaps = 6/153 (4%)
 Frame = +1

Query  202  ENGHSNDFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            E+ +S+ FC       DPL+W +AADS+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQV
Sbjct  10   ESLNSSIFCTAAKAGSDPLSWGVAADSMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQV  69

Query  370  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  549
            AAIAA D  V VEL E ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+AL
Sbjct  70   AAIAANDQGVSVELCESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNAL  129

Query  550  QQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            Q ELIRFLNAGIFG G  T HTLP  ATRAAML
Sbjct  130  QLELIRFLNAGIFGNGTETSHTLPQPATRAAML  162



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 6/156 (4%)
 Frame = +1

Query  193  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  358  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  535  NGHALQQELIRFLNAGIFGTGTGHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG G+ +TLPHSATRAAML
Sbjct  126  QGGALQKELIRFLNAGIFGNGSDNTLPHSATRAAML  161



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   234 bits (598),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 126/147 (86%), Gaps = 7/147 (5%)
 Frame = +1

Query  223  FCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAAR  387
             C+K      DPLNW +AA+S+KGSHLDEVKRMV E+RNP V+IGG+TLT++QVAAIA R
Sbjct  18   LCLKSNNTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIGGETLTISQVAAIATR  77

Query  388  DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIR  567
            D  V +ELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIR
Sbjct  78   DQDVSLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIR  137

Query  568  FLNAGIFGTG--TGHTLPHSATRAAML  642
            FLNAGIFG G  + HTLPHSATRAAML
Sbjct  138  FLNAGIFGNGAVSCHTLPHSATRAAML  164



>gb|AGU91428.1| phenylalanine ammonia-lyase [Chrysanthemum boreale]
Length=709

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 133/155 (86%), Gaps = 8/155 (5%)
 Frame = +1

Query  199  IENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            ++NGH+N    + CIK DPLNW +AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+Q
Sbjct  1    MDNGHANGVAKELCIK-DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQ  59

Query  367  VAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            VA IAA +NA VKVEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG 
Sbjct  60   VAGIAASENAGVKVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGG  119

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  120  ALQKELIRFLNAGIFGNGTESNHTLPHSATRAAML  154



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 131/154 (85%), Gaps = 5/154 (3%)
 Frame = +1

Query  196  AIENGH--SNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            A ENGH  SN FC+K  DPLNW  AA+S+ GSHL EVKRMV EFR P V++GG+TLT++Q
Sbjct  2    AAENGHHASNGFCVKQSDPLNWGAAAESMSGSHLQEVKRMVEEFRKPVVRLGGETLTISQ  61

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAAIAA+DNAV VEL+E ARAGVKASSDWVM+SM+ GT SYGVTTGFGATSHRRTK G A
Sbjct  62   VAAIAAKDNAVAVELAESARAGVKASSDWVMDSMSKGTVSYGVTTGFGATSHRRTKQGGA  121

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  122  LQKELIRFLNAGIFGNGTESSHTLPHTATRAAML  155



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 132/162 (81%), Gaps = 15/162 (9%)
 Frame = +1

Query  202  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  3    QNGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  62

Query  352  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  522
            LTVAQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  63   LTVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122

Query  523  RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            RRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAML
Sbjct  123  RRTKNGGALQKELIRFLNAGVFGNGTELSHTLPHSATRAAML  164



>gb|AIA24411.1| phenylalanine ammonia-lyase [Sinopodophyllum hexandrum]
Length=709

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FCIK DPLNW MAAD+LKGSHLDEVK+MV E+R   V++GG+TLT++QVAA+A+ D  VK
Sbjct  15   FCIKEDPLNWGMAADALKGSHLDEVKKMVKEYRQGVVRLGGETLTISQVAAVASHDQGVK  74

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  75   VELNESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  134

Query  583  IFGTGTG--HTLPHSATRAAML  642
            +FG GT   HTLPHSATRAAML
Sbjct  135  VFGNGTESTHTLPHSATRAAML  156



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 133/167 (80%), Gaps = 15/167 (9%)
 Frame = +1

Query  187  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  336
            M    +NGH N      + C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK
Sbjct  1    MASIAQNGHVNGEVVAMELCKKSINVDDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  60

Query  337  IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  507
            +GG+TLTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  508  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            GATSHRRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAML
Sbjct  121  GATSHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAML  167



>gb|KGN48166.1| hypothetical protein Csa_6G446280 [Cucumis sativus]
Length=166

 Score =   219 bits (557),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  14   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDFDVTVELSE  73

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG G
Sbjct  74   SARAGVKASSDWVMESMKKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNG  133

Query  598  --TGHTLPHSATRAAML  642
              + HTL  SATRAAML
Sbjct  134  AESCHTLSRSATRAAML  150



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 132/162 (81%), Gaps = 15/162 (9%)
 Frame = +1

Query  202  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  3    QNGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  62

Query  352  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  522
            LTVAQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  63   LTVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122

Query  523  RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            RRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSATRAAML
Sbjct  123  RRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAML  164



>ref|XP_004143356.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156338.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=717

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%), Gaps = 4/151 (3%)
 Frame = +1

Query  202  ENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  375
            +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAA
Sbjct  12   QNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQVAA  71

Query  376  IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  555
            IA RDN V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  72   IATRDNDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  131

Query  556  ELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            ELIRFLNAGIFG G  + HTLPHSATRAAML
Sbjct  132  ELIRFLNAGIFGNGAESNHTLPHSATRAAML  162



>gb|KGN48164.1| hypothetical protein Csa_6G445770 [Cucumis sativus]
Length=717

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 127/151 (84%), Gaps = 4/151 (3%)
 Frame = +1

Query  202  ENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  375
            +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAA
Sbjct  12   QNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQVAA  71

Query  376  IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  555
            IA RDN V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  72   IATRDNDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  131

Query  556  ELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            ELIRFLNAGIFG G  + HTLPHSATRAAML
Sbjct  132  ELIRFLNAGIFGNGAESNHTLPHSATRAAML  162



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 128/154 (83%), Gaps = 8/154 (5%)
 Frame = +1

Query  205  NGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            NGH N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  5    NGHQNGSFCLSTAKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQ  64

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  65   VAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  124

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  125  LQKELIRFLNAGIFGNGTESSHTLPHTATRAAML  158



>emb|CAA44609.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
Length=240

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW  AA+ +KGSHLDEVKRMVAEFR P V +GG+TLT+ QVAAI+   N+VKVELSE
Sbjct  34   DPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAISTIGNSVKVELSE  93

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  94   TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  153

Query  598  --TGHTLPHSATRAAML  642
              T HTLPHSATRAAML
Sbjct  154  KETSHTLPHSATRAAML  170



>sp|P27991.1|PAL1_SOYBN RecName: Full=Phenylalanine ammonia-lyase 1 [Glycine max]
 emb|CAA37129.1| phenylalanine ammonia-lyase [Glycine max]
Length=713

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 128/154 (83%), Gaps = 8/154 (5%)
 Frame = +1

Query  205  NGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            NGH N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  5    NGHQNGSFCLSTAKGNNDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQ  64

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  65   VAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  124

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  125  LQKELIRFLNAGIFGNGTESSHTLPHTATRAAML  158



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 129/154 (84%), Gaps = 8/154 (5%)
 Frame = +1

Query  205  NGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            NGH N    DFCI  DPLNW +AA+++ GSHLDEVKRMVAEFR P VK+GG+TLTV+QVA
Sbjct  5    NGHVNGVATDFCINKDPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVVKLGGETLTVSQVA  64

Query  373  AIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
             IAA  ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G A
Sbjct  65   GIAAAGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGA  124

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  125  LQKELIRFLNAGIFGNGTESCHTLPHSATRAAML  158



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            N  S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R P V++GG+TLT+AQVAA+A+
Sbjct  12   NIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVAS  71

Query  385  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
            RD+ V VEL+E ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  72   RDDGVTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELI  131

Query  565  RFLNAGIFGTGT--GHTLPHSATRAAML  642
            RFLNAGIFG GT   H LPH+ATRAAML
Sbjct  132  RFLNAGIFGKGTESCHMLPHTATRAAML  159



>ref|XP_006424538.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
 gb|ESR37778.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
Length=714

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            N  S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R P V++GG+TLT+AQVAA+A+
Sbjct  12   NIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVAS  71

Query  385  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
            RD+ V VEL+E ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  72   RDDGVTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELI  131

Query  565  RFLNAGIFGTGT--GHTLPHSATRAAML  642
            RFLNAGIFG GT   H LPH+ATRAAML
Sbjct  132  RFLNAGIFGKGTESCHMLPHTATRAAML  159



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 131/158 (83%), Gaps = 7/158 (4%)
 Frame = +1

Query  187  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            MEG I NGH+   FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG TL
Sbjct  1    MEG-ITNGHAEATFCVTKSVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGATL  59

Query  355  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  119

Query  535  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAML
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAML  157



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   233 bits (593),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 131/158 (83%), Gaps = 7/158 (4%)
 Frame = +1

Query  187  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            MEG I NGH+   FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG TL
Sbjct  1    MEG-ITNGHAEATFCVTKSVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGATL  59

Query  355  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  119

Query  535  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAML
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAML  157



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 125/154 (81%), Gaps = 7/154 (5%)
 Frame = +1

Query  202  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            +NGH N       CIK  PLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNGVSESPLCIKKAPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGV TGFGATSHRRT  G A
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVPTGFGATSHRRTNKGAA  130

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAG+FG+ T  GHTLPH ATRAAML
Sbjct  131  LQKELIRFLNAGVFGSATESGHTLPHQATRAAML  164



>gb|ACT53398.1| phenylalanine ammonia-lyase 1 [Ageratina adenophora]
Length=715

 Score =   232 bits (592),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 134/159 (84%), Gaps = 9/159 (6%)
 Frame = +1

Query  193  GAIE-NGHSN---DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            G+IE NG  N    FC+K DPLNW + A+SLKGSHLDEVKRMV EFRNP VK+GG+TLTV
Sbjct  2    GSIEFNGDQNIDNYFCVKGDPLNWGVVAESLKGSHLDEVKRMVTEFRNPVVKLGGETLTV  61

