BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF043P03

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767335.1|  PREDICTED: uncharacterized protein LOC104218515    198   3e-56   Nicotiana sylvestris
ref|XP_004251882.1|  PREDICTED: uncharacterized protein LOC101257045    192   9e-54   Solanum lycopersicum
ref|XP_011082732.1|  PREDICTED: uncharacterized protein LOC105165426    190   4e-53   Sesamum indicum [beniseed]
ref|XP_009593456.1|  PREDICTED: uncharacterized protein LOC104090114    190   5e-53   Nicotiana tomentosiformis
ref|XP_006348283.1|  PREDICTED: uncharacterized protein LOC102600810    190   6e-53   Solanum tuberosum [potatoes]
ref|XP_009604315.1|  PREDICTED: uncharacterized protein LOC104099119    188   3e-52   Nicotiana tomentosiformis
ref|XP_009766997.1|  PREDICTED: uncharacterized protein LOC104218248    187   3e-52   Nicotiana sylvestris
ref|XP_006358955.1|  PREDICTED: uncharacterized protein LOC102579474    187   5e-52   Solanum tuberosum [potatoes]
ref|XP_004146032.1|  PREDICTED: uncharacterized protein LOC101209...    186   2e-51   Cucumis sativus [cucumbers]
ref|XP_011098255.1|  PREDICTED: uncharacterized protein LOC105176...    186   2e-51   
ref|XP_011098256.1|  PREDICTED: uncharacterized protein LOC105176...    186   2e-51   Sesamum indicum [beniseed]
ref|XP_004244257.1|  PREDICTED: uncharacterized protein LOC101263533    186   2e-51   Solanum lycopersicum
ref|XP_008463718.1|  PREDICTED: uncharacterized protein LOC103501799    185   3e-51   Cucumis melo [Oriental melon]
gb|EYU44997.1|  hypothetical protein MIMGU_mgv1a003664mg                183   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_003634635.1|  PREDICTED: uncharacterized protein LOC100264164    183   2e-50   Vitis vinifera
ref|XP_010098421.1|  hypothetical protein L484_012136                   181   1e-49   Morus notabilis
ref|XP_008367769.1|  PREDICTED: uncharacterized protein LOC103431392    180   3e-49   
ref|XP_009340381.1|  PREDICTED: uncharacterized protein LOC103932481    176   4e-48   Pyrus x bretschneideri [bai li]
ref|XP_009348414.1|  PREDICTED: uncharacterized protein LOC103940068    176   5e-48   Pyrus x bretschneideri [bai li]
ref|XP_006414715.1|  hypothetical protein EUTSA_v10027329mg             168   6e-48   
ref|XP_011000241.1|  PREDICTED: uncharacterized protein LOC105107868    176   8e-48   Populus euphratica
ref|XP_007149412.1|  hypothetical protein PHAVU_005G068100g             175   2e-47   Phaseolus vulgaris [French bean]
ref|XP_008226453.1|  PREDICTED: uncharacterized protein LOC103326027    174   2e-47   Prunus mume [ume]
ref|XP_002298903.2|  sodium/calcium exchanger family protein            174   3e-47   
ref|XP_007021649.1|  Sodium/calcium exchanger family protein / ca...    172   3e-47   
gb|EPS64918.1|  sodium/calcium exchanger family protein                 173   4e-47   Genlisea aurea
ref|XP_004489056.1|  PREDICTED: uncharacterized protein LOC101505490    174   4e-47   Cicer arietinum [garbanzo]
ref|XP_004146033.1|  PREDICTED: uncharacterized protein LOC101209...    173   8e-47   
ref|XP_002282948.1|  PREDICTED: uncharacterized protein LOC100252144    172   2e-46   Vitis vinifera
gb|ADN33808.1|  sodium/calcium exchanger family protein                 172   2e-46   Cucumis melo subsp. melo
ref|XP_007021648.1|  Sodium/calcium exchanger family protein / ca...    172   2e-46   Theobroma cacao [chocolate]
ref|XP_010519243.1|  PREDICTED: uncharacterized protein LOC104798750    172   3e-46   Tarenaya hassleriana [spider flower]
ref|XP_003543222.1|  PREDICTED: uncharacterized protein LOC100809896    171   3e-46   Glycine max [soybeans]
gb|KJB45757.1|  hypothetical protein B456_007G325800                    170   4e-46   Gossypium raimondii
ref|XP_004294082.1|  PREDICTED: uncharacterized protein LOC101313777    171   6e-46   Fragaria vesca subsp. vesca
gb|AAF69532.1|AC008007_7  F12M16.12                                     169   1e-45   Arabidopsis thaliana [mouse-ear cress]
gb|KJB45756.1|  hypothetical protein B456_007G325800                    169   1e-45   Gossypium raimondii
ref|NP_564623.2|  Na+/Ca 2+ exchanger-like protein                      169   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392816.1|  hypothetical protein EUTSA_v10011341mg             169   3e-45   Eutrema salsugineum [saltwater cress]
emb|CDY55841.1|  BnaCnng29300D                                          169   3e-45   Brassica napus [oilseed rape]
ref|XP_010279178.1|  PREDICTED: uncharacterized protein LOC104613162    168   5e-45   Nelumbo nucifera [Indian lotus]
gb|KHG29939.1|  Vacuolar calcium ion transporter                        168   5e-45   Gossypium arboreum [tree cotton]
gb|KDP36271.1|  hypothetical protein JCGZ_09836                         168   5e-45   Jatropha curcas
ref|XP_008367781.1|  PREDICTED: uncharacterized protein LOC103431400    168   7e-45   
emb|CDY25725.1|  BnaC03g69500D                                          167   8e-45   Brassica napus [oilseed rape]
ref|XP_008386231.1|  PREDICTED: uncharacterized protein LOC103448741    167   9e-45   Malus domestica [apple tree]
ref|XP_009144785.1|  PREDICTED: uncharacterized protein LOC103868446    167   1e-44   Brassica rapa
ref|XP_010535054.1|  PREDICTED: uncharacterized protein LOC104810447    167   1e-44   Tarenaya hassleriana [spider flower]
gb|KJB13244.1|  hypothetical protein B456_002G064800                    164   1e-44   Gossypium raimondii
emb|CDY25869.1|  BnaA05g14600D                                          167   1e-44   Brassica napus [oilseed rape]
ref|XP_002891737.1|  sodium/calcium exchanger family protein            167   2e-44   
gb|ACY66868.1|  P20Sh148J07                                             166   2e-44   Saccharum hybrid cultivar R570
gb|KHG25681.1|  Vacuolar calcium ion transporter                        166   3e-44   Gossypium arboreum [tree cotton]
ref|XP_008226455.1|  PREDICTED: uncharacterized protein LOC103326029    166   3e-44   Prunus mume [ume]
gb|KJB13247.1|  hypothetical protein B456_002G064800                    164   4e-44   Gossypium raimondii
ref|XP_002522155.1|  calcium ion binding protein, putative              165   4e-44   
gb|KJB13245.1|  hypothetical protein B456_002G064800                    164   5e-44   Gossypium raimondii
ref|XP_002279120.1|  PREDICTED: uncharacterized protein LOC100253888    165   5e-44   Vitis vinifera
ref|XP_010675392.1|  PREDICTED: uncharacterized protein LOC104891403    165   6e-44   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY24108.1|  BnaA06g01060D                                          165   9e-44   Brassica napus [oilseed rape]
gb|KFK35737.1|  hypothetical protein AALP_AA4G030000                    164   1e-43   Arabis alpina [alpine rockcress]
gb|KJB13246.1|  hypothetical protein B456_002G064800                    164   1e-43   Gossypium raimondii
gb|KDO45772.1|  hypothetical protein CISIN_1g0423002mg                  161   1e-43   Citrus sinensis [apfelsine]
ref|XP_009106991.1|  PREDICTED: uncharacterized protein LOC103832685    164   2e-43   Brassica rapa
ref|XP_004294083.1|  PREDICTED: uncharacterized protein LOC101314065    162   7e-43   Fragaria vesca subsp. vesca
gb|KCW69971.1|  hypothetical protein EUGRSUZ_F03285                     160   1e-42   Eucalyptus grandis [rose gum]
emb|CDY26003.1|  BnaC06g06210D                                          161   1e-42   Brassica napus [oilseed rape]
ref|XP_009147618.1|  PREDICTED: uncharacterized protein LOC103871140    161   1e-42   Brassica rapa
ref|NP_001151543.1|  LOC100285177 precursor                             161   2e-42   Zea mays [maize]
ref|XP_008655084.1|  PREDICTED: LOC100285177 isoform X1                 161   2e-42   Zea mays [maize]
ref|XP_010062838.1|  PREDICTED: uncharacterized protein LOC104450104    160   2e-42   Eucalyptus grandis [rose gum]
ref|XP_006469050.1|  PREDICTED: uncharacterized protein LOC102616350    160   3e-42   Citrus sinensis [apfelsine]
ref|XP_007021639.1|  Sodium/calcium exchanger family protein / ca...    160   4e-42   
gb|ACY66874.1|  P20Sh095F0                                              159   6e-42   Saccharum hybrid cultivar R570
dbj|BAI94501.1|  sodium/calcium exchanger protein                       159   8e-42   Dianthus caryophyllus [carnation]
ref|XP_006852513.1|  hypothetical protein AMTR_s00021p00164610          159   1e-41   Amborella trichopoda
ref|XP_002525142.1|  calcium ion binding protein, putative              158   1e-41   
ref|XP_009348415.1|  PREDICTED: uncharacterized protein LOC103940069    159   1e-41   Pyrus x bretschneideri [bai li]
ref|XP_006451747.1|  hypothetical protein CICLE_v10007809mg             158   1e-41   Citrus clementina [clementine]
ref|XP_004968611.1|  PREDICTED: uncharacterized protein LOC101771765    157   3e-41   Setaria italica
ref|XP_008673552.1|  PREDICTED: uncharacterized protein LOC103649588    157   4e-41   
ref|XP_003565462.1|  PREDICTED: uncharacterized protein LOC100838274    157   4e-41   Brachypodium distachyon [annual false brome]
ref|XP_006446746.1|  hypothetical protein CICLE_v10018123mg             157   5e-41   
ref|XP_010277718.1|  PREDICTED: uncharacterized protein LOC104612...    149   5e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010277717.1|  PREDICTED: uncharacterized protein LOC104612...    149   6e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010060650.1|  PREDICTED: uncharacterized protein LOC104448506    156   6e-41   Eucalyptus grandis [rose gum]
emb|CDM82192.1|  unnamed protein product                                156   8e-41   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007213018.1|  hypothetical protein PRUPE_ppa023026mg             156   1e-40   Prunus persica
ref|XP_006643900.1|  PREDICTED: uncharacterized protein LOC102712578    156   1e-40   Oryza brachyantha
ref|XP_004305436.1|  PREDICTED: uncharacterized protein LOC101295737    156   1e-40   Fragaria vesca subsp. vesca
ref|XP_008229131.1|  PREDICTED: uncharacterized protein LOC103328510    155   1e-40   Prunus mume [ume]
ref|NP_001042378.1|  Os01g0212400                                       155   2e-40   
ref|XP_009354324.1|  PREDICTED: uncharacterized protein LOC103945475    155   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_008362437.1|  PREDICTED: uncharacterized protein LOC103426126    154   3e-40   
ref|XP_008368645.1|  PREDICTED: uncharacterized protein LOC103432241    154   4e-40   
dbj|BAJ93500.1|  predicted protein                                      154   4e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EAZ04370.1|  hypothetical protein OsI_26513                          154   4e-40   Oryza sativa Indica Group [Indian rice]
dbj|BAD19956.1|  putative drought-induced protein RDI                   153   8e-40   Oryza sativa Japonica Group [Japonica rice]
gb|EEE56655.1|  hypothetical protein OsJ_06069                          153   8e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007050030.1|  Sodium/calcium exchanger family protein / ca...    152   1e-39   
gb|KDP31770.1|  hypothetical protein JCGZ_12231                         153   1e-39   Jatropha curcas
ref|XP_010500958.1|  PREDICTED: uncharacterized protein LOC104778258    152   2e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006307086.1|  hypothetical protein CARUB_v10008672mg             152   2e-39   Capsella rubella
ref|XP_010052481.1|  PREDICTED: uncharacterized protein LOC104441...    151   4e-39   Eucalyptus grandis [rose gum]
ref|XP_007050029.1|  Sodium/calcium exchanger family protein / ca...    151   5e-39   
ref|XP_010479874.1|  PREDICTED: uncharacterized protein LOC104758667    151   6e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010041151.1|  PREDICTED: uncharacterized protein LOC104430086    150   7e-39   Eucalyptus grandis [rose gum]
ref|XP_010462200.1|  PREDICTED: uncharacterized protein LOC104742841    150   7e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009380498.1|  PREDICTED: uncharacterized protein LOC103968880    150   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004951320.1|  PREDICTED: uncharacterized protein LOC101782315    149   2e-38   Setaria italica
ref|XP_010915578.1|  PREDICTED: uncharacterized protein LOC105040648    149   2e-38   Elaeis guineensis
ref|XP_010276580.1|  PREDICTED: uncharacterized protein LOC104611295    148   7e-38   Nelumbo nucifera [Indian lotus]
ref|XP_008645573.1|  PREDICTED: uncharacterized protein LOC103626994    147   2e-37   
ref|XP_008783929.1|  PREDICTED: uncharacterized protein LOC103703017    147   2e-37   
ref|XP_009405607.1|  PREDICTED: uncharacterized protein LOC103988717    147   2e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW89606.1|  hypothetical protein EUGRSUZ_A01890                     145   8e-37   Eucalyptus grandis [rose gum]
ref|XP_003571165.2|  PREDICTED: uncharacterized protein LOC100833...    145   8e-37   
ref|XP_010234099.1|  PREDICTED: uncharacterized protein LOC100833...    145   9e-37   
ref|XP_002451861.1|  hypothetical protein SORBIDRAFT_04g008850          144   2e-36   
ref|XP_009409407.1|  PREDICTED: uncharacterized protein LOC103991626    140   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN78652.1|  hypothetical protein VITISV_033128                     139   1e-34   Vitis vinifera
ref|XP_010279180.1|  PREDICTED: uncharacterized protein LOC104613163    123   6e-29   Nelumbo nucifera [Indian lotus]
ref|XP_002987555.1|  hypothetical protein SELMODRAFT_42348              121   1e-28   
ref|XP_002992821.1|  hypothetical protein SELMODRAFT_42349              120   6e-28   
ref|XP_010064464.1|  PREDICTED: uncharacterized protein LOC104451526    113   3e-27   
ref|XP_007213956.1|  hypothetical protein PRUPE_ppa004823mg             115   2e-26   
ref|XP_002974272.1|  hypothetical protein SELMODRAFT_52345              115   2e-26   
ref|XP_002522156.1|  calcium ion binding protein, putative              115   3e-26   
emb|CDP05978.1|  unnamed protein product                                114   5e-26   Coffea canephora [robusta coffee]
ref|XP_007212014.1|  hypothetical protein PRUPE_ppa004833mg             113   7e-26   
emb|CBI20223.3|  unnamed protein product                                113   9e-26   Vitis vinifera
gb|EMS61578.1|  hypothetical protein TRIUR3_22187                       112   2e-25   Triticum urartu
ref|XP_002985644.1|  hypothetical protein SELMODRAFT_181929             112   2e-25   
gb|KDP36272.1|  hypothetical protein JCGZ_09837                         110   2e-24   Jatropha curcas
ref|XP_010644148.1|  PREDICTED: uncharacterized protein LOC100241883    109   8e-24   Vitis vinifera
ref|XP_010052488.1|  PREDICTED: uncharacterized protein LOC104441...    107   9e-24   