Query  361  AQVAAIA--ARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            +QVAAIA  A D++ +KVELSE AR GVKASS+WVM SMN GTDSYGVTTGFGATSHRRT
Sbjct  62   SQVAAIAVAATDSSNIKVELSESAREGVKASSEWVMESMNKGTDSYGVTTGFGATSHRRT  121

Query  532  KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            K G ALQ+ELIRFLNAGIFG+GT   HTLPHSATRAAML
Sbjct  122  KEGGALQKELIRFLNAGIFGSGTESSHTLPHSATRAAML  160



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   232 bits (592),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 131/159 (82%), Gaps = 12/159 (8%)
 Frame = +1

Query  202  ENGHSN-----DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            +NGH N     D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TL+V
Sbjct  7    QNGHINGEVAMDLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSV  66

Query  361  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            AQVA+IA  D   N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRT
Sbjct  67   AQVASIANVDDKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRT  126

Query  532  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            KNG ALQ+ELIRFLNAG+FG G  + HTLPHSATRAAML
Sbjct  127  KNGGALQKELIRFLNAGVFGNGIESFHTLPHSATRAAML  165



>gb|KGN48161.1| hypothetical protein Csa_6G445740 [Cucumis sativus]
Length=544

 Score =   229 bits (583),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 125/151 (83%), Gaps = 8/151 (5%)
 Frame = +1

Query  211  HSND---FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
             +ND   FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  6    QTNDDSSFCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVA  65

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RD  V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  66   AIATRDTDVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAM  639
            +ELIRFLNAGIFG+G  + HTLPHSATRAA+
Sbjct  126  KELIRFLNAGIFGSGAESDHTLPHSATRAAI  156



>ref|XP_004156293.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Cucumis sativus]
Length=712

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 126/152 (83%), Gaps = 8/152 (5%)
 Frame = +1

Query  211  HSND---FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
             +ND   FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  6    QTNDDSSFCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVA  65

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RD  V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  66   AIATRDTDVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLNAGIFG+G  + HTLPHSATRAAML
Sbjct  126  KELIRFLNAGIFGSGAESDHTLPHSATRAAML  157



>gb|ABL14040.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   221 bits (562),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 130/162 (80%), Gaps = 9/162 (6%)
 Frame = +1

Query  184  TMEGAIENG--HSND--FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  342
            T EGA  N   H+N+  FCI+    DP NW +AA++LKGSHLDEVKRMV E+R P V+IG
Sbjct  2    TGEGANGNAKNHANEVEFCIRETRGDPFNWGVAAEALKGSHLDEVKRMVEEYRKPVVRIG  61

Query  343  GQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  522
            G+TLT++QVAAIA  D  VKV+LSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  62   GETLTISQVAAIAGHDQGVKVDLSESARDGVKASSDWVMESMNKGTDSYGVTTGFGATSH  121

Query  523  RRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            RRTK G ALQ+ELIRFLNAGIFG G  T  TLP++ATRAAML
Sbjct  122  RRTKQGGALQKELIRFLNAGIFGNGTETSCTLPNTATRAAML  163



>ref|XP_004143256.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=712

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 126/152 (83%), Gaps = 8/152 (5%)
 Frame = +1

Query  211  HSND---FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
             +ND   FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  6    QTNDDSSFCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVA  65

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RD  V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  66   AIATRDTDVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLNAGIFG+G  + HTLPHSATRAAML
Sbjct  126  KELIRFLNAGIFGSGAESDHTLPHSATRAAML  157



>gb|AGV54597.1| phenylalanine ammonia-lyase [Phaseolus vulgaris]
Length=714

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 127/154 (82%), Gaps = 6/154 (4%)
 Frame = +1

Query  199  IENGHSNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            + N  +  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  6    LTNAQNGSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIAQ  65

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAA++  D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  66   VAAVSGHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  125

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  126  LQKELIRFLNAGIFGNGTESSHTLPHTATRAAML  159



>gb|AHA42445.1| phenylalanine ammonia lyase, partial [Cannabis sativa]
Length=528

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+K DPLNW +AA+S+ GSHLDEVKRMVAE+R P V +GG+TLT++QVAAIAA D  VK
Sbjct  12   FCVKGDPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAIAAAD-GVK  70

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE  RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAG
Sbjct  71   VELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAG  130

Query  583  IFGTGT--GHTLPHSATRAAML  642
            IFG GT   HTLPHS+TRA +L
Sbjct  131  IFGHGTESCHTLPHSSTRAGLL  152



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 128/153 (84%), Gaps = 7/153 (5%)
 Frame = +1

Query  205  NGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            NGH N  FC+      DPLNW  AA+++KGSHLDEVKRMV+E+R P V++GG+TLT+AQV
Sbjct  5    NGHQNGSFCLSSTKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQV  64

Query  370  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  549
            AA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G AL
Sbjct  65   AAVAGHDHGVTVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  550  QQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            Q+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  125  QKELIRFLNAGIFGNGTESSHTLPHTATRAAML  157



>emb|CDY18463.1| BnaA04g21240D [Brassica napus]
Length=263

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = +1

Query  217  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  396
            N   +  DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N 
Sbjct  24   NATVVGADPLNWGAAAEQMKGSHLDEVKRMVKEFRRPVVNLGGETLTIGQVAAISTLGNG  83

Query  397  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  576
            VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLN
Sbjct  84   VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLN  143

Query  577  AGIFGTG--TGHTLPHSATRAAML  642
            AGIFG+   T HTLPHSATRAAML
Sbjct  144  AGIFGSTKETSHTLPHSATRAAML  167



>ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156291.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48163.1| hypothetical protein Csa_6G445760 [Cucumis sativus]
Length=713

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 126/150 (84%), Gaps = 3/150 (2%)
 Frame = +1

Query  202  ENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  378
            +NG     CI   DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAI
Sbjct  9    KNGSVESLCIGSNDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAI  68

Query  379  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  558
            A RD  V VELSE +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  69   ATRDTDVIVELSESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  128

Query  559  LIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            LIRFLNAGIFG+G  + HTLPHSATRAAML
Sbjct  129  LIRFLNAGIFGSGAESDHTLPHSATRAAML  158



>ref|XP_007162756.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
 gb|ESW34750.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
Length=714

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 127/154 (82%), Gaps = 6/154 (4%)
 Frame = +1

Query  199  IENGHSNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            + N  +  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  6    LTNAQNGSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIAQ  65

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAA++  D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  66   VAAVSGHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  125

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  126  LQKELIRFLNAGIFGNGTESSHTLPHTATRAAML  159



>gb|KGN52975.1| hypothetical protein Csa_4G008780 [Cucumis sativus]
Length=646

 Score =   230 bits (587),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 125/152 (82%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            A +NG    FC    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESFCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLN+GIFG G  + HTLPHSATRAAML
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAML  158



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 5/152 (3%)
 Frame = +1

Query  202  ENGHSNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  378
            ENG+  D C+K  DPL+W +AA++LKGSHL+EVKRMVAE+R P VK+GG+TLT++QVAAI
Sbjct  9    ENGNGVDLCMKKEDPLSWGVAAEALKGSHLEEVKRMVAEYRKPVVKLGGETLTISQVAAI  68

Query  379  AARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  555
            +ARD++ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  69   SARDDSGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  128

Query  556  ELIRFLNAGIFGTGT---GHTLPHSATRAAML  642
            ELIRFLNAGIFG+G     +TLPHSATRAAML
Sbjct  129  ELIRFLNAGIFGSGAEAGNNTLPHSATRAAML  160



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 130/167 (78%), Gaps = 15/167 (9%)
 Frame = +1

Query  187  MEGAIENGHSN----DFCIK---------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  327
            ME   +NG  N     FC           VDPLNW   A+SLKGSHLDEVKRMVAE+R P
Sbjct  1    METIAQNGRQNGSLESFCTTASTATKGAVVDPLNWGATAESLKGSHLDEVKRMVAEYRKP  60

Query  328  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  507
            +VK+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGF
Sbjct  61   SVKLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGF  120

Query  508  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            GATSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  121  GATSHRRTKQGAALQKELIRFLNAGIFGNGTESCHTLPHSATRAAML  167



>ref|XP_008449237.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=717

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 128/153 (84%), Gaps = 4/153 (3%)
 Frame = +1

Query  196  AIENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            A +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QV
Sbjct  10   AHQNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQV  69

Query  370  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  549
            AAIA RD+ V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  70   AAIATRDSDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  129

Query  550  QQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            Q+ELIRFLNAGIFG G  + HTLPHSATRAAML
Sbjct  130  QKELIRFLNAGIFGNGAESNHTLPHSATRAAML  162



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 130/158 (82%), Gaps = 7/158 (4%)
 Frame = +1

Query  187  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  355  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  534
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  119

Query  535  NGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAML
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAML  157



>gb|AAL55242.1|AF299330_1 phenylalanine ammonia-lyase [Lactuca sativa]
Length=711

 Score =   231 bits (588),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 5/150 (3%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            NG  N+ CIK DPLNW +AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  8    NGVVNELCIK-DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQVAGIAA  66

Query  385  RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  558
             +++  VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  67   ANDSDTVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  126

Query  559  LIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            LIRFLNAGIFG G  T HTLPHSATRAAM+
Sbjct  127  LIRFLNAGIFGNGTETSHTLPHSATRAAMI  156



>dbj|BAA31258.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=319

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 122/144 (85%), Gaps = 3/144 (2%)
 Frame = +1

Query  217  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  396
              FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  
Sbjct  13   ESFCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGD  71

Query  397  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  576
            V VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI+FLN
Sbjct  72   VGVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIKFLN  131

Query  577  AGIFGTG--TGHTLPHSATRAAML  642
            AGIFG G  + HTLPHS TRAAML
Sbjct  132  AGIFGNGRESCHTLPHSTTRAAML  155



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 128/163 (79%), Gaps = 8/163 (5%)
 Frame = +1

Query  178  NTTMEGAIENGHSNDFCIKV-------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  336
            N   +  I+NG  +  C+K        DPLNW  AA+S+ GSHLDEVKRMVAE+R P VK
Sbjct  7    NGYHQNGIQNGSLDILCVKTESLKAVSDPLNWGAAAESMTGSHLDEVKRMVAEYRKPVVK  66

Query  337  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  516
            +GG+TLT+AQVAAIA  D+ VKVEL E ARAGVKASSDWVM+SMN GTDSYGVTTGFGAT
Sbjct  67   LGGKTLTIAQVAAIANHDSGVKVELDESARAGVKASSDWVMDSMNKGTDSYGVTTGFGAT  126

Query  517  SHRRTKNGHALQQELIRFLNAGIFGTGT-GHTLPHSATRAAML  642
            SHRRTK G ALQ+ELIRFLNAG+FG GT  HTLPH  TRAAML
Sbjct  127  SHRRTKQGAALQKELIRFLNAGVFGKGTESHTLPHPTTRAAML  169



>gb|KGN52973.1| hypothetical protein Csa_4G008760 [Cucumis sativus]
Length=438

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            A +NG     C    DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSVETLCNTHQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLN+GIFG G  + HTLPHSATRAAML
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAML  158



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 127/154 (82%), Gaps = 8/154 (5%)
 Frame = +1

Query  205  NGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            NGHS+ + CIK     DPLNW MAA +L GSHLDEVK+MV EFR PAV++GG+TLTVAQV
Sbjct  9    NGHSDQELCIKGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAVRLGGETLTVAQV  68

Query  370  AAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            AAIA R    V VELSEGARAGVKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69   AAIAGRSGTEVTVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGFGATSHRRTKQGAA  128

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  129  LQKELIRFLNAGIFGNGTESCHTLPHSATRAAML  162



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 122/146 (84%), Gaps = 6/146 (4%)
 Frame = +1

Query  223  FCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  390
            FC       DPLNW M ADSLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA RD
Sbjct  19   FCTATAGHHDPLNWGMLADSLKGSHLDEVKRMVDEYRRPVVRLGGETLTIAQVTAIANRD  78

Query  391  NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRF  570
              +KVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRF
Sbjct  79   AGIKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRF  138

Query  571  LNAGIFGTGT--GHTLPHSATRAAML  642
            LNAGIFG GT   HTLPHSATRAAML
Sbjct  139  LNAGIFGNGTESCHTLPHSATRAAML  164



>gb|KGN52974.1| hypothetical protein Csa_4G008770 [Cucumis sativus]
Length=592

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLN+GIFG G  + HTLPHSATRAAML
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAML  158



>gb|ACT53399.1| phenylalanine ammonia-lyase 2 [Ageratina adenophora]
Length=720

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 126/151 (83%), Gaps = 6/151 (4%)
 Frame = +1

Query  205  NGHSND-FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  381
            NG  ND FCIK DPLNW  AA  L GSHLDEVK+MVAEFR P VK+GG+TLTVAQVA IA
Sbjct  16   NGVVNDPFCIK-DPLNWGAAAAELTGSHLDEVKKMVAEFRKPVVKLGGETLTVAQVAGIA  74

Query  382  ARD--NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  555
            A D  +AVKVELSE ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  75   AADGGSAVKVELSEAARAGVAASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  134

Query  556  ELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  135  ELIRFLNAGIFGNGTESSHTLPHSATRAAML  165



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 134/156 (86%), Gaps = 4/156 (3%)
 Frame = +1

Query  187  MEGAIENGH-SNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            M  A+ENGH SN  C+K  DPLNW  AADSLKGSHLDEVK+MV EFR   VK+GG+TLT+
Sbjct  1    MAPAVENGHFSNGLCVKQSDPLNWGAAADSLKGSHLDEVKKMVEEFRKSVVKLGGETLTI  60

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            AQVAAIAARDNAV VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIAARDNAVAVELAEAARAGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQG  120

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  121  GALQKELIRFLNAGIFGKGTESCHTLPHSATRAAML  156



>ref|XP_008449239.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=711

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  20   DPLNWGLAADSLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDTDVIVELSE  79

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  80   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  139

Query  598  --TGHTLPHSATRAAML  642
              + H LPHSATRAAML
Sbjct  140  AESNHILPHSATRAAML  156



>ref|XP_008454139.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=708

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 126/152 (83%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            A +NG S   C+   DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  2    ACQNGSSESLCMNGQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  61

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  62   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  121

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLN+GIFG G  + HTLPHSATRAAML
Sbjct  122  KELIRFLNSGIFGNGSESNHTLPHSATRAAML  153



>ref|XP_004143257.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156292.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=710

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = +1

Query  205  NGHSND-FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  378
            NGH  D  C    DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAI
Sbjct  6    NGHIEDNLCHTHSDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAI  65

Query  379  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  558
            A RD+ V VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  66   ATRDSDVIVELSESARVGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKE  125

Query  559  LIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            LIRFLNAGIFG+G  + HTLPHSATRAAML
Sbjct  126  LIRFLNAGIFGSGAESDHTLPHSATRAAML  155



>gb|AAV98199.1| phenylalanine ammonialyase 1 [Petunia x hybrida]
Length=718

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 132/163 (81%), Gaps = 11/163 (7%)
 Frame = +1

Query  187  MEGAIEN--GH-SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  342
            ME A EN  GH S D C+K     +DPLNW MAAD+LKGSHLDEVKRMV EFR P V++G
Sbjct  1    MEYANENCNGHASQDICVKGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLG  60

Query  343  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  519
            G+TLTVAQVAAIA++    V V+LSE +RAGVKASSDWV+  M NGTDSYGVTTGFGATS
Sbjct  61   GETLTVAQVAAIASQSGTDVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATS  120

Query  520  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            HRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  121  HRRTKEGAALQKELIRFLNAGIFGNGTESSHTLPHSATRAAML  163



>gb|AEC11891.1| PAL1 [Petunia exserta]
 gb|AEC11892.1| PAL1 [Petunia axillaris]
Length=718

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 132/163 (81%), Gaps = 11/163 (7%)
 Frame = +1

Query  187  MEGAIEN--GH-SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  342
            ME A EN  GH S D C+K     +DPLNW MAAD+LKGSHLDEVKRMV EFR P V++G
Sbjct  1    MEYANENCNGHASQDICVKGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLG  60

Query  343  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  519
            G+TLTVAQVAAIA++    V V+LSE +RAGVKASSDWV+  M NGTDSYGVTTGFGATS
Sbjct  61   GETLTVAQVAAIASQSGTDVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATS  120

Query  520  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            HRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  121  HRRTKEGAALQKELIRFLNAGIFGNGTESSHTLPHSATRAAML  163



>ref|XP_003521396.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=716

 Score =   229 bits (585),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 127/156 (81%), Gaps = 8/156 (5%)
 Frame = +1

Query  199  IENGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            I NG  N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+
Sbjct  6    ITNGSQNGSFCLSTTKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTI  65

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            AQVAA+A  D  V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G
Sbjct  66   AQVAAVAGHDLGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQG  125

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  126  GALQKELIRFLNAGIFGNGTESSHTLPHTATRAAML  161



>dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata]
Length=715

 Score =   229 bits (584),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/155 (73%), Positives = 128/155 (83%), Gaps = 7/155 (5%)
 Frame = +1

Query  199  IENGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            + NG+ N  FC       DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+A
Sbjct  6    LTNGNQNGSFCFTSTKTSDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIA  65

Query  364  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            QVA ++A D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  66   QVAGVSAHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  125

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  126  ALQKELIRFLNAGIFGNGTESCHTLPHTATRAAML  160



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 122/142 (86%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW +AA+ LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGVAAEELKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREEDVT  73

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAG  133

Query  583  IFGTGTG--HTLPHSATRAAML  642
            IFG GT   HTLPHSATRAAML
Sbjct  134  IFGNGTDSCHTLPHSATRAAML  155



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 132/160 (83%), Gaps = 8/160 (5%)
 Frame = +1

Query  187  MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            ME   +NGH N      CI ++DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1    METVTKNGHQNGSLESLCINQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  352  LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  528
            LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61   LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  529  TKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            TK G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  TKQGGALQRELIRFLNAGIFGNGTETCHTLPHSATRAAML  160



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 133/155 (86%), Gaps = 9/155 (6%)
 Frame = +1

Query  205  NGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            NGH+N    D C+K  DPLNW +AA++L GSHLDEVKRMVAE+R P VK+ G+TLT++QV
Sbjct  9    NGHANGNGLDLCMKKEDPLNWGVAAEALTGSHLDEVKRMVAEYRKPVVKLEGETLTISQV  68

Query  370  AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            AAI+ARD++ VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69   AAISARDDSGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGA  128

Query  547  LQQELIRFLNAGIFGTGT---GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG+G     +TLPHSATRAAML
Sbjct  129  LQKELIRFLNAGIFGSGAEAGNNTLPHSATRAAML  163



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 132/152 (87%), Gaps = 5/152 (3%)
 Frame = +1

Query  202  ENGHSNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  378
            ENG+  D C+K  DPL+W +AA++L GSHL+EVKRMVAE+R P VK+GG+TLT++QVAAI
Sbjct  9    ENGNGVDLCMKKEDPLSWGVAAEALTGSHLEEVKRMVAEYRKPVVKLGGETLTISQVAAI  68

Query  379  AARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  555
            +ARD++ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  69   SARDDSGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  128

Query  556  ELIRFLNAGIFGTGT---GHTLPHSATRAAML  642
            ELIRFLNAGIFG+G     +TLPHSATRAAML
Sbjct  129  ELIRFLNAGIFGSGAEAGNNTLPHSATRAAML  160



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 126/157 (80%), Gaps = 11/157 (7%)
 Frame = +1