gb|AAK32813.1|AF361800_1  At1g53210/F12M16_12                           107   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010277716.1|  PREDICTED: uncharacterized protein LOC104612096    107   4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_002275961.1|  PREDICTED: uncharacterized protein LOC100260847    106   4e-23   Vitis vinifera
emb|CBI21945.3|  unnamed protein product                                107   9e-23   Vitis vinifera
ref|XP_001755925.1|  predicted protein                                  105   1e-22   
ref|XP_011096402.1|  PREDICTED: uncharacterized protein LOC105175...    105   1e-22   Sesamum indicum [beniseed]
gb|KCW67440.1|  hypothetical protein EUGRSUZ_F011933                  98.2    4e-22   Eucalyptus grandis [rose gum]
gb|ACN27225.1|  unknown                                                 102   6e-22   Zea mays [maize]
ref|XP_001752917.1|  predicted protein                                  103   7e-22   
ref|XP_001762095.1|  predicted protein                                  103   7e-22   
gb|EMT26919.1|  hypothetical protein F775_25869                         102   1e-21   
gb|KDP21052.1|  hypothetical protein JCGZ_21523                         102   1e-21   Jatropha curcas
ref|XP_005650712.1|  hypothetical protein COCSUDRAFT_61158              102   2e-21   Coccomyxa subellipsoidea C-169
ref|XP_011083284.1|  PREDICTED: uncharacterized protein LOC105165819    102   2e-21   Sesamum indicum [beniseed]
ref|XP_011460765.1|  PREDICTED: uncharacterized protein LOC105350...  98.6    2e-21   Fragaria vesca subsp. vesca
ref|XP_007021646.1|  Sodium/calcium exchanger family protein / ca...    102   4e-21   
gb|EPS57671.1|  hypothetical protein M569_17145                       99.8    5e-21   Genlisea aurea
ref|XP_011096401.1|  PREDICTED: uncharacterized protein LOC105175...    100   5e-21   Sesamum indicum [beniseed]
ref|XP_006307087.1|  hypothetical protein CARUB_v10008672mg           99.4    8e-21   
ref|XP_006594743.1|  PREDICTED: uncharacterized protein LOC100798...    100   9e-21   
ref|XP_006594741.1|  PREDICTED: uncharacterized protein LOC100798...    100   1e-20   Glycine max [soybeans]
ref|XP_006594742.1|  PREDICTED: uncharacterized protein LOC100798...    100   1e-20   Glycine max [soybeans]
ref|XP_001751608.1|  predicted protein                                98.2    5e-20   
emb|CBI20222.3|  unnamed protein product                              98.2    6e-20   Vitis vinifera
ref|XP_011000239.1|  PREDICTED: uncharacterized protein LOC105107...  97.4    1e-19   Populus euphratica
ref|XP_011000240.1|  PREDICTED: uncharacterized protein LOC105107...  97.4    1e-19   Populus euphratica
ref|XP_007025465.1|  Sodium/calcium exchanger family protein / ca...  96.7    2e-19   
ref|XP_007149414.1|  hypothetical protein PHAVU_005G068300g           96.7    3e-19   Phaseolus vulgaris [French bean]
ref|XP_003540477.1|  PREDICTED: uncharacterized protein LOC100800452  96.3    3e-19   Glycine max [soybeans]
gb|ACU19365.1|  unknown                                               90.9    9e-19   Glycine max [soybeans]
ref|XP_007021642.1|  Sodium/calcium exchanger family protein / ca...  93.6    1e-18   
ref|XP_002305761.1|  hypothetical protein POPTR_0004s05210g           94.0    1e-18   
ref|XP_004489085.1|  PREDICTED: uncharacterized protein LOC101490110  93.2    2e-18   
ref|XP_011000236.1|  PREDICTED: uncharacterized protein LOC105107...  94.0    2e-18   Populus euphratica
ref|XP_011460767.1|  PREDICTED: uncharacterized protein LOC105350439  94.0    2e-18   Fragaria vesca subsp. vesca
ref|XP_002962226.1|  hypothetical protein SELMODRAFT_76965            93.2    2e-18   
ref|XP_002272134.1|  PREDICTED: uncharacterized protein LOC100243523  93.2    2e-18   
ref|XP_002965139.1|  hypothetical protein SELMODRAFT_82683            93.2    3e-18   
gb|EYU28049.1|  hypothetical protein MIMGU_mgv1a003825mg              92.4    4e-18   Erythranthe guttata [common monkey flower]
ref|XP_008226451.1|  PREDICTED: uncharacterized protein LOC103326025  92.8    5e-18   Prunus mume [ume]
ref|XP_008383659.1|  PREDICTED: uncharacterized protein LOC103446347  92.0    5e-18   Malus domestica [apple tree]
ref|XP_010060649.1|  PREDICTED: uncharacterized protein LOC104448505  91.7    1e-17   Eucalyptus grandis [rose gum]
gb|KHN36865.1|  hypothetical protein glysoja_001596                   91.3    2e-17   Glycine soja [wild soybean]
ref|XP_011027727.1|  PREDICTED: uncharacterized protein LOC105127...  89.7    2e-17   Populus euphratica
ref|XP_009352820.1|  PREDICTED: uncharacterized protein LOC103944133  90.9    2e-17   
ref|XP_009340418.1|  PREDICTED: uncharacterized protein LOC103932516  90.9    2e-17   Pyrus x bretschneideri [bai li]
ref|XP_007214217.1|  hypothetical protein PRUPE_ppa023212mg           90.1    2e-17   
ref|XP_008225191.1|  PREDICTED: uncharacterized protein LOC103324855  90.1    2e-17   Prunus mume [ume]
gb|EMT05376.1|  hypothetical protein F775_06447                       89.7    3e-17   
ref|XP_009353170.1|  PREDICTED: uncharacterized protein LOC103944425  90.1    3e-17   
ref|XP_011000235.1|  PREDICTED: uncharacterized protein LOC105107...  90.1    4e-17   Populus euphratica
ref|XP_011027724.1|  PREDICTED: uncharacterized protein LOC105127...  89.7    4e-17   Populus euphratica
ref|XP_002275985.2|  PREDICTED: uncharacterized protein LOC100255777  89.4    5e-17   Vitis vinifera
gb|EYU43357.1|  hypothetical protein MIMGU_mgv1a003865mg              88.6    6e-17   Erythranthe guttata [common monkey flower]
ref|XP_011082730.1|  PREDICTED: uncharacterized protein LOC105165425  89.4    7e-17   Sesamum indicum [beniseed]
gb|KHN28092.1|  hypothetical protein glysoja_007824                   89.0    9e-17   Glycine soja [wild soybean]
ref|XP_007213499.1|  hypothetical protein PRUPE_ppa022096mg           88.6    1e-16   
emb|CAN78650.1|  hypothetical protein VITISV_033126                   87.8    2e-16   Vitis vinifera
ref|XP_002979758.1|  hypothetical protein SELMODRAFT_177778           85.5    2e-16   
gb|EYU43358.1|  hypothetical protein MIMGU_mgv1a003865mg              87.8    2e-16   Erythranthe guttata [common monkey flower]
ref|XP_002298902.2|  hypothetical protein POPTR_0001s38430g           87.8    2e-16   
ref|XP_002522528.1|  conserved hypothetical protein                   87.0    3e-16   
gb|ABR26205.1|  sodium/calcium exchanger protein                      84.7    3e-16   Oryza sativa Indica Group [Indian rice]
emb|CDP05977.1|  unnamed protein product                              86.3    9e-16   Coffea canephora [robusta coffee]
gb|EYU26347.1|  hypothetical protein MIMGU_mgv1a002045mg              85.9    1e-15   Erythranthe guttata [common monkey flower]
ref|XP_005839482.1|  hypothetical protein GUITHDRAFT_159252           84.7    1e-15   Guillardia theta CCMP2712
ref|XP_009352959.1|  PREDICTED: uncharacterized protein LOC103944258  84.7    2e-15   
ref|XP_008386229.1|  PREDICTED: uncharacterized protein LOC103448738  85.1    2e-15   
gb|KCW67430.1|  hypothetical protein EUGRSUZ_F01186                   84.0    4e-15   Eucalyptus grandis [rose gum]
gb|AFK39630.1|  unknown                                               77.0    2e-14   Lotus japonicus
emb|CAN66793.1|  hypothetical protein VITISV_034151                   80.1    2e-14   Vitis vinifera
ref|XP_006370033.1|  hypothetical protein POPTR_0001s38420g           81.6    3e-14   
gb|EYU44995.1|  hypothetical protein MIMGU_mgv1a002795mg              80.1    7e-14   Erythranthe guttata [common monkey flower]
emb|CAN66796.1|  hypothetical protein VITISV_034154                   77.4    7e-14   Vitis vinifera
gb|KEH38644.1|  calcium ion-binding protein, putative                 75.5    8e-14   Medicago truncatula
ref|XP_004293919.1|  PREDICTED: uncharacterized protein LOC101312324  79.7    8e-14   Fragaria vesca subsp. vesca
gb|KCW67437.1|  hypothetical protein EUGRSUZ_F01191                   77.4    3e-13   Eucalyptus grandis [rose gum]
emb|CAN78275.1|  hypothetical protein VITISV_037788                   77.8    4e-13   Vitis vinifera
gb|EYU44996.1|  hypothetical protein MIMGU_mgv1a025835mg              77.8    5e-13   Erythranthe guttata [common monkey flower]
emb|CAN66375.1|  hypothetical protein VITISV_037549                   78.2    6e-13   Vitis vinifera
ref|XP_008371442.1|  PREDICTED: uncharacterized protein LOC103434855  75.5    2e-12   
ref|XP_010101519.1|  hypothetical protein L484_008850                 74.7    3e-12   
ref|XP_002113975.1|  hypothetical protein TRIADDRAFT_57950            74.7    4e-12   Trichoplax adhaerens
ref|XP_008383883.1|  PREDICTED: uncharacterized protein LOC103446524  74.7    4e-12   
ref|XP_002500016.1|  Ca2+:Cation antiporter family                    74.3    5e-12   Micromonas commoda
ref|XP_642144.1|  hypothetical protein DDB_G0278609                   74.3    6e-12   Dictyostelium discoideum AX4
ref|XP_010058976.1|  PREDICTED: uncharacterized protein LOC104446874  74.3    6e-12   Eucalyptus grandis [rose gum]
ref|XP_011000237.1|  PREDICTED: uncharacterized protein LOC105107...  74.3    7e-12   Populus euphratica
tpg|DAA52870.1|  TPA: hypothetical protein ZEAMMB73_004216            70.1    9e-12   
ref|XP_009352958.1|  PREDICTED: uncharacterized protein LOC103944256  73.6    1e-11   
gb|EYU28050.1|  hypothetical protein MIMGU_mgv1a023246mg              73.6    1e-11   Erythranthe guttata [common monkey flower]
gb|AFW71107.1|  hypothetical protein ZEAMMB73_054247                  69.3    2e-11   
ref|XP_002522529.1|  calmodulin, putative                             72.8    2e-11   
gb|KIY91568.1|  hypothetical protein MNEG_16396                       68.9    3e-11   Monoraphidium neglectum
ref|XP_001627159.1|  predicted protein                                72.0    4e-11   Nematostella vectensis
ref|XP_003288984.1|  hypothetical protein DICPUDRAFT_153287           71.6    4e-11   Dictyostelium purpureum
emb|CDY27823.1|  BnaC09g28500D                                        67.4    6e-11   Brassica napus [oilseed rape]
gb|AFW71108.1|  hypothetical protein ZEAMMB73_635590                  67.4    8e-11   
gb|ACN36915.1|  unknown                                               70.1    1e-10   Zea mays [maize]
gb|EMS45634.1|  hypothetical protein TRIUR3_11261                     69.7    1e-10   Triticum urartu
gb|KDP21053.1|  hypothetical protein JCGZ_21524                       70.1    2e-10   Jatropha curcas
ref|XP_011096404.1|  PREDICTED: uncharacterized protein LOC105175608  68.9    3e-10   Sesamum indicum [beniseed]
gb|EPS72526.1|  sodium/calcium exchanger protein                      64.7    4e-10   Genlisea aurea
ref|XP_004361492.1|  hypothetical protein DFA_05775                   68.6    5e-10   Cavenderia fasciculata
gb|EFA82832.1|  hypothetical protein PPL_04527                        68.2    5e-10   Heterostelium album PN500
ref|XP_009605371.1|  PREDICTED: uncharacterized protein LOC104099939  68.2    6e-10   Nicotiana tomentosiformis
gb|EMT26603.1|  hypothetical protein F775_16568                       65.5    1e-09   
emb|CDY43114.1|  BnaC05g36630D                                        62.0    1e-09   Brassica napus [oilseed rape]
emb|CDY09702.1|  BnaC07g33590D                                        63.5    1e-09   Brassica napus [oilseed rape]
ref|XP_009803286.1|  PREDICTED: uncharacterized protein LOC104248681  66.2    3e-09   Nicotiana sylvestris
ref|XP_006340117.1|  PREDICTED: uncharacterized protein LOC102587762  65.5    4e-09   
gb|EFA85983.1|  hypothetical protein PPL_01216                        64.7    7e-09   Heterostelium album PN500
gb|KCW74040.1|  hypothetical protein EUGRSUZ_E02663                   63.9    1e-08   Eucalyptus grandis [rose gum]
ref|XP_010058973.1|  PREDICTED: uncharacterized protein LOC104446871  63.9    1e-08   
ref|XP_011096403.1|  PREDICTED: uncharacterized protein LOC105175606  63.2    2e-08   
ref|XP_004357876.1|  hypothetical protein DFA_00160                   63.2    3e-08   Cavenderia fasciculata
ref|XP_010317432.1|  PREDICTED: uncharacterized protein LOC101254...  62.4    4e-08   Solanum lycopersicum
ref|XP_006343216.1|  PREDICTED: uncharacterized protein LOC102593213  62.4    5e-08   Solanum tuberosum [potatoes]
ref|XP_002276006.2|  PREDICTED: uncharacterized protein LOC100250594  61.6    7e-08   
ref|XP_003057911.1|  predicted protein                                61.6    7e-08   Micromonas pusilla CCMP1545
ref|XP_004234097.2|  PREDICTED: uncharacterized protein LOC101254...  61.6    7e-08   Solanum lycopersicum
ref|XP_009629500.1|  PREDICTED: uncharacterized protein LOC104119642  61.6    8e-08   Nicotiana tomentosiformis
dbj|GAM24148.1|  hypothetical protein SAMD00019534_073230             61.2    9e-08   Acytostelium subglobosum LB1
emb|CAN78651.1|  hypothetical protein VITISV_033127                   61.6    9e-08   Vitis vinifera
gb|KCW44589.1|  hypothetical protein EUGRSUZ_L01893                   61.2    9e-08   Eucalyptus grandis [rose gum]
gb|ADC80445.1|  putative methyltransferase                            58.2    1e-07   Oryza sativa Indica Group [Indian rice]
gb|KIY94308.1|  hypothetical protein MNEG_13653                       59.7    2e-07   Monoraphidium neglectum
gb|AAL32034.1|AF439275_1  drought-induced protein RDI                 57.4    2e-07   Retama raetam [retem]
ref|XP_004233846.1|  PREDICTED: uncharacterized protein LOC101251749  59.7    3e-07   Solanum lycopersicum
emb|CAN69279.1|  hypothetical protein VITISV_023274                   58.2    9e-07   Vitis vinifera
ref|XP_010089436.1|  hypothetical protein L484_002737                 55.8    1e-06   
ref|XP_003386706.1|  PREDICTED: uncharacterized protein LOC100632705  57.8    2e-06   Amphimedon queenslandica
gb|EMS60382.1|  hypothetical protein TRIUR3_19684                     55.1    2e-06   Triticum urartu
ref|XP_009603995.1|  PREDICTED: uncharacterized protein LOC104098869  55.8    5e-06   
gb|KEH38650.1|  calcium-binding EF-hand protein                       55.1    1e-05   Medicago truncatula
ref|XP_011027726.1|  PREDICTED: uncharacterized protein LOC105127...  52.8    7e-05   Populus euphratica
ref|XP_008366059.1|  PREDICTED: uncharacterized protein LOC103429706  51.6    9e-05   
ref|XP_008358657.1|  PREDICTED: uncharacterized protein LOC103422380  50.8    3e-04   
emb|CCI40171.1|  unnamed protein product                              51.2    3e-04   Albugo candida
ref|XP_009141357.1|  PREDICTED: uncharacterized protein LOC103865312  50.8    3e-04   Brassica rapa
gb|EJK62281.1|  hypothetical protein THAOC_17107                      50.8    3e-04   Thalassiosira oceanica
ref|XP_010499420.1|  PREDICTED: uncharacterized protein LOC104776935  50.4    5e-04   
emb|CDY34082.1|  BnaA09g27080D                                        50.1    7e-04   Brassica napus [oilseed rape]
ref|XP_009517896.1|  hypothetical protein PHYSODRAFT_349569           49.7    9e-04   