Query  205  NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            NG +ND          C   DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG++LT
Sbjct  9    NGINNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMVDEYRRPVVKLGGESLT  68

Query  358  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69   IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAML
Sbjct  129  GGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAML  165



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
             + N  +N+  +   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVA
Sbjct  18   CVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVA  77

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIAA D+ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  78   AIAAHDHGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  137

Query  553  QELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            +ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  138  KELIRFLNAGIFGNGTESSHTLPHTATRAAML  169



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
             + N  +N+  +   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVA
Sbjct  18   CVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVA  77

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIAA D+ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  78   AIAAHDHGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  137

Query  553  QELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            +ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  138  KELIRFLNAGIFGNGTESSHTLPHTATRAAML  169



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 7/148 (5%)
 Frame = +1

Query  220  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-  390
            D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TL+VAQVA+IA  D 
Sbjct  2    DLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSVAQVASIANVDD  61

Query  391  --NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
              N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRTKNG ALQ+ELI
Sbjct  62   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRTKNGGALQKELI  121

Query  565  RFLNAGIFGTG--TGHTLPHSATRAAML  642
            RFLNAG+FG G  + HTLPHSATRAAML
Sbjct  122  RFLNAGVFGNGIESFHTLPHSATRAAML  149



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 126/155 (81%), Gaps = 9/155 (6%)
 Frame = +1

Query  205  NGH--SNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            NGH  S +FCIK     DPLNW MAAD+LKGSHLDEVK+MV EFR P V++GG+TLT+ Q
Sbjct  9    NGHNASQEFCIKGHEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKPVVRLGGETLTIGQ  68

Query  367  VAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            VAAIA R    V VEL+E ARAGVKASSDWV+  M NGTDSYGVTTGFGATSHRRTK G 
Sbjct  69   VAAIAGRSGTEVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTTGFGATSHRRTKQGA  128

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  129  ALQKELIRFLNAGIFGNGTESSHTLPHSATRAAML  163



>gb|AAR31107.1| phenylalanine ammonia-lyase [Quercus suber]
Length=709

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = +1

Query  187  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            ME    NG S + C   DPLNW +AA+ LKGSHLDEVKRMV EFR P VK GG++LT+AQ
Sbjct  1    MEYCNGNGSSVNSCKSSDPLNWGLAAEGLKGSHLDEVKRMVDEFRKPLVKPGGKSLTIAQ  60

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAAIA++D A+KVEL+E ARAGVKASSDWVM SM+ G DSYGVTTGFGATSHRRTK G A
Sbjct  61   VAAIASQDGAIKVELAEEARAGVKASSDWVMGSMDKGKDSYGVTTGFGATSHRRTKQGGA  120

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  121  LQRELIRFLNAGIFGNGTESCHTLPHTATRAAML  154



>gb|ACT32033.1| phenylalanine ammonia-lyase [Glycine soja]
Length=712

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 127/153 (83%), Gaps = 7/153 (5%)
 Frame = +1

Query  205  NGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            NGH N  FC+      DPLNW  AA+++KGSHLDEVKRMV+E+R P V++GG+TLT+AQV
Sbjct  5    NGHQNGSFCLSSTKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQV  64

Query  370  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  549
            AA+A  D+ V VELSE AR GVKASS+WVMNSMNN TDSYGVTTGFGATSHRRTK G AL
Sbjct  65   AAVAGHDHGVTVELSESAREGVKASSEWVMNSMNNRTDSYGVTTGFGATSHRRTKQGGAL  124

Query  550  QQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            Q+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  125  QKELIRFLNAGIFGNGTESSHTLPHTATRAAML  157



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 122/138 (88%), Gaps = 2/138 (1%)
 Frame = +1

Query  235  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  414
            VDPLNW +AA+SLKGSHLDEVKRMVAE+R P VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  23   VDPLNWGVAAESLKGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLGVKVELS  82

Query  415  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  594
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRT  G ALQ+ELIRFLNAGIFG 
Sbjct  83   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTNQGAALQKELIRFLNAGIFGN  142

Query  595  GT--GHTLPHSATRAAML  642
            GT   HTLPHSATRAAML
Sbjct  143  GTESCHTLPHSATRAAML  160



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT+ QV AIA+ D+ V+VELSE
Sbjct  16   DPLNWNFAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIGQVTAIASHDSGVRVELSE  75

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGV+ASSDWVM SM NGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  76   TARAGVQASSDWVMESMKNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  135

Query  598  T--GHTLPHSATRAAML  642
            T   HTLPHSATRAAML
Sbjct  136  TESCHTLPHSATRAAML  152



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 125/157 (80%), Gaps = 11/157 (7%)
 Frame = +1

Query  205  NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            NG  ND          C   DPLNW +AADSLKGSHLDEVKRM+ E+R P VK+GG++LT
Sbjct  9    NGIKNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLT  68

Query  358  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69   IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAML
Sbjct  129  GGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAML  165



>dbj|BAJ17655.1| phenylalanine ammonia lyase [Gynura bicolor]
Length=726

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 127/148 (86%), Gaps = 5/148 (3%)
 Frame = +1

Query  211  HSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  390
            H +D CIK D LNW +AA++L GSHLDEVK+MVAEFRNP VKIGG+TLTV+QVA IAA  
Sbjct  25   HVHDLCIK-DTLNWGVAAEALTGSHLDEVKKMVAEFRNPVVKIGGETLTVSQVAGIAAAS  83

Query  391  NA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
            ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  84   DSSTVKVELSEAARAGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGGALQKELI  143

Query  565  RFLNAGIFGTGT--GHTLPHSATRAAML  642
            RFLNAGIFG GT   HTLPHSATRAAML
Sbjct  144  RFLNAGIFGNGTESSHTLPHSATRAAML  171



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 125/157 (80%), Gaps = 11/157 (7%)
 Frame = +1

Query  205  NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            NG  ND          C   DPLNW +AADSLKGSHLDEVKRM+ E+R P VK+GG++LT
Sbjct  9    NGIKNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLT  68

Query  358  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69   IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAML
Sbjct  129  GGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAML  165



>gb|AHA42443.1| phenylalanine ammonia lyase [Cannabis sativa]
Length=707

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+K DPLNW +AA+S+ GSHLDEVKRMVAE+R P V +GG+TLT++QVAAIAA D  VK
Sbjct  12   FCVKGDPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAIAAAD-GVK  70

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE  RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAG
Sbjct  71   VELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAG  130

Query  583  IFGTGT--GHTLPHSATRAAML  642
            IFG GT   HTLPHS+TRA +L
Sbjct  131  IFGHGTESCHTLPHSSTRAGLL  152



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 131/162 (81%), Gaps = 15/162 (9%)
 Frame = +1

Query  202  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            +NGH N      + C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+ G+T
Sbjct  7    QNGHVNGEVVAMELCKKSINVHDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLEGET  66

Query  352  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  522
            LTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFG TSH
Sbjct  67   LTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSH  126

Query  523  RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            RRTKNG+ALQ++LIRFLNAG+FG GT   HTLPHSATRAAML
Sbjct  127  RRTKNGNALQKDLIRFLNAGVFGNGTELSHTLPHSATRAAML  168



>gb|AID51445.1| phenylalanine ammonia-lyase 2 [Astragalus membranaceus]
Length=718

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 129/155 (83%), Gaps = 9/155 (6%)
 Frame = +1

Query  205  NGHSNDFCIK------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            N +   FC+K       DPLNW +AA+S+KGSHLDEVKRMV E+R P V++GG+TLT++Q
Sbjct  9    NFNGGSFCLKNSTINASDPLNWGVAAESMKGSHLDEVKRMVEEYRTPVVRLGGETLTISQ  68

Query  367  VAAIA-ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  543
            VAAIA A D+ V+VELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  69   VAAIAGAYDDGVRVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  128

Query  544  ALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            ALQ+ELIRFLNAGIFG GT   HTLP +ATRAAML
Sbjct  129  ALQKELIRFLNAGIFGNGTESSHTLPQTATRAAML  163



>ref|XP_009596642.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=719

 Score =   228 bits (582),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 127/156 (81%), Gaps = 10/156 (6%)
 Frame = +1

Query  205  NGHSN---DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            NGH+N   + CIK     DPLNW MAAD+LKGSHLDEVK+MV EFR P V++GG+TLT+A
Sbjct  9    NGHNNASQELCIKGNEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKPVVQLGGETLTIA  68

Query  364  QVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            QVAAIA R    V VEL+E ARAGVKASSDWV+  M NGTDSYGVTTGFGATSHRRTK G
Sbjct  69   QVAAIAGRSGTEVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTTGFGATSHRRTKQG  128

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG GT   HTLPHSATRAAML
Sbjct  129  AALQKELIRFLNAGIFGNGTESCHTLPHSATRAAML  164



>emb|CBI31445.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   226 bits (575),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRMV E+R   V++GG+TLT++QVAA+A+RD  V VELSE
Sbjct  32   DPLNWNMAAESLKGSHLDEVKRMVEEYRRQVVQLGGETLTISQVAAVASRDTGVTVELSE  91

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             AR GVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ ELIRFLNAGIFG G
Sbjct  92   EAREGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQMELIRFLNAGIFGNG  151

Query  598  T--GHTLPHSATRAAML  642
            T   HTLPHSATRA+ML
Sbjct  152  TESCHTLPHSATRASML  168



>gb|AER58180.1| phenylalanine ammonia lyase [Cucumis sativus]
Length=713

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLN+GIFG G  + HTLPHSATRAAML
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAML  158



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = +1

Query  220  DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-N  393
            D CI K DPL+W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT++QVAAI+ARD +
Sbjct  2    DLCINKEDPLSWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLTISQVAAISARDGS  61

Query  394  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFL  573
             V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFL
Sbjct  62   GVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFL  121

Query  574  NAGIFGTGTGHTLPHSATRAAML  642
            NAGIFG G+ +TLPHSATRAAML
Sbjct  122  NAGIFGNGSDNTLPHSATRAAML  144



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 131/167 (78%), Gaps = 15/167 (9%)
 Frame = +1