>ref|XP_009767335.1| PREDICTED: uncharacterized protein LOC104218515 [Nicotiana sylvestris]
Length=568

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 149/169 (88%), Gaps = 3/169 (2%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
            S DL+SDG VH  G  S VLRL  ++  EE CEQSYGFLPCT TALGN+FLI+VYGYLMF
Sbjct  25   SGDLISDG-VH--GRDSDVLRLDRISAAEENCEQSYGFLPCTKTALGNVFLIIVYGYLMF  81

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
            LAATYLSSGSELLLEILGPGLIGGLFLP+LGALPDAMLILVSG+SGS A AQSQVSVGMG
Sbjct  82   LAATYLSSGSELLLEILGPGLIGGLFLPMLGALPDAMLILVSGISGSTAAAQSQVSVGMG  141

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            LLAGSTVML+TVIWGT  +VGKCDIQ +VAVDLKDT  FSLTGSGV+TD
Sbjct  142  LLAGSTVMLITVIWGTCCIVGKCDIQNSVAVDLKDTKGFSLTGSGVSTD  190



>ref|XP_004251882.1| PREDICTED: uncharacterized protein LOC101257045 [Solanum lycopersicum]
Length=578

 Score =   192 bits (487),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 151/178 (85%), Gaps = 4/178 (2%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSA-GEGSGVLRL--GVLAPEEETCEQSYGFLPCTTTALGNLFL  282
            R I D S+ ++SDG VHS  G    +LRL       EEE+CEQSYGFLPCT TALGN+FL
Sbjct  24   RFISDDSAGVISDG-VHSEIGRDLEILRLDRNFAGGEEESCEQSYGFLPCTKTALGNVFL  82

Query  283  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  462
            ILVYGYLMFL ATYLSSGSELLLEILGPG+IGGLFLP+LGALPDAMLILVSG+SGS A A
Sbjct  83   ILVYGYLMFLGATYLSSGSELLLEILGPGIIGGLFLPVLGALPDAMLILVSGISGSTAAA  142

Query  463  QSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            QSQVSVGMGLLAGSTVML+TVIWGT  +VGKCDIQ +VAVD+KDT  FSLTGSGV+TD
Sbjct  143  QSQVSVGMGLLAGSTVMLITVIWGTCCIVGKCDIQNSVAVDMKDTNGFSLTGSGVSTD  200



>ref|XP_011082732.1| PREDICTED: uncharacterized protein LOC105165426 [Sesamum indicum]
Length=567

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 151/175 (86%), Gaps = 6/175 (3%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I D+S DLVSDG VHS+ +    LRL      EETCEQ+YGF+PCT+TALGNLFLILV
Sbjct  26   RFIADQS-DLVSDG-VHSS-KLPNFLRL---YAAEETCEQTYGFMPCTSTALGNLFLILV  79

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YGYLMFLAATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGSV  AQSQ
Sbjct  80   YGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGSVETAQSQ  139

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VSVGMGLLAGSTVMLLTVIWGT VVVGKCDI   VAVD +DT  FSLTGSG++TD
Sbjct  140  VSVGMGLLAGSTVMLLTVIWGTCVVVGKCDIVNHVAVDSQDTKGFSLTGSGISTD  194



>ref|XP_009593456.1| PREDICTED: uncharacterized protein LOC104090114 [Nicotiana tomentosiformis]
Length=564

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 145/167 (87%), Gaps = 4/167 (2%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRLGVL-APEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
             +SDG VH  G  S VLRL  + A EE TCEQSYGFLPCT TALGN+FLI+VYGYLMFLA
Sbjct  23   FISDG-VH--GRDSDVLRLDRISAAEESTCEQSYGFLPCTKTALGNVFLIIVYGYLMFLA  79

Query  316  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  495
            ATYLSSGSE LLEILGPGLIGGLFLP+LGALPDAMLILVSG+SGS A AQSQVSVGMGLL
Sbjct  80   ATYLSSGSEFLLEILGPGLIGGLFLPVLGALPDAMLILVSGISGSTAAAQSQVSVGMGLL  139

Query  496  AGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            AGSTVML+TVIWGT  +VGKCDIQ + A+DLKDT  FSLTGSGV+TD
Sbjct  140  AGSTVMLITVIWGTCCIVGKCDIQNSAAIDLKDTKGFSLTGSGVSTD  186



>ref|XP_006348283.1| PREDICTED: uncharacterized protein LOC102600810 [Solanum tuberosum]
Length=589

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 142/184 (77%), Positives = 153/184 (83%), Gaps = 11/184 (6%)
 Frame = +1

Query  112  RLIVDRSS-DLVSDGGVH--------SAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTA  264
            R+IVD+SS DLVSDG VH        S G    V+ L   AP EE CEQSYGFLPCT TA
Sbjct  29   RVIVDQSSSDLVSDG-VHGGGGRNSSSIGRERRVISL-FAAPVEEACEQSYGFLPCTKTA  86

Query  265  LGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLS  444
            LGN+FLI+VYGYLMF AATYLSSGSELLLEILGPGLIGGLFLPILGALPDAMLILVSG++
Sbjct  87   LGNVFLIIVYGYLMFSAATYLSSGSELLLEILGPGLIGGLFLPILGALPDAMLILVSGIT  146

Query  445  GSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSG  624
            GS AEAQSQVSVG+GLLAGSTVMLLTVIWGT  +VGKCDI+ + AVDLKDT   SLTGSG
Sbjct  147  GSAAEAQSQVSVGIGLLAGSTVMLLTVIWGTCCIVGKCDIENSTAVDLKDTKGLSLTGSG  206

Query  625  VTTD  636
            VTTD
Sbjct  207  VTTD  210



>ref|XP_009604315.1| PREDICTED: uncharacterized protein LOC104099119 [Nicotiana tomentosiformis]
Length=574

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 151/178 (85%), Gaps = 6/178 (3%)
 Frame = +1

Query  112  RLIVDR-SSDLVSDG--GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFL  282
            R+I D+ SSDLVSDG  GV S G   G++ L   A  EE CEQSYGFLPCT TALGN+FL
Sbjct  22   RVISDQPSSDLVSDGVRGVDS-GREKGIISL--FAETEEACEQSYGFLPCTKTALGNVFL  78

Query  283  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  462
            I+VYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLP LGALPDAMLILVSG+SG+ A A
Sbjct  79   IVVYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLPALGALPDAMLILVSGVSGTAAAA  138

Query  463  QSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            QSQVSVG+GLLAGSTVMLLT IWGT  +VGKCDIQ +VAVDL+DT   SLTGSGVTTD
Sbjct  139  QSQVSVGIGLLAGSTVMLLTAIWGTCCIVGKCDIQNSVAVDLRDTKGLSLTGSGVTTD  196



>ref|XP_009766997.1| PREDICTED: uncharacterized protein LOC104218248 [Nicotiana sylvestris]
Length=574

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 151/178 (85%), Gaps = 6/178 (3%)
 Frame = +1

Query  112  RLIVDR-SSDLVSDGGVH--SAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFL  282
            R+I D+ SSDLVSDG VH  S+G   G++ L   A  EE CEQSYGFLPCT TALGN+FL
Sbjct  22   RVISDQPSSDLVSDG-VHGGSSGREHGIISL--FAETEEACEQSYGFLPCTKTALGNVFL  78

Query  283  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  462
            I+VYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLP LGALPDAMLILVSG+SG+ A A
Sbjct  79   IVVYGYLMFLAATYLSSGSELLLEILGPGLIGGLFLPALGALPDAMLILVSGVSGTAAAA  138

Query  463  QSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            Q QVSVG+GLLAGSTVMLLT IWGT  +VGKCDIQ +VAVDL+DT   S+TGSGVTTD
Sbjct  139  QGQVSVGIGLLAGSTVMLLTAIWGTCCIVGKCDIQNSVAVDLRDTKGLSMTGSGVTTD  196



>ref|XP_006358955.1| PREDICTED: uncharacterized protein LOC102579474 [Solanum tuberosum]
Length=577

 Score =   187 bits (475),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 149/178 (84%), Gaps = 4/178 (2%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSA-GEGSGVLRLG--VLAPEEETCEQSYGFLPCTTTALGNLFL  282
            R  +  S  L+SDG VHS  G    +LRL       EEE+CEQSYGF+PCT TALGN+FL
Sbjct  23   RRFISDSGGLISDG-VHSEIGRDLEILRLDRDFAGGEEESCEQSYGFMPCTKTALGNVFL  81