Query  187  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  336
            M   + NGH+N      D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK
Sbjct  1    MASIVPNGHANGKVVAMDLCKKSIIVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  60

Query  337  IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  507
            +GG+TLT+AQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  508  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G TSHRRT NG ALQ++LIRFLNAG+ G GT   HTLPHSATRAAML
Sbjct  121  GDTSHRRTTNGSALQKDLIRFLNAGVLGNGTESSHTLPHSATRAAML  167



>ref|XP_004152155.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLN+GIFG G  + HTLPHSATRAAML
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAML  158



>ref|XP_004152158.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSVETLCNTHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLN+GIFG G  + HTLPHSATRAAML
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAML  158



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 123/138 (89%), Gaps = 2/138 (1%)
 Frame = +1

Query  235  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  414
            VDPLNW +AA+SL+GSHLDEVKRMVAE+R P VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  29   VDPLNWGVAAESLQGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLGVKVELS  88

Query  415  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  594
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG 
Sbjct  89   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGN  148

Query  595  G--TGHTLPHSATRAAML  642
            G  + HTLPHSATRAAML
Sbjct  149  GIESCHTLPHSATRAAML  166



>ref|XP_008449238.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis melo]
Length=708

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  17   DPLNWGVAAEALKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDTDVIVELSE  76

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  77   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  136

Query  598  --TGHTLPHSATRAAML  642
              + HTLPHSATRAAML
Sbjct  137  AESNHTLPHSATRAAML  153



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 121/145 (83%), Gaps = 3/145 (2%)
 Frame = +1

Query  214  SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  393
            S  FCI  DPLNW  +A+SLKGSHLDEVKRMV EFR P V++GG+TLT+AQVAAIA RD 
Sbjct  15   SPGFCI-TDPLNWGASAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTIAQVAAIANRDA  73

Query  394  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFL  573
             VKVELSE AR  VKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFL
Sbjct  74   GVKVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGAALQKELIRFL  133

Query  574  NAGIFGTGT--GHTLPHSATRAAML  642
            NAG+FG GT   HTLPH+ATRAAML
Sbjct  134  NAGVFGQGTESCHTLPHTATRAAML  158



>gb|KGN48162.1| hypothetical protein Csa_6G445750 [Cucumis sativus]
Length=708

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD+ V VELSE
Sbjct  17   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDSDVIVELSE  76

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  77   SARVGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  136

Query  598  --TGHTLPHSATRAAML  642
              + HTLPHSATRAAML
Sbjct  137  AESDHTLPHSATRAAML  153



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   228 bits (580),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 130/161 (81%), Gaps = 13/161 (8%)
 Frame = +1

Query  199  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  355  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  525
            T+AQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFG TSHR
Sbjct  66   TIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSHR  125

Query  526  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            RT NG ALQ++LIRFLNAG+ G GT   HTLPHSATRAAML
Sbjct  126  RTTNGSALQKDLIRFLNAGVLGNGTESSHTLPHSATRAAML  166



>emb|CDX91331.1| BnaC04g08190D [Brassica napus]
Length=380

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 116/137 (85%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N VKVELSE
Sbjct  28   DPLNWGAAAEQMKGSHLDEVKRMVMEFRKPVVNLGGETLTIGQVAAISTVGNGVKVELSE  87

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT-  594
             ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  88   TARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  147

Query  595  -GTGHTLPHSATRAAML  642
              T HTLPHSATRAAML
Sbjct  148  KETCHTLPHSATRAAML  164



>emb|CDX74991.1| BnaA05g07370D [Brassica napus]
Length=380

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 116/137 (85%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N VKVELSE
Sbjct  28   DPLNWGAAAEQMKGSHLDEVKRMVMEFRKPVVNLGGETLTIGQVAAISTVGNGVKVELSE  87

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT-  594
             ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  88   TARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  147

Query  595  -GTGHTLPHSATRAAML  642
              T HTLPHSATRAAML
Sbjct  148  KETCHTLPHSATRAAML  164



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPL+W +AA+S+KGSHL+EVKRMVAE+R P VK+GG+TLT+AQVAAIAA +  V VEL E
Sbjct  13   DPLSWGVAAESMKGSHLNEVKRMVAEYRKPVVKLGGETLTIAQVAAIAANEQGVSVELCE  72

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+ALQ ELIRFLNAGIFG G
Sbjct  73   SARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNALQLELIRFLNAGIFGNG  132

Query  598  T--GHTLPHSATRAAML  642
            T   HTLP  ATRAAML
Sbjct  133  TESTHTLPQPATRAAML  149



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +1

Query  193  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            G++   +S   C+  DPLNW MAA+S+KGSHLDEVKRMV E+R   V++GG++LT++QVA
Sbjct  2    GSLVQENSIALCLNKDPLNWNMAAESMKGSHLDEVKRMVEEYRKGVVRLGGESLTISQVA  61

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA+ D  V VEL+E +RAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  62   AIASHDQGVMVELNESSRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQ  121

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLNAG+FG G  T HTLPHSATRAAML
Sbjct  122  KELIRFLNAGVFGNGTETSHTLPHSATRAAML  153



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 133/167 (80%), Gaps = 14/167 (8%)
 Frame = +1

Query  184  TMEGAIENGHSND-FCI-----------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  327
            T+  AI    +N+ FC+           + DPLNW +AA+++KGSH+DEVKRMV E+R P
Sbjct  3    TISAAITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHIDEVKRMVEEYRKP  62

Query  328  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  507
             V++GG+TLT++QVAAIAA D+ V+VELSE ARAGV+ASSDWVM SMN GTDSYGVTTGF
Sbjct  63   VVRLGGETLTISQVAAIAAHDHGVQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGF  122

Query  508  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            GATSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  123  GATSHRRTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAML  169



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   226 bits (577),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 8/160 (5%)
 Frame = +1

Query  187  MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            ME   +NG+ N      C+ ++DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1    METVTKNGYQNGSLESLCVNQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  352  LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  528
            LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61   LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  529  TKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            TK G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  TKQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAML  160



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRMV E+R   V++GG+TLT++QVAA+A+RD  V VELSE
Sbjct  32   DPLNWNMAAESLKGSHLDEVKRMVEEYRRQVVQLGGETLTISQVAAVASRDTGVTVELSE  91

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             AR GVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ ELIRFLNAGIFG G
Sbjct  92   EAREGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQMELIRFLNAGIFGNG  151

Query  598  T--GHTLPHSATRAAML  642
            T   HTLPHSATRA+ML
Sbjct  152  TESCHTLPHSATRASML  168



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 133/167 (80%), Gaps = 14/167 (8%)
 Frame = +1

Query  184  TMEGAIENGHSND-FCI-----------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  327
            T+  AI    +N+ FC+           + DPLNW +AA+++KGSHLDEVKRMV E+R P
Sbjct  3    TISAAITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHLDEVKRMVEEYRKP  62

Query  328  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  507
             V++GG+TLT++QVAAIAA D+ V+VELSE ARAGV+ASSDWVM SMN GTDSYGVTTGF
Sbjct  63   VVRLGGETLTISQVAAIAAHDHGVQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGF  122

Query  508  GATSHRRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            GATSHRRTK G ALQ+ELIRFLNAGIFG G  + HTLPH+ATRAAML
Sbjct  123  GATSHRRTKQGGALQKELIRFLNAGIFGKGSESSHTLPHTATRAAML  169



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 125/148 (84%), Gaps = 7/148 (5%)
 Frame = +1

Query  220  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-  390
            D C K   DPLNWEMAADSL+ SHLDEVK+MV EFR P VK+GG+TL+VAQVA+IA  D 
Sbjct  2    DLCKKSINDPLNWEMAADSLRQSHLDEVKKMVDEFRKPIVKLGGETLSVAQVASIANVDD  61

Query  391  --NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
              N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRTKNG ALQ+ELI
Sbjct  62   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRTKNGGALQKELI  121

Query  565  RFLNAGIFGTG--TGHTLPHSATRAAML  642
            RFLNAG+FG G  + HTLPHSATRAAML
Sbjct  122  RFLNAGVFGNGIESFHTLPHSATRAAML  149



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 119/137 (87%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIASRDIGVKVELSE  79

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  598  TG--HTLPHSATRAAML  642
            T   HTLPHSA+RAAML
Sbjct  140  TESTHTLPHSASRAAML  156



>gb|KDP44384.1| hypothetical protein JCGZ_20064 [Jatropha curcas]
Length=712

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW   A+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+AQV AIA RD  VKVELSE
Sbjct  21   DPLNWGAVAESLKGSHLDEVKRMINEYRKPVVKLGGETLTIAQVTAIANRDAGVKVELSE  80

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  81   AARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNG  140

Query  598  --TGHTLPHSATRAAML  642
              T H LPHSATRAAML
Sbjct  141  TETCHILPHSATRAAML  157



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 123/142 (87%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  583  IFGTGT--GHTLPHSATRAAML  642
            IFG GT   HTLPHSATRAAML
Sbjct  134  IFGNGTESCHTLPHSATRAAML  155



>ref|XP_008454138.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSVESLCNSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  553  QELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            +ELIRFLN+GIFG G  + HTLPHSATRAAML
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSATRAAML  158



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 119/135 (88%), Gaps = 2/135 (1%)
 Frame = +1

Query  244  LNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSEGA  423
            L+W +AA+S+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQVAAIAA D  V VEL E A
Sbjct  1    LSWGVAAESMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQVAAIAANDQGVSVELCESA  60

Query  424  RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG--  597
            RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+ALQ ELIRFLNAGIFG G  
Sbjct  61   RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNALQLELIRFLNAGIFGNGTE  120

Query  598  TGHTLPHSATRAAML  642
            T HTLP  ATRAAML
Sbjct  121  TNHTLPQPATRAAML  135



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 123/142 (87%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPLVRLGGETLTISQVAAIAGREGDVS  73

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  583  IFGTGT--GHTLPHSATRAAML  642
            IFG GT   HTLPHSATRAAML
Sbjct  134  IFGNGTESCHTLPHSATRAAML  155



>sp|Q9M568.1|PAL1_RUBID RecName: Full=Phenylalanine ammonia-lyase 1; AltName: Full=RiPAL1 
[Rubus idaeus]
 gb|AAF40223.1|AF237954_1 phenylalanine ammonia-lyase 1 [Rubus idaeus]
Length=710

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 124/148 (84%), Gaps = 2/148 (1%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            NG    FC   DPLNW MAA+SLKGSH+DE+KRMV+++R P VK+GG+TLT+ QVAAIA+
Sbjct  8    NGAVESFCEGHDPLNWNMAAESLKGSHVDELKRMVSDYRKPVVKLGGETLTIGQVAAIAS  67

Query  385  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
             D  V+VELSE  RAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  68   HDGGVRVELSEEKRAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKNGGALQRELI  127

Query  565  RFLNAGIFGTG--TGHTLPHSATRAAML  642
            RFLNAGIFG+   + H LPH+ATRAAML
Sbjct  128  RFLNAGIFGSSLDSTHKLPHTATRAAML  155



>gb|EYU34451.1| hypothetical protein MIMGU_mgv1a002104mg [Erythranthe guttata]
Length=714

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 131/154 (85%), Gaps = 5/154 (3%)
 Frame = +1

Query  196  AIENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            A ENGH  SN +C+K  DPLNW +AA+ LKGSHLDEVKRMV EFR P V +GG+TLT+AQ
Sbjct  6    ATENGHHNSNGYCVKQKDPLNWGLAAEGLKGSHLDEVKRMVEEFRKPVVNLGGKTLTIAQ  65

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAAIAA DNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  66   VAAIAATDNAVAVELAEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGA  125

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   H LPHSATRAAML
Sbjct  126  LQKELIRFLNAGIFGNGTESSHMLPHSATRAAML  159



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 119/137 (87%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P +K+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVIKLGGETLTIGQVTAIASRDVGVKVELSE  79

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  598  T--GHTLPHSATRAAML  642
            T   HTLPHSA+RAAML
Sbjct  140  TESTHTLPHSASRAAML  156



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 129/157 (82%), Gaps = 10/157 (6%)
 Frame = +1

Query  202  ENGHSN--DFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            E+G+ N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ESGYQNGVEFCIGARSNSNNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  358  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLNAG+FG GT   HTLPHS+TRAAML
Sbjct  123  GGALQRELIRFLNAGVFGRGTESSHTLPHSSTRAAML  159



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 130/161 (81%), Gaps = 10/161 (6%)
 Frame = +1

Query  190  EGAIENGHSNDFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            +   +NG  N  C         DPL+W +AA+S+KGSHLDEVKRMVAEFR P VK+GG+T
Sbjct  6    QNGFKNGSLNSLCTDSESIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGET  65

Query  352  LTVAQVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  525
            LTVAQVAAIAA + +  ++VEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHR
Sbjct  66   LTVAQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  125

Query  526  RTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            RTK G ALQ+ELIRFLNAGIFG G  T H LPHSAT+AAM+
Sbjct  126  RTKQGGALQKELIRFLNAGIFGNGTETSHILPHSATKAAMI  166



>gb|ACT21093.1| phenylalanine ammonia-lyase [Camellia oleifera]
Length=706

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 129/154 (84%), Gaps = 5/154 (3%)
 Frame = +1

Query  187  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  366
            ME   ENG+ N   IK DPL+WE+AADS+KGSHLDEVKRMV EFR PA+++GG+TLT++Q
Sbjct  1    MEFCHENGNGNGHVIK-DPLSWELAADSMKGSHLDEVKRMVREFRQPAIRLGGETLTISQ  59

Query  367  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  546
            VAA+AA    + VELSE ARA V+ASS+WVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  60   VAAVAA--GCLPVELSEAARAAVQASSEWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  117

Query  547  LQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            LQ+ELIRFLNAGIFG GT   HTLPHS+TRAAML
Sbjct  118  LQKELIRFLNAGIFGNGTESCHTLPHSSTRAAML  151



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 130/161 (81%), Gaps = 10/161 (6%)
 Frame = +1

Query  190  EGAIENGHSNDFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            +   +NG  N  C         DPL+W +AA+S+KGSHLDEVKRMVAEFR P VK+GG+T
Sbjct  6    QNGFKNGSLNSLCTDSESIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGET  65

Query  352  LTVAQVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  525
            LTVAQVAAIAA + +  ++VEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHR
Sbjct  66   LTVAQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  125

Query  526  RTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            RTK G ALQ+ELIRFLNAGIFG G  T H LPHSAT+AAM+
Sbjct  126  RTKQGGALQKELIRFLNAGIFGNGTETSHILPHSATKAAMI  166



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 123/142 (87%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  583  IFGTGT--GHTLPHSATRAAML  642
            IFG GT   HTLPHSATRAAML
Sbjct  134  IFGNGTESCHTLPHSATRAAML  155



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 4/144 (3%)
 Frame = +1

Query  217  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  396
            N  C++ DPLNW MAA++L GSHLDEVKRMVAEFR P V++GG+TLTV+QVAAIAA   +
Sbjct  12   NGLCMQKDPLNWGMAAEALTGSHLDEVKRMVAEFRKPMVQLGGETLTVSQVAAIAA--GS  69

Query  397  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  576
            VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLN
Sbjct  70   VKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLN  129

Query  577  AGIFGTG--TGHTLPHSATRAAML  642
            AGIFG+G  + + LPHSATRAAML
Sbjct  130  AGIFGSGNDSSNILPHSATRAAML  153



>ref|XP_008454137.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 125/152 (82%), Gaps = 3/152 (2%)
 Frame = +1

Query  196  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            A +NG +   C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSTESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  553  QELIRFLNAGIFG--TGTGHTLPHSATRAAML  642
            +ELIRFLN+GIFG  + + HTLPHSATRAAML
Sbjct  127  KELIRFLNSGIFGNESESNHTLPHSATRAAML  158



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 130/164 (79%), Gaps = 13/164 (8%)
 Frame = +1

Query  190  EGAIENGHSND-FCIKV----------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  336
            +  I+NG  +D  CIK           DPLNW  AA+S+ GSHLDEV+RMVAE+R P VK
Sbjct  12   QNGIQNGSLDDGLCIKTESIKTGYSVSDPLNWGAAAESMTGSHLDEVRRMVAEYRKPVVK  71

Query  337  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  516
            +GG+TLT++QVAAIA  D+ VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGAT
Sbjct  72   LGGETLTISQVAAIANHDSGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGAT  131

Query  517  SHRRTKNGHALQQELIRFLNAGIF--GTGTGHTLPHSATRAAML  642
            SHRRTK G ALQ+ELIRFLNAG+   GT + HTLPHSATRAAML
Sbjct  132  SHRRTKQGAALQKELIRFLNAGVLRNGTESAHTLPHSATRAAML  175



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 131/160 (82%), Gaps = 8/160 (5%)
 Frame = +1

Query  187  MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  351
            ME   +NG+ N      C+ + DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1    METVTKNGYQNGSLESLCVNQRDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  352  LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  528
            LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61   LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  529  TKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            TK G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  TKQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAML  160



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 128/166 (77%), Gaps = 19/166 (11%)
 Frame = +1

Query  202  ENGHSNDFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            E+ +S+ FC       DPL+W +AADS+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQV
Sbjct  10   ESLNSSIFCTAAKAGSDPLSWGVAADSMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQV  69

Query  370  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  549
            AAIAA D  V VEL E ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+AL
Sbjct  70   AAIAANDQGVSVELCESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNAL  129

Query  550  QQELI-------------RFLNAGIFGTG--TGHTLPHSATRAAML  642
            Q ELI             RFLNAGIFG G  T HTLP  ATRAAML
Sbjct  130  QLELIRIKVVDVNMFLFFRFLNAGIFGNGTETSHTLPQPATRAAML  175



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 127/157 (81%), Gaps = 3/157 (2%)
 Frame = +1

Query  181  TTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTLT+
Sbjct  3    TITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTLTI  62

Query  361  AQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK 
Sbjct  63   AQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQ  122

Query  538  GHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  123  GGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAML  159



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  175  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTL
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTL  60

Query  355  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  532  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAML  159



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 127/159 (80%), Gaps = 3/159 (2%)
 Frame = +1

Query  175  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTL
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTL  60

Query  355  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  532  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAML  159



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  583  IFGTG--TGHTLPHSATRAAML  642
            IFG G  + HTLPHSATRAAML
Sbjct  134  IFGNGRESCHTLPHSATRAAML  155



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            NG  +  C+K DPLNW +AA+SL+GSHLDEVKRMV EF  P VK+ GQ+LT++QVAA+A 
Sbjct  14   NGSIDGLCMKSDPLNWGLAAESLQGSHLDEVKRMVNEFHKPIVKLEGQSLTISQVAAVAM  73

Query  385  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
            R + ++VELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  74   RADGIEVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQKELI  133

Query  565  RFLNAGIFGTGT--GHTLPHSATRAAML  642
            RFLNAG+FG GT   HTLP +ATRAAML
Sbjct  134  RFLNAGVFGNGTESTHTLPQTATRAAML  161



>ref|XP_004143255.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis sativus]
 gb|KGN48160.1| Phenylalanine ammonia-lyase [Cucumis sativus]
Length=714

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 127/157 (81%), Gaps = 10/157 (6%)
 Frame = +1

Query  202  ENGHSN--DFCI------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            E GH N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ELGHQNGVEFCIGGRNNINNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  358  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLNAG+FG GT   HTLPH ATRAAML
Sbjct  123  GGALQRELIRFLNAGVFGNGTESSHTLPHLATRAAML  159



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 119/137 (87%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRM+ E+RNP VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRNPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  598  T--GHTLPHSATRAAML  642
            T   HTLP SATRAAML
Sbjct  140  TESSHTLPRSATRAAML  156