Query  283  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  462
            ILVYGYLMFL ATYLSSGSELLLEILGPG+IGGLFLP+LGALPDAMLILVSG+SGS A A
Sbjct  82   ILVYGYLMFLGATYLSSGSELLLEILGPGIIGGLFLPVLGALPDAMLILVSGISGSTAAA  141

Query  463  QSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            QSQVSVGMGLLAGSTVML+T+IWGT  +VGKCDIQ +VAVD+KDT  FSLTGSGV+TD
Sbjct  142  QSQVSVGMGLLAGSTVMLITIIWGTCCIVGKCDIQNSVAVDMKDTRGFSLTGSGVSTD  199



>ref|XP_004146032.1| PREDICTED: uncharacterized protein LOC101209298 isoform 1 [Cucumis 
sativus]
 ref|XP_004162934.1| PREDICTED: uncharacterized protein LOC101229160 isoform 1 [Cucumis 
sativus]
 gb|KGN55087.1| hypothetical protein Csa_4G628350 [Cucumis sativus]
Length=589

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 147/171 (86%), Gaps = 6/171 (4%)
 Frame = +1

Query  136  DLVSDGGVHSAGEGSGVLRLGVL----APEEETCEQSYGFLPCTTTALGNLFLILVYGYL  303
            DLVSDG ++   E S  L L  L    APEEE+CEQSYGFLPCTTTALGNLFLI+VYGYL
Sbjct  41   DLVSDG-INGLQEPS-YLHLNTLSSLSAPEEESCEQSYGFLPCTTTALGNLFLIIVYGYL  98

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            MFLAATYLS+GSELLLEILGPG++GGLFLP LGALPDAMLILVSGL+GS   AQSQVSVG
Sbjct  99   MFLAATYLSTGSELLLEILGPGIVGGLFLPALGALPDAMLILVSGLAGSAEVAQSQVSVG  158

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTVMLLT+IWGT V+VGKCD+Q +VA+D +DT  FSLT SGV+TD
Sbjct  159  MGLLAGSTVMLLTLIWGTCVIVGKCDLQDSVAIDSQDTKGFSLTESGVSTD  209



>ref|XP_011098255.1| PREDICTED: uncharacterized protein LOC105176958 isoform X1 [Sesamum 
indicum]
Length=576

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 149/175 (85%), Gaps = 4/175 (2%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I D+S DL+SD  V  A +   +LRL      EE CE++YGF+PCT+TALGNLFLILV
Sbjct  24   RRIRDQS-DLISDDVVVGASKFPPLLRLPA---AEEVCEETYGFMPCTSTALGNLFLILV  79

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YGYLMFLAATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGS   AQSQ
Sbjct  80   YGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGSRETAQSQ  139

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VSVGMGLLAGSTVMLLT+IWGT ++VGKCDI+ +VAVD KDT AFSL GSG++TD
Sbjct  140  VSVGMGLLAGSTVMLLTLIWGTCIIVGKCDIENSVAVDSKDTKAFSLAGSGISTD  194



>ref|XP_011098256.1| PREDICTED: uncharacterized protein LOC105176958 isoform X2 [Sesamum 
indicum]
Length=569

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 149/175 (85%), Gaps = 4/175 (2%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I D+S DL+SD  V  A +   +LRL      EE CE++YGF+PCT+TALGNLFLILV
Sbjct  24   RRIRDQS-DLISDDVVVGASKFPPLLRLPA---AEEVCEETYGFMPCTSTALGNLFLILV  79

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YGYLMFLAATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGS   AQSQ
Sbjct  80   YGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGSRETAQSQ  139

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VSVGMGLLAGSTVMLLT+IWGT ++VGKCDI+ +VAVD KDT AFSL GSG++TD
Sbjct  140  VSVGMGLLAGSTVMLLTLIWGTCIIVGKCDIENSVAVDSKDTKAFSLAGSGISTD  194



>ref|XP_004244257.1| PREDICTED: uncharacterized protein LOC101263533 [Solanum lycopersicum]
Length=589

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 151/184 (82%), Gaps = 11/184 (6%)
 Frame = +1

Query  112  RLIVDRSS-DLVSDGGVH--------SAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTA  264
            R+IVD+SS DL+SDG VH        S G   G++ L   AP EE CEQSYGFLPCT TA
Sbjct  29   RVIVDQSSSDLISDG-VHGGGGRNSTSIGRERGIISL-FAAPVEEACEQSYGFLPCTKTA  86

Query  265  LGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLS  444
            LGN+FLI+VYGYLMF AATYLSSGSELLLEILGPGLIGGLFLPILGALPDAMLILVSG++
Sbjct  87   LGNVFLIVVYGYLMFTAATYLSSGSELLLEILGPGLIGGLFLPILGALPDAMLILVSGIT  146

Query  445  GSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSG  624
            GS AEAQSQVSVG+GLLAGSTVMLLT IWGT   VGKCDI  ++AVDLKDT   S TGSG
Sbjct  147  GSAAEAQSQVSVGIGLLAGSTVMLLTAIWGTCCTVGKCDIVNSIAVDLKDTKGLSFTGSG  206

Query  625  VTTD  636
            V+TD
Sbjct  207  VSTD  210



>ref|XP_008463718.1| PREDICTED: uncharacterized protein LOC103501799 [Cucumis melo]
Length=590

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 146/171 (85%), Gaps = 6/171 (4%)
 Frame = +1

Query  136  DLVSDGGVHSAGEGSGVLRLGVL----APEEETCEQSYGFLPCTTTALGNLFLILVYGYL  303
            DLVSDG V+   E S  L L  L    APEEE+CEQSYGFLPCTTTALGNLFLI+VYGYL
Sbjct  42   DLVSDG-VNELQEPS-YLHLNTLSSFSAPEEESCEQSYGFLPCTTTALGNLFLIIVYGYL  99

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            MFLAA YLS+GSELLLEILGPG++GGLFLP LGALPDAMLILVSGL+GS   AQSQVSVG
Sbjct  100  MFLAAKYLSTGSELLLEILGPGIVGGLFLPALGALPDAMLILVSGLAGSAEVAQSQVSVG  159

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTVMLLT+IWGT V+VGKCD+Q +VA+D +DT  FSLT SGV+TD
Sbjct  160  MGLLAGSTVMLLTLIWGTCVIVGKCDLQDSVAIDSQDTKGFSLTESGVSTD  210



>gb|EYU44997.1| hypothetical protein MIMGU_mgv1a003664mg [Erythranthe guttata]
Length=571

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 145/175 (83%), Gaps = 5/175 (3%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I D+  DLVSDG V      S V     L   EETCEQ+YGFLPCT+T LGNLFLILV
Sbjct  26   RFISDQP-DLVSDGVVRE----SKVPHFLRLHAAEETCEQTYGFLPCTSTGLGNLFLILV  80

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YGYLMFLAATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSGSV  AQSQ
Sbjct  81   YGYLMFLAATYLSTGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSVETAQSQ  140

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VSVGMGLLAGSTVML+TVIWGT ++VGKCDI+  +A+D +DT   SLTGSG+TTD
Sbjct  141  VSVGMGLLAGSTVMLITVIWGTCIIVGKCDIENDLAIDSRDTKGLSLTGSGITTD  195



>ref|XP_003634635.1| PREDICTED: uncharacterized protein LOC100264164 [Vitis vinifera]
 emb|CBI20221.3| unnamed protein product [Vitis vinifera]
Length=580

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 130/179 (73%), Positives = 149/179 (83%), Gaps = 5/179 (3%)
 Frame = +1

Query  112  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAP--EEETCEQSYGFLPCTTTALGNLF  279
            R+I +R+S   LVSDG VH   +GS  L L   +     ++C+Q+YGF+PCTTT +GNLF
Sbjct  24   RVISNRTSSTGLVSDG-VHDHRDGSPYLLLRSFSAVSASDSCDQTYGFMPCTTTTVGNLF  82

Query  280  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  459
            LILVYGYLMFLAATYLSSGSELLLE+LGPGL+GGL LPILGALPDAMLILVSGLSGS   
Sbjct  83   LILVYGYLMFLAATYLSSGSELLLELLGPGLVGGLLLPILGALPDAMLILVSGLSGSTET  142

Query  460  AQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            AQSQVSVGMGLLAGSTVMLLT+IWGT V+VGKCD+Q +VA D +DT  FSLTGSGV+TD
Sbjct  143  AQSQVSVGMGLLAGSTVMLLTIIWGTCVIVGKCDLQDSVAKDSQDTKGFSLTGSGVSTD  201



>ref|XP_010098421.1| hypothetical protein L484_012136 [Morus notabilis]
 gb|EXB75012.1| hypothetical protein L484_012136 [Morus notabilis]
Length=578

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 148/181 (82%), Gaps = 7/181 (4%)
 Frame = +1

Query  112  RLIVDRSS--DLVSDGGVHSAGEGS-GVLRLGVLAPE---EETCEQSYGFLPCTTTALGN  273
            R I D+SS  DLVS+G +H   E     LRL     +   E TCEQSYGFLPCTTTALGN
Sbjct  20   RFISDQSSQSDLVSNG-LHDLREAQPSFLRLNAALSDFGAESTCEQSYGFLPCTTTALGN  78

Query  274  LFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSV  453
            LFLILVYGYLMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGS 
Sbjct  79   LFLILVYGYLMFTAATYLSNGSELLLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGSA  138

Query  454  AEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTT  633
              AQSQVSVGMGLLAGSTV+LLTVIWGT ++VGKCDI+ +VA D KDT  FSL GSGV+T
Sbjct  139  ETAQSQVSVGMGLLAGSTVLLLTVIWGTCIIVGKCDIEGSVARDGKDTKGFSLIGSGVST  198

Query  634  D  636
            D
Sbjct  199  D  199



>ref|XP_008367769.1| PREDICTED: uncharacterized protein LOC103431392 [Malus domestica]
Length=586

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 144/172 (84%), Gaps = 3/172 (2%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGY  300
            SSDL+SDG  H     +    L     L+ E+ TCEQ+YGFLPCTTT +GNLFLILVYGY
Sbjct  35   SSDLISDGVHHHHRSHTFAPYLTLKNALSAEDSTCEQTYGFLPCTTTVIGNLFLILVYGY  94

Query  301  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  480
            LM+LAATYLS+GSE+LLEILGPG+IGGLFLPILGALPDAMLILVSGLSG+   AQSQVSV
Sbjct  95   LMYLAATYLSNGSEMLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSV  154

Query  481  GMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GMGLLAGSTVMLLTVIWG+ V+VGKCDI+ +VA+D KDT   SLTGSGV+TD
Sbjct  155  GMGLLAGSTVMLLTVIWGSCVIVGKCDIEGSVAIDNKDTKGLSLTGSGVSTD  206



>ref|XP_009340381.1| PREDICTED: uncharacterized protein LOC103932481 [Pyrus x bretschneideri]
Length=585

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = +1

Query  115  LIVDRSSDLVSDGGVHSAGEGSGVLRLG-VLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
             I  +S DL+SDG  H +   +  L L    +  + TC+Q+YGFLPCTTT +GNLFLILV
Sbjct  31   FIPSKSPDLISDGVHHRSHSFAPYLALNNSFSAADSTCDQTYGFLPCTTTVIGNLFLILV  90

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YGYLM+LAATYLS GSELLLEILGPG+IGGLFLPILGALPDAMLILVSGLSG+   AQSQ
Sbjct  91   YGYLMYLAATYLSHGSELLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTTETAQSQ  150

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VSVGMGLLAGSTVML++VIWG+ V VGKCDI+ +VA+D +DT  FS+TGSGV+TD
Sbjct  151  VSVGMGLLAGSTVMLISVIWGSCVFVGKCDIEESVAIDNRDTKGFSITGSGVSTD  205



>ref|XP_009348414.1| PREDICTED: uncharacterized protein LOC103940068 [Pyrus x bretschneideri]
 ref|XP_009348417.1| PREDICTED: uncharacterized protein LOC103940071 [Pyrus x bretschneideri]
Length=549

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 141/169 (83%), Gaps = 3/169 (2%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
            ++SDG  H     +    L     L+ E+ TCEQ+YGFLPCTTT +GNLFLILVYGYLM+
Sbjct  1    MISDGAHHHHRSHTFAPYLTLKNALSAEDSTCEQTYGFLPCTTTVIGNLFLILVYGYLMY  60

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
            LAATYLS+GSELLLEILGPG+IGGLFLPILGALPDAMLILVSGLSG+   AQSQVSVGMG
Sbjct  61   LAATYLSNGSELLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTKETAQSQVSVGMG  120

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            LLAGSTVMLLTVIWG+ V+VGKCDIQ +VA+D KDT   SLTGSGV+TD
Sbjct  121  LLAGSTVMLLTVIWGSCVIVGKCDIQGSVAMDNKDTKRLSLTGSGVSTD  169



>ref|XP_006414715.1| hypothetical protein EUTSA_v10027329mg, partial [Eutrema salsugineum]
 gb|ESQ56168.1| hypothetical protein EUTSA_v10027329mg, partial [Eutrema salsugineum]
Length=220

 Score =   168 bits (425),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 141/174 (81%), Gaps = 6/174 (3%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSG-VLRLGVLAP----EEETCEQSYGFLPCTTTALGNLFLILVY  294
            S+ L+SDG +     GSG V++  V AP    +EE CEQ+YGF+PCT TALGN+FLILVY
Sbjct  14   STGLISDG-IDGGNLGSGSVIKTVVSAPPDEEKEEACEQTYGFMPCTKTALGNVFLILVY  72

Query  295  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  474
            G+LMF AATYLS+ SELLL+ILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQV
Sbjct  73   GFLMFTAATYLSARSELLLKILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQV  132

Query  475  SVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SVGMGLLAGSTVMLLTVIWGT  VVGKCD++  +AV  +DT  FSL  SGVT D
Sbjct  133  SVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVKNQDTKRFSLKDSGVTVD  186