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW  AA++LKGSHLDEVKRMV+E+R P V +GGQTLT++QVAAIAA D  V V+LSE
Sbjct  24   DPLNWAAAAEALKGSHLDEVKRMVSEYRKPLVNLGGQTLTISQVAAIAANDQGVSVQLSE  83

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             +RAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  84   ASRAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  143

Query  598  --TGHTLPHSATRAAML  642
              T  TLPH+ATRAAML
Sbjct  144  TETNCTLPHTATRAAML  160



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  583  IFGTG--TGHTLPHSATRAAML  642
            IFG G  + HTLPHSATRAAML
Sbjct  134  IFGNGRESCHTLPHSATRAAML  155



>gb|AJO53272.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 128/156 (82%), Gaps = 8/156 (5%)
 Frame = +1

Query  199  IENGHSND-FCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            +ENG++ D  C++     VDPLNW  AA++L+GSHLDEVKRMV EFR P V++GG+TLT+
Sbjct  1    MENGNNGDGLCVQSRNDVVDPLNWNAAAEALRGSHLDEVKRMVEEFRKPVVRLGGETLTI  60

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
             QVAA+A R+ AV VEL+E AR GVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G
Sbjct  61   GQVAAVATREAAVTVELTETAREGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQG  120

Query  541  HALQQELIRFLNAGIFG--TGTGHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG  T + H LPHS TRA+ML
Sbjct  121  GALQKELIRFLNAGIFGNNTESSHMLPHSTTRASML  156



>ref|XP_004156289.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=714

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 127/157 (81%), Gaps = 10/157 (6%)
 Frame = +1

Query  202  ENGHSN--DFCI------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            E GH N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ELGHQNGVEFCIGGRNNINNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  358  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLNAG+FG GT   HTLPH ATRAAML
Sbjct  123  GGALQRELIRFLNAGVFGNGTESSHTLPHLATRAAML  159



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  583  IFGTG--TGHTLPHSATRAAML  642
            IFG G  + HTLPHSATRAAML
Sbjct  134  IFGNGRESCHTLPHSATRAAML  155



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA  D+ V VELSE
Sbjct  32   DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIATHDHGVTVELSE  91

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             +R GVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  92   SSRPGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  151

Query  598  T--GHTLPHSATRAAML  642
            T   HTLPH+ATRAAML
Sbjct  152  TESNHTLPHTATRAAML  168



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 130/163 (80%), Gaps = 11/163 (7%)
 Frame = +1

Query  187  MEGAI-ENGHS-NDFC------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  342
            ME  I +NGH  N  C      +  DPLNW   A+SLKGSHL+EVKRMV E+R P VK+G
Sbjct  1    METTITQNGHHMNGLCMNGSAHVNSDPLNWGYLAESLKGSHLEEVKRMVEEYRKPLVKLG  60

Query  343  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  519
            G+TLT+AQVAA+A    A VKVEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATS
Sbjct  61   GETLTIAQVAAVAGGFEAGVKVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATS  120

Query  520  HRRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            HRRTK G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  HRRTKQGAALQKELIRFLNAGIFGNGTETSHTLPHSATRAAML  163



>ref|XP_004173742.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Cucumis 
sativus]
Length=144

 Score =   208 bits (530),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +1

Query  196  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  372
            A +NG     C+K  DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  2    ACQNGSLESLCMKGQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  61

Query  373  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  552
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  62   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  121

Query  553  QELIRFLNAGIFGTG--TGHTLP  615
            +ELIRFLN+ IFG G  + HTLP
Sbjct  122  KELIRFLNSDIFGNGSESNHTLP  144



>gb|AEJ88223.1| phenylalanine ammonia lyase [Prunus persica]
Length=719

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQVAAIA  D+ V VELSE
Sbjct  28   DPLNWGMAAESLKGSHLDEVKRMVNEYRKPVVRLGGETLTIAQVAAIANHDSGVHVELSE  87

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+ 
Sbjct  88   DARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGSS  147

Query  598  TG--HTLPHSATRAAML  642
            T   HTLPH+ATRAAML
Sbjct  148  TESTHTLPHTATRAAML  164



>emb|CBI26455.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 122/142 (86%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  39   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  97

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  98   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  157

Query  583  IFGTG--TGHTLPHSATRAAML  642
            IFG G  + HTLPHS TRAAML
Sbjct  158  IFGNGRESCHTLPHSTTRAAML  179



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 127/163 (78%), Gaps = 11/163 (7%)
 Frame = +1

Query  187  MEGAIENGHSNDFC---------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  339
            M    +NG  + FC            DPLNW + A+SLKGSHLDEVKRMV E+R P VK+
Sbjct  1    MAAITQNGSFDSFCTTTANGSTAFAADPLNWGIVAESLKGSHLDEVKRMVMEYRKPLVKL  60

Query  340  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  519
            GG+TLT++QVAAIAA D+ VKVELS+ ARA VKAS+DWV++ MN GTDSYGVTTGFGATS
Sbjct  61   GGETLTISQVAAIAAHDSGVKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATS  120

Query  520  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            HRRTK G ALQ+ELIRFLNAGIFG GT   +TLPHSATRAAML
Sbjct  121  HRRTKQGAALQKELIRFLNAGIFGNGTESCNTLPHSATRAAML  163



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 121/142 (85%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVQLGGETLTISQVAAIAGREGDVS  73

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGVKASSDWVM SM  G DSYGVTTGFGATSHRRTK G ALQ+ELIR LNAG
Sbjct  74   VELSETARAGVKASSDWVMESMKKGIDSYGVTTGFGATSHRRTKQGGALQKELIRVLNAG  133

Query  583  IFGTG--TGHTLPHSATRAAML  642
            IFG G  + HTLPHSATRAAML
Sbjct  134  IFGNGRESCHTLPHSATRAAML  155



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = +1

Query  235  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  414
            VDPLNW +AA SL+GSHLDEVKRMVAE+R   VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  29   VDPLNWGVAAKSLQGSHLDEVKRMVAEYRRSLVKLGGETLTISQVAAIATRDLGVKVELS  88

Query  415  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  594
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG 
Sbjct  89   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGN  148

Query  595  G--TGHTLPHSATRAAML  642
            G  + HTLPHSATRAAML
Sbjct  149  GIESCHTLPHSATRAAML  166



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 122/142 (86%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  583  IFGTG--TGHTLPHSATRAAML  642
            IFG G  + HTLPHS TRAAML
Sbjct  134  IFGNGRESCHTLPHSTTRAAML  155



>gb|AAK60274.1|AF383151_1 phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=687

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA  D+ VKVELSE
Sbjct  19   DPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQVTAIANHDSGVKVELSE  78

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWV++SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  79   EARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNG  138

Query  598  --TGHTLPHSATRAAML  642
              + HTL H+ATRAAML
Sbjct  139  QESCHTLSHTATRAAML  155



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 122/142 (86%), Gaps = 3/142 (2%)
 Frame = +1

Query  223  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  402
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVN  73

Query  403  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  582
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  583  IFGTG--TGHTLPHSATRAAML  642
            IFG G  + HTLPHS TRAAML
Sbjct  134  IFGNGRESCHTLPHSTTRAAML  155



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  598  TG--HTLPHSATRAAML  642
            T   HTLPHSA+RAAML
Sbjct  140  TESTHTLPHSASRAAML  156



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 126/159 (79%), Gaps = 3/159 (2%)
 Frame = +1

Query  175  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQ L
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNL  60

Query  355  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  532  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAML  159



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 128/153 (84%), Gaps = 7/153 (5%)
 Frame = +1

Query  202  ENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            +NGH N      C   DPLNW +AA+S+ GSHLDEVK+MVAEFR P VK+GG+TLTVAQV
Sbjct  6    QNGHQNGSLDSLCTARDPLNWGLAAESMSGSHLDEVKKMVAEFRKPLVKLGGETLTVAQV  65

Query  370  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  549
            AAIA R++ ++VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G AL
Sbjct  66   AAIA-RESGLQVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  550  QQELIRFLNAGIFG--TGTGHTLPHSATRAAML  642
            Q+ELIRFLNAGIFG  T + HTL HSATRAAML
Sbjct  125  QRELIRFLNAGIFGNKTESCHTLSHSATRAAML  157



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMINEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  598  T--GHTLPHSATRAAML  642
            T   HTLPHSA+RAAML
Sbjct  140  TESTHTLPHSASRAAML  156



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 127/163 (78%), Gaps = 11/163 (7%)
 Frame = +1

Query  187  MEGAIENGHSNDFC---------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  339
            M    +NG  + FC            DPLNW + A+SLKGSHLDEVKRMV E+R P VK+
Sbjct  1    MAAITQNGSLDSFCTTTANGSTAFAADPLNWGVVAESLKGSHLDEVKRMVMEYRKPLVKL  60

Query  340  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  519
            GG+TLT++QVAAIAA D+ VKVELS+ ARA VKAS+DWV++ MN GTDSYGVTTGFGATS
Sbjct  61   GGETLTISQVAAIAAHDSGVKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATS  120

Query  520  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            HRRTK G ALQ+ELIRFLNAGIFG GT   +TLPHSATRAAML
Sbjct  121  HRRTKQGAALQKELIRFLNAGIFGNGTESCNTLPHSATRAAML  163



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 126/159 (79%), Gaps = 3/159 (2%)
 Frame = +1

Query  175  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  354
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQ L
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNL  60

Query  355  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASDVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  532  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSATRAAML  642
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSATRAAML
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAML  159



>ref|XP_006488063.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Citrus sinensis]
Length=714

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 122/148 (82%), Gaps = 2/148 (1%)
 Frame = +1

Query  205  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  384
            N  S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R   V++GG+TLT+AQVAA+A+
Sbjct  12   NIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKQVVRLGGETLTIAQVAAVAS  71