>ref|XP_011000241.1| PREDICTED: uncharacterized protein LOC105107868 [Populus euphratica]
Length=589

 Score =   176 bits (445),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 143/174 (82%), Gaps = 7/174 (4%)
 Frame = +1

Query  133  SDLVSDGGVHSAGE----GSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGY  300
            SD +SDG VH+        S    L + +  EETCEQ+YGFLPCTTT +GNLFLILVYGY
Sbjct  36   SDPISDG-VHNNQSLNQTTSSPFHLALKSSAEETCEQTYGFLPCTTTVIGNLFLILVYGY  94

Query  301  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  480
            LMFLAATYLSSGSELLL+ILGPG+IGGLFLP+LGALPDA+LILVSGLSGS   AQSQVSV
Sbjct  95   LMFLAATYLSSGSELLLQILGPGIIGGLFLPVLGALPDALLILVSGLSGSTETAQSQVSV  154

Query  481  GMGLLAGSTVMLLTVIWGTYVVVGKCDIQXA--VAVDLKDTXAFSLTGSGVTTD  636
            GMGLLAGSTVMLLTVIWG+ VVVGKCD++     A+D KDT  FSLTGSGVTTD
Sbjct  155  GMGLLAGSTVMLLTVIWGSCVVVGKCDMRETENSAIDRKDTKRFSLTGSGVTTD  208



>ref|XP_007149412.1| hypothetical protein PHAVU_005G068100g [Phaseolus vulgaris]
 gb|ESW21406.1| hypothetical protein PHAVU_005G068100g [Phaseolus vulgaris]
Length=576

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 144/169 (85%), Gaps = 2/169 (1%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
            S D +SDG  +++ EG  +LRL      E +CEQ+YGFLPCTTT LGNLFLIL+YG+LMF
Sbjct  30   SRDPLSDGVSNNSWEG--LLRLPSAITVESSCEQTYGFLPCTTTVLGNLFLILIYGFLMF  87

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
             AAT+LS GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSGS   AQSQVSVGMG
Sbjct  88   KAATFLSGGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKETAQSQVSVGMG  147

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            LLAGSTV+LLT+IWGT V+VGKCDI+ ++A+D +DT  FSLTGSGV+TD
Sbjct  148  LLAGSTVLLLTIIWGTCVIVGKCDIEDSIAIDSQDTRGFSLTGSGVSTD  196



>ref|XP_008226453.1| PREDICTED: uncharacterized protein LOC103326027 [Prunus mume]
 ref|XP_008226454.1| PREDICTED: uncharacterized protein LOC103326027 [Prunus mume]
Length=579

 Score =   174 bits (442),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 145/180 (81%), Gaps = 5/180 (3%)
 Frame = +1

Query  112  RLIVDR---SSDLVSDGGVHSAGE-GSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNL  276
            R I D    S DL+SDG  H         L L   + + E TC+Q+YGFLPCTTT LGNL
Sbjct  22   RFISDTQAASQDLISDGVHHHLSHIPRSYLTLNPYSVDAESTCDQTYGFLPCTTTVLGNL  81

Query  277  FLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVA  456
            FLILVYGYLM+LAATYLS+GSE+LLEILGPG+IGGLFLPILGALPDAMLILVSGLSG+  
Sbjct  82   FLILVYGYLMYLAATYLSNGSEMLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTTE  141

Query  457  EAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
             AQSQVSVGMGLLAGSTVMLLTVIWG+ V+VGKCDI+ ++A+D KDT   SLTGSGV+TD
Sbjct  142  TAQSQVSVGMGLLAGSTVMLLTVIWGSCVLVGKCDIENSIAIDNKDTKGLSLTGSGVSTD  201



>ref|XP_002298903.2| sodium/calcium exchanger family protein [Populus trichocarpa]
 gb|EEE83708.2| sodium/calcium exchanger family protein [Populus trichocarpa]
Length=582

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 142/173 (82%), Gaps = 5/173 (3%)
 Frame = +1

Query  133  SDLVSDGGVHSAGEG---SGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYL  303
            SDL+SDG +++       S    L + +  EETCEQ+YGFLPCTTT +GNLFLILVYGYL
Sbjct  38   SDLISDGVLNNQSLNQTTSSPFHLALKSSAEETCEQTYGFLPCTTTVIGNLFLILVYGYL  97

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            MF AATYLSSGSELLL+ILGPG+IGGLFLP+LGALPDA+LILVSGLSGS   AQSQVSVG
Sbjct  98   MFFAATYLSSGSELLLQILGPGIIGGLFLPVLGALPDALLILVSGLSGSTETAQSQVSVG  157

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXA--VAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTVMLLTVIWG+ VVVGKCD+      A+D KDT  FSLTGSGV+TD
Sbjct  158  MGLLAGSTVMLLTVIWGSCVVVGKCDMSETENSAIDRKDTKRFSLTGSGVSTD  210



>ref|XP_007021649.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 2 [Theobroma cacao]
 gb|EOY13174.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 2 [Theobroma cacao]
Length=452

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = +1

Query  112  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I  R S  DLVSDG   S  +    L L  LA  EE+CEQ+YGFLPCTTTALGNLFLI
Sbjct  24   RFITGRPSPTDLVSDGI--STVKNPPYLLLKPLASAEESCEQTYGFLPCTTTALGNLFLI  81

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYG LMFLAATYLS+GSELLL+ILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGCLMFLAATYLSNGSELLLQILGPGIVGGLFLPILGALPDAMLILVSGLSGTTETAQ  141

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SQVSVGMGLLAGSTVMLLTVIWG+ VVVG+CD++ +VAVD   T  FSLT +GV+TD
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDLRDSVAVDGTITKGFSLTETGVSTD  198



>gb|EPS64918.1| sodium/calcium exchanger family protein, partial [Genlisea aurea]
Length=519

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 132/141 (94%), Gaps = 0/141 (0%)
 Frame = +1

Query  214  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  393
            EE+CEQ+YGFLPCT+TALGNLFLILVYGYLMF AA YLSSGSELLLEILGPG++GGLFLP
Sbjct  2    EESCEQTYGFLPCTSTALGNLFLILVYGYLMFSAARYLSSGSELLLEILGPGIVGGLFLP  61

Query  394  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXA  573
            ILGALPDAMLILVSGLSGSV  AQSQVSVG+GLLAGSTVMLLTVIWG+ ++VGKCDI+ +
Sbjct  62   ILGALPDAMLILVSGLSGSVETAQSQVSVGIGLLAGSTVMLLTVIWGSCILVGKCDIENS  121

Query  574  VAVDLKDTXAFSLTGSGVTTD  636
            +A+D KDT  F+LTGSGVTTD
Sbjct  122  IAIDSKDTKGFNLTGSGVTTD  142



>ref|XP_004489056.1| PREDICTED: uncharacterized protein LOC101505490 [Cicer arietinum]
Length=583

 Score =   174 bits (440),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 143/169 (85%), Gaps = 10/169 (6%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
            + DLVSDG        S VLRL     +E TCE++YGFLPCTTT LGNLFLILVYG+LM+
Sbjct  45   TPDLVSDGW-------SNVLRLPT---DESTCEETYGFLPCTTTILGNLFLILVYGFLMY  94

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
             AAT+LS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGS   AQSQVSVGMG
Sbjct  95   TAATFLSNGSELLLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGSTETAQSQVSVGMG  154

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            LLAGSTV+LLT+IWGT V+VGKCDI+ ++A+D +DT  FSLTGSGV+TD
Sbjct  155  LLAGSTVLLLTIIWGTCVIVGKCDIEDSIAIDSQDTRGFSLTGSGVSTD  203



>ref|XP_004146033.1| PREDICTED: uncharacterized protein LOC101209298 isoform 2 [Cucumis 
sativus]
 ref|XP_004162935.1| PREDICTED: uncharacterized protein LOC101229160 isoform 2 [Cucumis 
sativus]
Length=584

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 142/171 (83%), Gaps = 11/171 (6%)
 Frame = +1

Query  136  DLVSDGGVHSAGEGSGVLRLGVL----APEEETCEQSYGFLPCTTTALGNLFLILVYGYL  303
            DLVSDG ++   E S  L L  L    APEEE+CEQSYGFLPCTTTALGNLFLI+VYGYL
Sbjct  41   DLVSDG-INGLQEPS-YLHLNTLSSLSAPEEESCEQSYGFLPCTTTALGNLFLIIVYGYL  98

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            MFLAATYLS+GSELLLEILGPG++GGLFLP LGALPDAMLIL     GS   AQSQVSVG
Sbjct  99   MFLAATYLSTGSELLLEILGPGIVGGLFLPALGALPDAMLIL-----GSAEVAQSQVSVG  153

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTVMLLT+IWGT V+VGKCD+Q +VA+D +DT  FSLT SGV+TD
Sbjct  154  MGLLAGSTVMLLTLIWGTCVIVGKCDLQDSVAIDSQDTKGFSLTESGVSTD  204



>ref|XP_002282948.1| PREDICTED: uncharacterized protein LOC100252144 [Vitis vinifera]
Length=579

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 148/179 (83%), Gaps = 5/179 (3%)
 Frame = +1

Query  112  RLIVDR--SSDLVSDGGVHSAGEGSGVLRLGVLAP--EEETCEQSYGFLPCTTTALGNLF  279
            R+I +R  S+DLVSD   H    GS  L L   +     ++C+Q+YGF+PCTTT +GNLF
Sbjct  24   RVISNRTLSTDLVSDD-FHDHRNGSPYLLLRSFSAVSASDSCDQTYGFMPCTTTIVGNLF  82

Query  280  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  459
            LI+VYGYLMFLAATYLSSGSELLLEILGPGL+GGL +PILGALPDA+LILVSGLSGS   
Sbjct  83   LIVVYGYLMFLAATYLSSGSELLLEILGPGLVGGLIVPILGALPDAILILVSGLSGSTET  142

Query  460  AQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            AQSQVSVGMGLLAGSTV+LLT++WG+ V+VGKCD+Q +VA DL+DT  FSLTGSGV+TD
Sbjct  143  AQSQVSVGMGLLAGSTVILLTIMWGSCVIVGKCDLQDSVAKDLQDTKGFSLTGSGVSTD  201



>gb|ADN33808.1| sodium/calcium exchanger family protein [Cucumis melo subsp. 
melo]
Length=585

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 141/171 (82%), Gaps = 11/171 (6%)
 Frame = +1

Query  136  DLVSDGGVHSAGEGSGVLRLGVL----APEEETCEQSYGFLPCTTTALGNLFLILVYGYL  303
            DLVSDG V+   E S  L L  L    APEEE+CEQSYGFLPCTTTALGNLFLI+VYGYL
Sbjct  42   DLVSDG-VNELQEPS-YLHLNTLSSFSAPEEESCEQSYGFLPCTTTALGNLFLIIVYGYL  99

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            MFLAA YLS+GSELLLEILGPG++GGLFLP LGALPDAMLIL     GS   AQSQVSVG
Sbjct  100  MFLAAKYLSTGSELLLEILGPGIVGGLFLPALGALPDAMLIL-----GSAEVAQSQVSVG  154

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTVMLLT+IWGT V+VGKCD+Q +VA+D +DT  FSLT SGV+TD
Sbjct  155  MGLLAGSTVMLLTLIWGTCVIVGKCDLQDSVAIDSQDTKGFSLTESGVSTD  205



>ref|XP_007021648.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
 gb|EOY13173.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
Length=578

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 145/177 (82%), Gaps = 4/177 (2%)
 Frame = +1

Query  112  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I  R S  DLVSDG   S  +    L L  LA  EE+CEQ+YGFLPCTTTALGNLFLI
Sbjct  24   RFITGRPSPTDLVSDG--ISTVKNPPYLLLKPLASAEESCEQTYGFLPCTTTALGNLFLI  81

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYG LMFLAATYLS+GSELLL+ILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGCLMFLAATYLSNGSELLLQILGPGIVGGLFLPILGALPDAMLILVSGLSGTTETAQ  141

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SQVSVGMGLLAGSTVMLLTVIWG+ VVVG+CD++ +VAVD   T  FSLT +GV+TD
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDLRDSVAVDGTITKGFSLTETGVSTD  198



>ref|XP_010519243.1| PREDICTED: uncharacterized protein LOC104798750 [Tarenaya hassleriana]
Length=587

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 146/182 (80%), Gaps = 8/182 (4%)
 Frame = +1

Query  112  RLIVDRSSD--LVSDGGVH--SAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALG  270
            R +  R S   L+SDG VH  S  EGS +  +   AP   EEE CEQ+YGF+PCT TALG
Sbjct  24   RFVAVRPSSTGLISDG-VHDGSGDEGSVIETVVSAAPAEVEEEVCEQTYGFMPCTKTALG  82

Query  271  NLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGS  450
            N+FLILVYGYLMF AA YLS+GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+
Sbjct  83   NVFLILVYGYLMFTAAKYLSNGSELLLEILGPGIVGGLFLPVLGALPDAMLILVSGLSGT  142

Query  451  VAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVT  630
               AQSQVSVGMGLLAGSTVMLLTVIWGT  VVGKCD++ ++AV+ +DT  F LTGSGVT
Sbjct  143  PETAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNGQDTKGFHLTGSGVT  202

Query  631  TD  636
             D
Sbjct  203  VD  204



>ref|XP_003543222.1| PREDICTED: uncharacterized protein LOC100809896 [Glycine max]
 gb|KHN36868.1| hypothetical protein glysoja_001599 [Glycine soja]
Length=579

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = +1

Query  136  DLVSDGGVHSAG-EGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFL  312
            D VSDG   ++G +   +LRL      E  CEQ+YGFLPCTTT LGNLFLI+VYG+LMF 
Sbjct  32   DPVSDGFAAASGSKWQSILRLPTALTGESVCEQTYGFLPCTTTVLGNLFLIIVYGFLMFK  91

Query  313  AATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGL  492
            AAT+LS GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSGS   AQSQVSVGMGL
Sbjct  92   AATFLSGGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKEVAQSQVSVGMGL  151

Query  493  LAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            LAGST +LLT+IWGT V+VGKCDI+ ++A+D +DT  FSLTGSGV+TD
Sbjct  152  LAGSTTLLLTIIWGTCVIVGKCDIEGSIAIDSRDTRGFSLTGSGVSTD  199



>gb|KJB45757.1| hypothetical protein B456_007G325800 [Gossypium raimondii]
Length=511

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 142/177 (80%), Gaps = 4/177 (2%)
 Frame = +1

Query  112  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I   SS  DLVSDG   S  +    L L  L   EE+CEQ+YGFLPCTTT LGNLFLI
Sbjct  24   RFITGPSSPTDLVSDGI--STVKNPPFLSLKPLFSAEESCEQTYGFLPCTTTVLGNLFLI  81

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYGYLMFLAATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMFLAATYLSNGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGTAETAQ  141

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
             QVSVGMGLLAGSTVMLLTVIWG+ VVVG+CDI+ +VAVD   T  F LT +GV+TD
Sbjct  142  DQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDIRDSVAVDGTITKGFHLTETGVSTD  198



>ref|XP_004294082.1| PREDICTED: uncharacterized protein LOC101313777 [Fragaria vesca 
subsp. vesca]
Length=580

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 139/169 (82%), Gaps = 3/169 (2%)
 Frame = +1

Query  136  DLVSDGGVHSAGEGSGVLRLGV--LAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
            DL+SDG VH +G  S  L L    L   E TC+++YGFLPCTTT LGNLFLILVYG LM+
Sbjct  32   DLLSDG-VHRSGTSSSFLTLHRPSLLKAESTCDETYGFLPCTTTVLGNLFLILVYGALMY  90

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
             AATYLS GSELLLEILGPG+IGGLFLPILGALPDAMLILVSGLSGS   AQ QVSVGMG
Sbjct  91   TAATYLSHGSELLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGSTETAQDQVSVGMG  150

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            LLAGSTVML+TV+WG+ V++GKCDI+  +A D KDT  FSLTGSGV+TD
Sbjct  151  LLAGSTVMLITVVWGSCVIIGKCDIENGIARDNKDTKGFSLTGSGVSTD  199



>gb|AAF69532.1|AC008007_7 F12M16.12 [Arabidopsis thaliana]
Length=574

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 145/175 (83%), Gaps = 7/175 (4%)
 Frame = +1

Query  130  SSDLVSDG---GVHSAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALGNLFLILV  291
            S+ L+SDG   G + AG GS V++  V AP   +EE CEQ+YGF+PCT TALGN+FLILV
Sbjct  30   STSLISDGIDGGSNLAGSGS-VIKSVVSAPAEEKEEACEQTYGFMPCTKTALGNVFLILV  88

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQ
Sbjct  89   YGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQ  148

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VSVGMGLLAGSTVMLLTVIWGT  VVGKCD++ ++AV+ +DT  F L  SGVT D
Sbjct  149  VSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVD  203



>gb|KJB45756.1| hypothetical protein B456_007G325800 [Gossypium raimondii]
Length=578

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 142/177 (80%), Gaps = 4/177 (2%)
 Frame = +1

Query  112  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I   SS  DLVSDG   S  +    L L  L   EE+CEQ+YGFLPCTTT LGNLFLI
Sbjct  24   RFITGPSSPTDLVSDG--ISTVKNPPFLSLKPLFSAEESCEQTYGFLPCTTTVLGNLFLI  81

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYGYLMFLAATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMFLAATYLSNGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGTAETAQ  141

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
             QVSVGMGLLAGSTVMLLTVIWG+ VVVG+CDI+ +VAVD   T  F LT +GV+TD
Sbjct  142  DQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDIRDSVAVDGTITKGFHLTETGVSTD  198



>ref|NP_564623.2| Na+/Ca 2+ exchanger-like protein [Arabidopsis thaliana]
 gb|AAM20402.1| unknown protein [Arabidopsis thaliana]
 gb|AEE32908.1| sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Arabidopsis thaliana]
Length=585

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 145/175 (83%), Gaps = 7/175 (4%)
 Frame = +1

Query  130  SSDLVSDG---GVHSAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALGNLFLILV  291
            S+ L+SDG   G + AG GS V++  V AP   +EE CEQ+YGF+PCT TALGN+FLILV
Sbjct  30   STSLISDGIDGGSNLAGSGS-VIKSVVSAPAEEKEEACEQTYGFMPCTKTALGNVFLILV  88

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQ
Sbjct  89   YGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQ  148

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VSVGMGLLAGSTVMLLTVIWGT  VVGKCD++ ++AV+ +DT  F L  SGVT D
Sbjct  149  VSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVD  203



>ref|XP_006392816.1| hypothetical protein EUTSA_v10011341mg [Eutrema salsugineum]
 gb|ESQ30102.1| hypothetical protein EUTSA_v10011341mg [Eutrema salsugineum]
Length=585

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 143/174 (82%), Gaps = 6/174 (3%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSG-VLRLGVLAP----EEETCEQSYGFLPCTTTALGNLFLILVY  294
            S+ L+SDG +     GSG V++  V AP    +EE CEQ+YGF+PCT TALGN+FLILVY
Sbjct  30   STGLISDG-IDGGNPGSGSVIKTVVSAPPAEEKEEACEQTYGFMPCTKTALGNVFLILVY  88

Query  295  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  474
            G+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQV
Sbjct  89   GFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQV  148

Query  475  SVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SVGMGLLAGSTVMLLTVIWGT  VVGKCD++  +AV+ +DT  FSL  SGVT D
Sbjct  149  SVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNNQDTKRFSLKDSGVTVD  202



>emb|CDY55841.1| BnaCnng29300D [Brassica napus]
Length=585

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 141/173 (82%), Gaps = 4/173 (2%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAP----EEETCEQSYGFLPCTTTALGNLFLILVYG  297
            S+DL+SDG    + +   ++R  V AP    +EE CEQ+YGF+PCT TALGN+FLILVYG
Sbjct  30   SADLISDGISGGSLDSGTIIRTVVSAPPAEEKEEACEQTYGFMPCTKTALGNVFLILVYG  89

Query  298  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  477
            +LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQVS
Sbjct  90   FLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQVS  149

Query  478  VGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VGMGLLAGSTVMLLTVIWGT  VVGKCD++  +AV+ +DT  F L  SGVT D
Sbjct  150  VGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDDIAVNNQDTKGFHLKDSGVTVD  202



>ref|XP_010279178.1| PREDICTED: uncharacterized protein LOC104613162 [Nelumbo nucifera]
Length=577

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 145/176 (82%), Gaps = 3/176 (2%)
 Frame = +1

Query  112  RLIVDRS-SDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  288
            R I + S SDLVSDG +++A   S +L +  L    E+CE +YGFLPCTTT +GNLFLI+
Sbjct  26   RFITESSHSDLVSDG-INNAQTKSPLLLIKRLR-ASESCENTYGFLPCTTTVVGNLFLII  83

Query  289  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
            VYGYLMFLAA+YLS GSELLL ILGPGLIGGLFLPILGALPDAMLILVSGLSGS   AQS
Sbjct  84   VYGYLMFLAASYLSDGSELLLAILGPGLIGGLFLPILGALPDAMLILVSGLSGSKETAQS  143

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            QV VGMGLLAGSTVMLLT++WG+ VVVGKCDI+ ++AVD +DT   SL GSG++TD
Sbjct  144  QVLVGMGLLAGSTVMLLTLLWGSCVVVGKCDIEESIAVDSQDTKRLSLVGSGISTD  199



>gb|KHG29939.1| Vacuolar calcium ion transporter [Gossypium arboreum]
Length=578

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 141/177 (80%), Gaps = 4/177 (2%)
 Frame = +1

Query  112  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I   SS  DL SDG   S  +    L L  L   EE+CEQ+YGFLPCTTT LGNLFLI
Sbjct  24   RFITGPSSPTDLFSDG--ISTVKNPPFLSLKPLFSAEESCEQTYGFLPCTTTVLGNLFLI  81

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYGYLMFLAATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMFLAATYLSNGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGTAETAQ  141

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
             QVSVGMGLLAGSTVMLLTVIWG+ VVVG+CDI+ +VAVD   T  F LT +GV+TD
Sbjct  142  DQVSVGMGLLAGSTVMLLTVIWGSCVVVGRCDIRDSVAVDGTITKGFHLTETGVSTD  198



>gb|KDP36271.1| hypothetical protein JCGZ_09836 [Jatropha curcas]
Length=585

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 143/173 (83%), Gaps = 4/173 (2%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
            SSDL+SDG   + G  S  + L  L+ + E+CEQ+YGFLPCTTTA GNLFLI+VYGYLM+
Sbjct  28   SSDLISDGVHDNNGVTSPYIFLNPLSFKAESCEQTYGFLPCTTTAFGNLFLIIVYGYLMY  87

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
            L+ATYLS+GSELLL ILGPG++GGLFLP+LGALPDAMLILVSG+SGS   AQSQVSVGMG
Sbjct  88   LSATYLSAGSELLLAILGPGIVGGLFLPMLGALPDAMLILVSGISGSKETAQSQVSVGMG  147

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDIQXA----VAVDLKDTXAFSLTGSGVTTD  636
            LLAGSTVML+TVIWG+ V+VGKCDI+ +    V +  ++T  FSL GSGV+TD
Sbjct  148  LLAGSTVMLITVIWGSCVIVGKCDIRESEIGPVTISGQNTKGFSLIGSGVSTD  200



>ref|XP_008367781.1| PREDICTED: uncharacterized protein LOC103431400 [Malus domestica]
Length=609

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 142/171 (83%), Gaps = 7/171 (4%)
 Frame = +1

Query  142  VSDGGVHSAGEGSGVL-----RLGVLAPEEE-TCEQSYGFLPCTTTALGNLFLILVYGYL  303
            VSDG VH     S V      R G +A E E  CE++YGFLPCT + LGNLFLILVYGYL
Sbjct  67   VSDG-VHRRSNNSTVPYLTLNRPGDIATEAEGECEETYGFLPCTDSVLGNLFLILVYGYL  125

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            M+LAATYLS+GSELLLEILGPG++GGLFLP+LG+LPDA+LILVSGLSGS   AQSQVSVG
Sbjct  126  MYLAATYLSNGSELLLEILGPGIVGGLFLPVLGSLPDAILILVSGLSGSKETAQSQVSVG  185

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTV++LT+IWG+ VVVGKCDI+ +VA+D KDT  FSLTGSGV+TD
Sbjct  186  MGLLAGSTVLILTLIWGSCVVVGKCDIRNSVAIDNKDTKGFSLTGSGVSTD  236



>emb|CDY25725.1| BnaC03g69500D [Brassica napus]
Length=581

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 139/169 (82%), Gaps = 0/169 (0%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
            S+DL+SDG        S  +   V++ EEE CEQ+YGF+PCT TALGN+FLILVYG+LMF
Sbjct  30   STDLISDGVNGEPLINSRSIIKTVVSAEEEACEQTYGFMPCTKTALGNVFLILVYGFLMF  89

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
             AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQ+QVSVGMG
Sbjct  90   TAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQTQVSVGMG  149

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            LLAGSTVMLLTVIWGT  VVGKCD++ ++AV+ +DT  F L  SGVT D
Sbjct  150  LLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVD  198



>ref|XP_008386231.1| PREDICTED: uncharacterized protein LOC103448741 [Malus domestica]
Length=584

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = +1

Query  115  LIVDRSSDLVSDGGVHSAGEGSGVLRLG-VLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
             I   S  L+SDG  H +   +  L L    +  + TC+Q+YGFLPCTTT +GNLFLILV
Sbjct  30   FIHSTSPGLISDGVHHRSHSFAPYLALNNSFSAADSTCDQTYGFLPCTTTVIGNLFLILV  89

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YGYLM+ AATYLS+GSELLLEILGPG+IGGLFLPILGALPDAMLILVSGLSG+   AQSQ
Sbjct  90   YGYLMYSAATYLSNGSELLLEILGPGIIGGLFLPILGALPDAMLILVSGLSGTTETAQSQ  149

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VSVGMGLLAGSTVML++VIWG+ V VGKCDI+ +VA+D +DT  FS+TGSGV+TD
Sbjct  150  VSVGMGLLAGSTVMLISVIWGSCVFVGKCDIEGSVAIDNRDTKGFSITGSGVSTD  204



>ref|XP_009144785.1| PREDICTED: uncharacterized protein LOC103868446 [Brassica rapa]
Length=585

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 141/173 (82%), Gaps = 4/173 (2%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAP----EEETCEQSYGFLPCTTTALGNLFLILVYG  297
            S+DL+SDG    + +   V++  V AP    +EE CEQ+YGF+PCT TALGN+FLILVYG
Sbjct  30   SADLISDGISGGSLDSGSVIKTVVSAPPAEEKEEACEQTYGFMPCTKTALGNVFLILVYG  89

Query  298  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  477
            +LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQVS
Sbjct  90   FLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQVS  149

Query  478  VGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VGMGLLAGSTVMLLTVIWGT  VVGKCD++  +A++ +DT  F L  SGVT D
Sbjct  150  VGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDNIALNNQDTKGFHLKDSGVTVD  202



>ref|XP_010535054.1| PREDICTED: uncharacterized protein LOC104810447 [Tarenaya hassleriana]
Length=573

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 141/178 (79%), Gaps = 11/178 (6%)
 Frame = +1