Query  385  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  564
            RD  V VEL+E ARAGVKASSDWVM SMN GTDSYG+TTGFGATSHRRTK G ALQ+ELI
Sbjct  72   RDGGVTVELNEEARAGVKASSDWVMESMNKGTDSYGITTGFGATSHRRTKQGAALQKELI  131

Query  565  RFLNAGIFGTGT--GHTLPHSATRAAML  642
            RFLNAGIFG GT     LPH+ATRAAML
Sbjct  132  RFLNAGIFGKGTESCQMLPHTATRAAML  159



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 125/157 (80%), Gaps = 11/157 (7%)
 Frame = +1

Query  205  NGHSNDFCIKV---------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  357
            N  + +FC+ V         DPLNW  AA+++ GSHLDEVKRM+ E+R P VK+GG+TLT
Sbjct  6    NAANTNFCVNVSNNGYISANDPLNWGAAAEAMAGSHLDEVKRMLEEYRRPVVKLGGETLT  65

Query  358  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  537
            ++QVAAIAA D  VKVEL+E +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  66   ISQVAAIAAHDQGVKVELAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  125

Query  538  GHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAML
Sbjct  126  GAALQKELIRFLNAGIFGNGTESNCTLPHTATRAAML  162



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 117/137 (85%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW  AA+SLKGSHLDEVKRMV E R P VK+GG+TLT+ QV AIA  D+ ++VELSE
Sbjct  16   DPLNWNFAAESLKGSHLDEVKRMVEESRKPVVKLGGETLTIGQVTAIANHDSGLRVELSE  75

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             AR GV+ASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  76   AARPGVQASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  135

Query  598  T--GHTLPHSATRAAML  642
            T   HTLPHSATRAAML
Sbjct  136  TESCHTLPHSATRAAML  152



>gb|AAW78932.1| phenylalanine-ammonia lyase [Rhodiola sachalinensis]
Length=710

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +1

Query  202  ENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  381
            +NGHS    +  DPL+W +AA+++KGSHLDEVKRMV E+R PAVK+GG+TLT+AQVAAIA
Sbjct  7    QNGHSVANVVVKDPLSWGLAAEAMKGSHLDEVKRMVEEYRKPAVKLGGETLTIAQVAAIA  66

Query  382  ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  561
             R + V+VELSE AR GVKASSDWVM SM  GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  67   GRGSDVRVELSESAREGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKQGGALQKEL  126

Query  562  IRFLNAGIFGTG--TGHTLPHSATRAAML  642
            IRFLNAGIFG+G  T HTL  SATRAAML
Sbjct  127  IRFLNAGIFGSGKDTCHTLSQSATRAAML  155



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 130/164 (79%), Gaps = 15/164 (9%)
 Frame = +1

Query  184  TMEGAIENGHSNDFCIKV---------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  336
            T EG   NG++N FC+ V         DPLNW  AA+++ GSHLDEVKRMV E+R P VK
Sbjct  2    TQEG---NGNTN-FCMSVNNNGYISANDPLNWGAAAEAMAGSHLDEVKRMVEEYRRPVVK  57

Query  337  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  516
            +GG+TLT++QVAAIAA D  VKVEL+E +RAGVKASSDWVM SM+ GTDSYGVTTGFGAT
Sbjct  58   LGGETLTISQVAAIAAHDQGVKVELAESSRAGVKASSDWVMESMDKGTDSYGVTTGFGAT  117

Query  517  SHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            SHRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+ATRAAML
Sbjct  118  SHRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTATRAAML  161



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  598  T--GHTLPHSATRAAML  642
            T   HTLP SATRAAML
Sbjct  140  TESSHTLPRSATRAAML  156



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  598  T--GHTLPHSATRAAML  642
            T   HTLP SATRAAML
Sbjct  140  TESSHTLPRSATRAAML  156



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  598  T--GHTLPHSATRAAML  642
            T   HTLP SATRAAML
Sbjct  140  TESSHTLPRSATRAAML  156



>sp|P45734.1|PALY_TRISU RecName: Full=Phenylalanine ammonia-lyase [Trifolium subterraneum]
 gb|AAA17993.1| phenylalanine ammonia-lyase [Trifolium subterraneum]
Length=725

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 126/149 (85%), Gaps = 6/149 (4%)
 Frame = +1

Query  211  HSNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  381
            H+N   +KV   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA
Sbjct  23   HANANNMKVNAADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIA  82

Query  382  ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  561
            A D A  VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  83   AHDGAT-VELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKEL  141

Query  562  IRFLNAGIFGTGT--GHTLPHSATRAAML  642
            IRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  142  IRFLNAGIFGNGTESNHTLPHTATRAAML  170



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA  D+ VKVELSE
Sbjct  19   DPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQVTAIANHDSGVKVELSE  78

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  597
             ARAGVKASSDWV++SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  79   EARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNG  138

Query  598  --TGHTLPHSATRAAML  642
              + HTL H+ATRAAML
Sbjct  139  QESCHTLSHTATRAAML  155



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   222 bits (566),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 127/156 (81%), Gaps = 3/156 (2%)
 Frame = +1

Query  181  TTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            T +   + +G S  FC+K DPLNW +AA+++KGSHL+EVK MV EFR P V++GG+TLT+
Sbjct  5    TAIGNGVGSGGSPGFCLK-DPLNWGVAAEAMKGSHLEEVKGMVEEFRKPVVRLGGETLTI  63

Query  361  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  540
            +QVAAIA R + V VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  64   SQVAAIAVRGSEVAVELSESAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEG  123

Query  541  HALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
             ALQ+ELIRFLNAGIFG GT   HTLP SATRAAML
Sbjct  124  GALQKELIRFLNAGIFGNGTESCHTLPQSATRAAML  159



>gb|ADD12041.1| phenylalanine ammonia lyase [Cistanche deserticola]
 gb|ADD16918.1| phenylalanine ammonia lyase [Cistanche deserticola]
Length=709

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 130/153 (85%), Gaps = 5/153 (3%)
 Frame = +1

Query  199  IENGH-SNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  369
            +ENGH SN FC+    DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG++LT+AQV
Sbjct  1    MENGHHSNVFCVNENKDPLNWAAAAESLKGSHLDEVKRMVEEFRKPVVKLGGESLTIAQV  60

Query  370  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  549
            AAIAARDNAV VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  61   AAIAARDNAVAVELAEAARDGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  120

Query  550  QQELIRFLNAGIFG--TGTGHTLPHSATRAAML  642
            Q+ELIRFLNAGIFG  T + HTLP SATRAAML
Sbjct  121  QKELIRFLNAGIFGNVTESSHTLPRSATRAAML  153



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 127/160 (79%), Gaps = 13/160 (8%)
 Frame = +1

Query  199  IENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  363
            +ENGH N       C+K DPLNW +AA+ +KGSHLDEVKRMVAEFRNP VK+GG+ LT++
Sbjct  1    MENGHRNGGXVSXLCVK-DPLNWGVAAEGMKGSHLDEVKRMVAEFRNPVVKLGGEGLTIS  59

Query  364  QVAAIAA-----RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  528
            QVAAIA+         VKVEL EGAR  VKASSDWVM SMN GTDSYGVTTGFGATSHRR
Sbjct  60   QVAAIASAGGGETSAGVKVELWEGARERVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  119

Query  529  TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            TK G ALQ+ELIRFLN+GIFG GT   HTLPHSATRAAML
Sbjct  120  TKQGGALQKELIRFLNSGIFGNGTESSHTLPHSATRAAML  159



>sp|P31425.1|PAL1_SOLTU RecName: Full=Phenylalanine ammonia-lyase 1 [Solanum tuberosum]
Length=720

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 127/159 (80%), Gaps = 12/159 (8%)
 Frame = +1

Query  202  ENGHSNDFCIKV-------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  360
            +NGH N    +V       DPLNWEMA DSL+GSHLDEVK+MV EFR P VK+ G+TLTV
Sbjct  7    QNGHVNGEVEEVLWKKSIHDPLNWEMAVDSLRGSHLDEVKKMVDEFRKPIVKLWGETLTV  66

Query  361  AQVAAIAARDNAV---KVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  531
            AQVA+IA  DN     KVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF ATSHRRT
Sbjct  67   AQVASIANADNKTSGFKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFCATSHRRT  126

Query  532  KNGHALQQELIRFLNAGIFGTGT--GHTLPHSATRAAML  642
            KNG ALQ+ELI+FLNAG+FG GT   HTLPHSATRAAML
Sbjct  127  KNGGALQKELIKFLNAGVFGNGTESTHTLPHSATRAAML  165



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW  AA+ +KGSHLDEVKRMVAEFR P V +GG+TLT+ QVAAI+   N+VKVELSE
Sbjct  34   DPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAISTIGNSVKVELSE  93

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT-  594
             ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  94   TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  153

Query  595  -GTGHTLPHSATRAAML  642
              T HTLPHSATRAAML
Sbjct  154  KETSHTLPHSATRAAML  170



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 118/137 (86%), Gaps = 2/137 (1%)
 Frame = +1

Query  238  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  417
            DPLNW  AA+ +KGSHLDEVKRMVAEFR P V +GG+TLT+ QVAAI+   N+VKVELSE
Sbjct  34   DPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAISTIGNSVKVELSE  93

Query  418  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT-  594
             ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  94   TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  153

Query  595  -GTGHTLPHSATRAAML  642
              T HTLPHSATRAAML
Sbjct  154  KETSHTLPHSATRAAML  170



>gb|AAZ29735.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=725

 Score =   222 bits (565),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 126/149 (85%), Gaps = 6/149 (4%)
 Frame = +1

Query  211  HSNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  381
            H+N   +KV   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA
Sbjct  23   HANANNMKVNGADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGKTLTISQVAAIA  82

Query  382  ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  561
            A D A  VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  83   AHDGAT-VELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKEL  141

Query  562  IRFLNAGIFGTGT--GHTLPHSATRAAML  642
            IRFLNAGIFG GT   HTLPH+ATRAAML
Sbjct  142  IRFLNAGIFGNGTESSHTLPHTATRAAML  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375