Query  112  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAP-EEETCEQSYGFLPCTTTALGNLFL  282
            R I  R S   LV DGG         ++   V AP EEE CEQ+YGF+PCT TALGN+FL
Sbjct  20   RFITARPSSTGLVYDGG--------SIIETVVSAPAEEEACEQTYGFMPCTKTALGNVFL  71

Query  283  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  462
            I+VYG+LMF AA YLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSG+   A
Sbjct  72   IIVYGFLMFTAAKYLSNGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGTPETA  131

Query  463  QSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            QSQVSVGMGLLAGSTVMLLTVIWGT  VVGKCD++ ++AV+ +DT  F LTGSGVT D
Sbjct  132  QSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNGQDTKGFHLTGSGVTVD  189



>gb|KJB13244.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=396

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 140/177 (79%), Gaps = 4/177 (2%)
 Frame = +1

Query  112  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I  R S   LVSDG   S  +    L L      EE+CEQSYGFLPCTTT LGN+FLI
Sbjct  24   RFITGRPSPTGLVSDGI--STVKNLPYLLLKPPVSAEESCEQSYGFLPCTTTVLGNMFLI  81

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYGYLM+LAATYLS GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGTAETAQ  141

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SQVSVGMGLLAGSTVMLLTVIWG+ ++VG+CD+  +VA+D  +T  F+L  SGV+TD
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDLHDSVAIDGTNTKGFNLKESGVSTD  198



>emb|CDY25869.1| BnaA05g14600D [Brassica napus]
Length=585

 Score =   167 bits (422),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 141/173 (82%), Gaps = 4/173 (2%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAP----EEETCEQSYGFLPCTTTALGNLFLILVYG  297
            S+DL+SDG    + +   +++  V AP    +EE CEQ+YGF+PCT TALGN+FLILVYG
Sbjct  30   SADLISDGISGGSLDSGSIIKTVVSAPPAEEKEEACEQTYGFMPCTKTALGNVFLILVYG  89

Query  298  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  477
            +LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQVS
Sbjct  90   FLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQVS  149

Query  478  VGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VGMGLLAGSTVMLLTVIWGT  VVGKCD++  +A++ +DT  F L  SGVT D
Sbjct  150  VGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDNIALNNQDTKGFHLKDSGVTVD  202



>ref|XP_002891737.1| sodium/calcium exchanger family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67996.1| sodium/calcium exchanger family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 142/175 (81%), Gaps = 6/175 (3%)
 Frame = +1

Query  130  SSDLVSDG---GVHSAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALGNLFLILV  291
            S+ L+SDG   G +  G    V++  V AP   +EE CEQ+YGF+PCT TALGN+FLILV
Sbjct  30   STSLISDGIDGGSNLDGGSGSVIKTVVSAPAEEKEEACEQTYGFMPCTKTALGNVFLILV  89

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQ
Sbjct  90   YGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQ  149

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VSVGMGLLAGSTVMLLTVIWGT  VVGKCD++ ++AV+ +DT  F L  SGVT D
Sbjct  150  VSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVD  204



>gb|ACY66868.1| P20Sh148J07 [Saccharum hybrid cultivar R570]
Length=563

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 134/167 (80%), Gaps = 3/167 (2%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  318
            L+SDG    +     V+RL    P EE CEQSYGFLPCTTT LGNLFL+L YG+ M+ AA
Sbjct  29   LISDGA--PSAPLVSVIRLSGSPPAEEKCEQSYGFLPCTTTVLGNLFLVLTYGFFMYKAA  86

Query  319  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  498
            TYLS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS  EAQSQV +GMGLLA
Sbjct  87   TYLSTGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKEEAQSQVLIGMGLLA  146

Query  499  GSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            GSTV LLT++WGT VVVGKCD+     AVDL DT  FSLTG+G+TTD
Sbjct  147  GSTVFLLTLLWGTCVVVGKCDLGPTREAVDLTDTKGFSLTGTGITTD  193



>gb|KHG25681.1| Vacuolar calcium ion transporter [Gossypium arboreum]
Length=578

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 141/177 (80%), Gaps = 4/177 (2%)
 Frame = +1

Query  112  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I  R S  DL+SDG   S  +    L L      EE+CEQSYGFLPCTTT LGN+FLI
Sbjct  24   RFITGRPSPTDLLSDGI--STVKNLPYLLLKPPVSAEESCEQSYGFLPCTTTVLGNMFLI  81

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYGYLM+LAATYLS GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGTAETAQ  141

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SQVSVGMGLLAGSTVMLLTVIWG+ ++VG+CD+  +VA+D  +T  F+L  SGV+TD
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDLHDSVAIDGTNTKGFNLKESGVSTD  198



>ref|XP_008226455.1| PREDICTED: uncharacterized protein LOC103326029 [Prunus mume]
Length=592

 Score =   166 bits (419),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 145/172 (84%), Gaps = 6/172 (3%)
 Frame = +1

Query  139  LVSDG---GVHSAGEGSGVLRL--GVLAPEEE-TCEQSYGFLPCTTTALGNLFLILVYGY  300
            ++SDG   G H++      L+L  G L+ E +  CE++YGFLPCT + LGNLFLILVYGY
Sbjct  42   VISDGVHVGPHNSTAPHLALKLLNGSLSAEADGACEETYGFLPCTRSVLGNLFLILVYGY  101

Query  301  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  480
            LM+LAATYLS+GSELLLEILGPG++GGLFLPILG+LPDA+LILVSGLSGS   AQSQVSV
Sbjct  102  LMYLAATYLSNGSELLLEILGPGIVGGLFLPILGSLPDAILILVSGLSGSTETAQSQVSV  161

Query  481  GMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GMGLLAGSTV++LT+IWG+ VVVGKCDIQ +VA+D +DT  FSLTGSGV+TD
Sbjct  162  GMGLLAGSTVLILTLIWGSCVVVGKCDIQNSVAIDNEDTKGFSLTGSGVSTD  213



>gb|KJB13247.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=506

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 140/177 (79%), Gaps = 4/177 (2%)
 Frame = +1

Query  112  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I  R S   LVSDG   S  +    L L      EE+CEQSYGFLPCTTT LGN+FLI
Sbjct  24   RFITGRPSPTGLVSDGI--STVKNLPYLLLKPPVSAEESCEQSYGFLPCTTTVLGNMFLI  81

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYGYLM+LAATYLS GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGTAETAQ  141

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SQVSVGMGLLAGSTVMLLTVIWG+ ++VG+CD+  +VA+D  +T  F+L  SGV+TD
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDLHDSVAIDGTNTKGFNLKESGVSTD  198



>ref|XP_002522155.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40234.1| calcium ion binding protein, putative [Ricinus communis]
Length=543

 Score =   165 bits (417),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 140/171 (82%), Gaps = 3/171 (2%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R ++   SDL+   G+H+    S +   G  A  EETCEQSYGFLPCTTTALGN+FLI+V
Sbjct  22   RPLLSDPSDLLVSDGLHTNRTSSHINLWGS-AAAEETCEQSYGFLPCTTTALGNMFLIIV  80

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YGYLMF+AATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSGS   AQSQ
Sbjct  81   YGYLMFIAATYLSNGSELLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKETAQSQ  140

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXA--VAVDLKDTXAFSLTG  618
            VSVGMGLLAGSTVMLLT+IWG+ VVVGKCDI+ A  +A+  +DT   SLTG
Sbjct  141  VSVGMGLLAGSTVMLLTIIWGSCVVVGKCDIREADSIAISGRDTRGISLTG  191



>gb|KJB13245.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=505

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 140/177 (79%), Gaps = 4/177 (2%)
 Frame = +1

Query  112  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I  R S   LVSDG   S  +    L L      EE+CEQSYGFLPCTTT LGN+FLI
Sbjct  24   RFITGRPSPTGLVSDGI--STVKNLPYLLLKPPVSAEESCEQSYGFLPCTTTVLGNMFLI  81

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYGYLM+LAATYLS GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGTAETAQ  141

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SQVSVGMGLLAGSTVMLLTVIWG+ ++VG+CD+  +VA+D  +T  F+L  SGV+TD
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDLHDSVAIDGTNTKGFNLKESGVSTD  198



>ref|XP_002279120.1| PREDICTED: uncharacterized protein LOC100253888 [Vitis vinifera]
 emb|CBI21944.3| unnamed protein product [Vitis vinifera]
Length=577

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            ++C+Q+YGFLPCTTT LGN+FLILVYGYLMF+AA +LS GSE+LL ILGPG+IGGLFLP+
Sbjct  58   DSCDQTYGFLPCTTTVLGNIFLILVYGYLMFIAAKFLSDGSEILLGILGPGIIGGLFLPV  117

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAV  576
            L A PDA++IL SGLSGS   AQSQVS+GMGLLAGSTVMLLT++WG+ ++VGKCDI+ +V
Sbjct  118  LSAFPDAVIILASGLSGSKETAQSQVSIGMGLLAGSTVMLLTILWGSCIIVGKCDIENSV  177

Query  577  AVDLKDTXAFSLTGSGVTTD  636
            A DLKDT  FSLTGSGV+TD
Sbjct  178  ATDLKDTRGFSLTGSGVSTD  197



>ref|XP_010675392.1| PREDICTED: uncharacterized protein LOC104891403 [Beta vulgaris 
subsp. vulgaris]
Length=572

 Score =   165 bits (417),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 137/175 (78%), Gaps = 3/175 (2%)
 Frame = +1

Query  121  VDRSSDLVSDGGVHSAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALGNLFLILV  291
            +  + DL+SD        G   LRL  +       E CEQSYGFLPCTTT LGN+FLILV
Sbjct  21   ISAARDLISDENNEVGVVGHSYLRLPTMKSVFSSSEICEQSYGFLPCTTTVLGNMFLILV  80

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YGYLM+ AATYLS GSELLLEILGPG+IGGLFLPILGALPDAMLI+VSGLSGS A AQ Q
Sbjct  81   YGYLMYTAATYLSYGSELLLEILGPGIIGGLFLPILGALPDAMLIMVSGLSGSPAVAQQQ  140

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            V VGMGLLAGSTVML+TVIWGT V+VGKCDI+ ++AVD +DT  F+L  SGV+TD
Sbjct  141  VFVGMGLLAGSTVMLITVIWGTCVLVGKCDIEGSLAVDERDTKGFNLRDSGVSTD  195



>emb|CDY24108.1| BnaA06g01060D [Brassica napus]
Length=648

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 142/177 (80%), Gaps = 3/177 (2%)
 Frame = +1

Query  112  RLIVDR--SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            RL+  R  S+DL+   G++ A  GS +  L     +EE CEQ+YGF+PCT TALGN+FLI
Sbjct  90   RLVAVRPSSTDLIISDGINGAS-GSVIKTLVSAEEKEEACEQTYGFMPCTKTALGNVFLI  148

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            LVYG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQ
Sbjct  149  LVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQ  208

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            +QVSVGMGLLAGSTVMLLTVIWGT  VVGKCD++  +AV+ +DT  F L  SGVT D
Sbjct  209  TQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDNIAVNNQDTKGFHLKDSGVTVD  265



>gb|KFK35737.1| hypothetical protein AALP_AA4G030000 [Arabis alpina]
Length=533

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +1

Query  199  VLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpglig  378
            V+  +EE CEQ+YGF+PCT TALGN+FLILVYG+LMF AATYLS+GSELLLEILGPG++G
Sbjct  5    VVPEKEEACEQTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVG  64

Query  379  glflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKC  558
            GLFLP+LGALPDAMLI+VSGLSG  +EAQSQVSVGMGLLAGSTVMLLTVIWGT  VVGKC
Sbjct  65   GLFLPMLGALPDAMLIMVSGLSGDASEAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKC  124

Query  559  DIQXAVAVDLKDTXAFSLTGSGVTTD  636
            D++ ++AV+ +DT  F L  SGVT D
Sbjct  125  DLRDSIAVNNQDTKGFHLKDSGVTVD  150



>gb|KJB13246.1| hypothetical protein B456_002G064800 [Gossypium raimondii]
Length=578

 Score =   164 bits (415),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 140/177 (79%), Gaps = 4/177 (2%)
 Frame = +1

Query  112  RLIVDRSSD--LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I  R S   LVSDG   S  +    L L      EE+CEQSYGFLPCTTT LGN+FLI
Sbjct  24   RFITGRPSPTGLVSDGI--STVKNLPYLLLKPPVSAEESCEQSYGFLPCTTTVLGNMFLI  81

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYGYLM+LAATYLS GSELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSG+   AQ
Sbjct  82   IVYGYLMYLAATYLSYGSELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGTAETAQ  141

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SQVSVGMGLLAGSTVMLLTVIWG+ ++VG+CD+  +VA+D  +T  F+L  SGV+TD
Sbjct  142  SQVSVGMGLLAGSTVMLLTVIWGSCIIVGRCDLHDSVAIDGTNTKGFNLKESGVSTD  198



>gb|KDO45772.1| hypothetical protein CISIN_1g0423002mg, partial [Citrus sinensis]
Length=372

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I + S+ ++SDG        S  L    L    + CEQ+YGFLPCTT+ LGN+FLI V
Sbjct  26   RPITNLSTVVISDGTHDVREPASTQLNNKYLISPSDMCEQTYGFLPCTTSLLGNVFLIAV  85

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YGYLM LAA  LS+GSE+LL+I+GPG+IGGLFLP+L ++PDA +IL SGLSGS   AQ+Q
Sbjct  86   YGYLMLLAAKLLSNGSEILLQIIGPGIIGGLFLPVLSSVPDAAIILASGLSGSKETAQNQ  145

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VSVGMGLLAGSTVMLLTV+WG+ ++VGKCDI+   AVDLKDT  FSLTGSGV+TD
Sbjct  146  VSVGMGLLAGSTVMLLTVLWGSCLLVGKCDIEGTTAVDLKDTKRFSLTGSGVSTD  200



>ref|XP_009106991.1| PREDICTED: uncharacterized protein LOC103832685 [Brassica rapa]
 emb|CDY02520.1| BnaA08g01270D [Brassica napus]
Length=583

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 141/174 (81%), Gaps = 8/174 (5%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGE----GSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNLFLILVY  294
            S+DL+SDG     GE       +++  V A E EE CEQ+YGF+PCT TALGN+FLILVY
Sbjct  30   STDLISDG---VNGEPLINSRSIIKTVVSAEEKEEACEQTYGFMPCTKTALGNVFLILVY  86

Query  295  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  474
            G+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQ+QV
Sbjct  87   GFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQTQV  146

Query  475  SVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SVGMGLLAGSTVMLLTVIWGT  VVGKCD++ ++AV+ +DT  F L  SGVT D
Sbjct  147  SVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQDTKGFHLKDSGVTVD  200



>ref|XP_004294083.1| PREDICTED: uncharacterized protein LOC101314065 [Fragaria vesca 
subsp. vesca]
Length=578

 Score =   162 bits (409),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 139/170 (82%), Gaps = 1/170 (1%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSG-VLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            S++LVSDG      E S  +L L  L   E TCE++YGF+PCTTT LGNLFL+LVYGYLM
Sbjct  33   STELVSDGISKPNYETSSYLLSLKPLTSAELTCEETYGFMPCTTTVLGNLFLMLVYGYLM  92

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
            + AA +LSSGSE+LLEILGPG++GGLFLP+L +LPDAMLILVSGLSGS   AQSQVSVG+
Sbjct  93   YSAAKWLSSGSEILLEILGPGIVGGLFLPVLTSLPDAMLILVSGLSGSTETAQSQVSVGI  152

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GLLAGSTV++L++IWG+ VVVGKCDI+ + A D KDT  F+ TGSGV+TD
Sbjct  153  GLLAGSTVLVLSLIWGSCVVVGKCDIEDSTAKDNKDTKGFNFTGSGVSTD  202



>gb|KCW69971.1| hypothetical protein EUGRSUZ_F03285 [Eucalyptus grandis]
Length=498

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            R SD VSDG       GS +L L   A   +TC+++YGFLPCTT  +GNLFLILVYGYLM
Sbjct  28   RLSDQVSDGLGKPLRRGSPLL-LPSWAASSDTCDETYGFLPCTTNWIGNLFLILVYGYLM  86

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
            + AAT LS GSE+LLEILGPGLIGGL LPILGALPDA+LILVSGLSGS   AQSQVSVG 
Sbjct  87   YTAATCLSGGSEMLLEILGPGLIGGLVLPILGALPDALLILVSGLSGSTETAQSQVSVGK  146

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GLLAGSTVMLLTVIWG+ V+VGKCD+Q + AVD  DT  FSLTGSG+T D
Sbjct  147  GLLAGSTVMLLTVIWGSCVLVGKCDLQDSTAVDKLDTKGFSLTGSGITID  196



>emb|CDY26003.1| BnaC06g06210D [Brassica napus]
Length=571

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 118/171 (69%), Positives = 137/171 (80%), Gaps = 14/171 (8%)
 Frame = +1

Query  130  SSDLVSDG--GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYL  303
            S++L+SDG   V SA E            +EE CEQ+YGF+PCT TALGN+FLILVYG+L
Sbjct  30   STNLISDGINTVVSAEE------------KEEACEQTYGFMPCTKTALGNVFLILVYGFL  77

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            MF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQ+QVSVG
Sbjct  78   MFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQTQVSVG  137

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTVMLLTVIWGT  VVGKCD++  +AV+ +DT  F L  SGVT D
Sbjct  138  MGLLAGSTVMLLTVIWGTCTVVGKCDLRDNIAVNNRDTKGFHLKDSGVTVD  188



>ref|XP_009147618.1| PREDICTED: uncharacterized protein LOC103871140 [Brassica rapa]
Length=576

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 140/177 (79%), Gaps = 7/177 (4%)
 Frame = +1

Query  112  RLIVDR--SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            RL+  R  S+DL+   G++      G L L     +EE CEQ+YGF+PCT TALGN+FLI
Sbjct  22   RLVSVRPSSTDLIISDGING-----GNLALVSAEEKEEACEQTYGFMPCTKTALGNVFLI  76

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            LVYG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQ
Sbjct  77   LVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQ  136

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            +QVSVGMGLLAGSTVMLLTVIWGT  VVGKCD++  +AV+ +DT  F L  SGVT D
Sbjct  137  TQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDNIAVNNQDTKGFHLKDSGVTVD  193



>ref|NP_001151543.1| LOC100285177 precursor [Zea mays]
 gb|ACG43258.1| calcium ion binding protein [Zea mays]
Length=568

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  318
            L+SDGG         V+RL    P E  CEQ+YGFLPCTTT LGNLFL+L YG+LMF AA
Sbjct  30   LISDGG--PPAPLLPVIRLAA-PPAEAECEQTYGFLPCTTTVLGNLFLVLAYGFLMFKAA  86

Query  319  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  498
            T+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS  EAQSQV +GMGLLA
Sbjct  87   TFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKEEAQSQVLIGMGLLA  146

Query  499  GSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            GSTV LLT++WGT VVVGKCD+     AVD+ DT  FSLTG+GVTTD
Sbjct  147  GSTVFLLTLLWGTCVVVGKCDLGPGREAVDVTDTKGFSLTGTGVTTD  193



>ref|XP_008655084.1| PREDICTED: LOC100285177 isoform X1 [Zea mays]
Length=596

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 134/167 (80%), Gaps = 4/167 (2%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  318
            L+SDGG         V+RL    P E  CEQ+YGFLPCTTT LGNLFL+L YG+LMF AA
Sbjct  30   LISDGG--PPAPLLPVIRLAA-PPAEAECEQTYGFLPCTTTVLGNLFLVLAYGFLMFKAA  86

Query  319  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  498
            T+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS  EAQSQV +GMGLLA
Sbjct  87   TFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKEEAQSQVLIGMGLLA  146

Query  499  GSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            GSTV LLT++WGT VVVGKCD+     AVD+ DT  FSLTG+GVTTD
Sbjct  147  GSTVFLLTLLWGTCVVVGKCDLGPGREAVDVTDTKGFSLTGTGVTTD  193



>ref|XP_010062838.1| PREDICTED: uncharacterized protein LOC104450104 [Eucalyptus grandis]
 gb|KCW69970.1| hypothetical protein EUGRSUZ_F03285 [Eucalyptus grandis]
Length=577

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 135/170 (79%), Gaps = 1/170 (1%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            R SD VSDG       GS +L L   A   +TC+++YGFLPCTT  +GNLFLILVYGYLM
Sbjct  28   RLSDQVSDGLGKPLRRGSPLL-LPSWAASSDTCDETYGFLPCTTNWIGNLFLILVYGYLM  86

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
            + AAT LS GSE+LLEILGPGLIGGL LPILGALPDA+LILVSGLSGS   AQSQVSVG 
Sbjct  87   YTAATCLSGGSEMLLEILGPGLIGGLVLPILGALPDALLILVSGLSGSTETAQSQVSVGK  146

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GLLAGSTVMLLTVIWG+ V+VGKCD+Q + AVD  DT  FSLTGSG+T D
Sbjct  147  GLLAGSTVMLLTVIWGSCVLVGKCDLQDSTAVDKLDTKGFSLTGSGITID  196



>ref|XP_006469050.1| PREDICTED: uncharacterized protein LOC102616350 [Citrus sinensis]
Length=577

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 138/176 (78%), Gaps = 2/176 (1%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGV-LRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  288
            R I + S+ ++SDG  H   E + + L    L    + CEQ+YGFLPCTT+ LGN+FLI 
Sbjct  26   RPITNLSTAVISDG-THDVRETALIQLNNKYLISPSDMCEQTYGFLPCTTSLLGNVFLIA  84

Query  289  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
            VYGYLM LAA  LS+GSE+LL+I+GPG+IGGLFLP+L ++PDA +IL SGLSGS   AQ+
Sbjct  85   VYGYLMLLAAKLLSNGSEILLQIIGPGIIGGLFLPVLSSVPDAAIILASGLSGSKETAQN  144

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            QVSVGMGLLAGSTVMLLTV+WG+ ++VGKCDI+   AVDLKDT  FSLTGSGV+TD
Sbjct  145  QVSVGMGLLAGSTVMLLTVLWGSCLLVGKCDIEGTTAVDLKDTKRFSLTGSGVSTD  200



>ref|XP_007021639.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
 gb|EOY13164.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
Length=707

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 139/177 (79%), Gaps = 3/177 (2%)
 Frame = +1

Query  112  RLIVDRSS--DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R I  R S  DLVSDG + +      +L L  LA  E +CEQ+YGFLPC+TTALGNLFLI
Sbjct  24   RFITGRPSPTDLVSDG-ISTVKSPPYLLLLKPLASAEVSCEQTYGFLPCSTTALGNLFLI  82

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            LVYGYLM+LAATYLS+GSE+L  I GPG++GGL LP LGALP+AMLILVSGLSG+   AQ
Sbjct  83   LVYGYLMYLAATYLSNGSEVLHVIRGPGIVGGLSLPPLGALPNAMLILVSGLSGAPETAQ  142

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            SQVSVGMG+LAGST+M LTV+WG+ V VG+CD++ +VAVD   T  FSLT +GV+TD
Sbjct  143  SQVSVGMGMLAGSTIMFLTVVWGSCVAVGRCDLRDSVAVDGTITKGFSLTETGVSTD  199



>gb|ACY66874.1| P20Sh095F0 [Saccharum hybrid cultivar R570]
Length=573

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +1

Query  214  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  393
            EE CEQSYGFLPCTTT LGNLFL+L YG+LM+ AATYLS+GSELLLEI+GPGL+GGL LP
Sbjct  60   EEKCEQSYGFLPCTTTVLGNLFLVLTYGFLMYKAATYLSTGSELLLEIMGPGLVGGLLLP  119

Query  394  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QX  570
            ILGALPDA+L+LVSGLSGS  EAQSQV +GMGLLAGSTV LLT++WGT VVVGKCD+   
Sbjct  120  ILGALPDALLVLVSGLSGSKEEAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPT  179

Query  571  AVAVDLKDTXAFSLTGSGVTTD  636
              AVDL DT  FSLTG+G+TTD
Sbjct  180  REAVDLTDTKGFSLTGTGITTD  201



>dbj|BAI94501.1| sodium/calcium exchanger protein [Dianthus caryophyllus]
Length=581

 Score =   159 bits (402),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            E CEQ+YGFLPCTTT  GN+FLI VYGYLM+LAAT+LS GSELLLEILGPG++GGLFLP+
Sbjct  64   EECEQTYGFLPCTTTWAGNMFLIGVYGYLMYLAATFLSDGSELLLEILGPGIVGGLFLPV  123

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAV  576
            LGALPDAMLILVSG+SGS +EAQSQVSVGMGLLAGSTVMLLTVIWGT +++GKCD+    
Sbjct  124  LGALPDAMLILVSGISGSTSEAQSQVSVGMGLLAGSTVMLLTVIWGTCILIGKCDMDGTE  183

Query  577  AVDLKDTXAFSLTGSGVTTD  636
            A+DL DT  FSL GSGV+TD
Sbjct  184  AIDLTDTKGFSLLGSGVSTD  203



>ref|XP_006852513.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda]
 gb|ERN13980.1| hypothetical protein AMTR_s00021p00164610 [Amborella trichopoda]
Length=574

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 143/176 (81%), Gaps = 2/176 (1%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            RL    +SDL+SDG   S+   S +L L   +   ETCEQ+YGFLPCT+T LGNLFL++V
Sbjct  25   RLFSTENSDLISDGAS-SSSSWSSLLVLKGKSATSETCEQTYGFLPCTSTVLGNLFLVIV  83

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            YGYLMFL ATYLS+GSELLLE+LGPG++GGLFLPILGALPDA+LILVSGLSGS   AQ Q
Sbjct  84   YGYLMFLGATYLSTGSELLLEVLGPGIVGGLFLPILGALPDAILILVSGLSGSTETAQKQ  143

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            V +GMGLL+GSTVMLLT++WG+ +V+GKCD+ + + A+D +DT  FSL GSG+TTD
Sbjct  144  VLIGMGLLSGSTVMLLTLLWGSCIVLGKCDLSERSTAIDQQDTKRFSLIGSGITTD  199



>ref|XP_002525142.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF37269.1| calcium ion binding protein, putative [Ricinus communis]
Length=543

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 134/166 (81%), Gaps = 0/166 (0%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  318
            +VSDG   SA      +RL  L   + +C+++YGF PCTTT LGN+FLILVYGYLMFL+A
Sbjct  1    MVSDGKYSSAQGQQPFIRLYDLFSSDGSCDETYGFFPCTTTILGNIFLILVYGYLMFLSA  60

Query  319  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  498
              LS GSE+LL+ILGPG+IGGLFLP+L ALPD+ +IL SGLSGS   AQSQVSVGMGL+A
Sbjct  61   KLLSDGSEILLQILGPGIIGGLFLPVLSALPDSAIILASGLSGSTETAQSQVSVGMGLMA  120

Query  499  GSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GSTV+LLT++WG+ ++VGKCDI+ +VAVD KDT  FSL GSGVTTD
Sbjct  121  GSTVLLLTLLWGSCLIVGKCDIEGSVAVDSKDTKTFSLIGSGVTTD  166



>ref|XP_009348415.1| PREDICTED: uncharacterized protein LOC103940069 [Pyrus x bretschneideri]
 ref|XP_009348416.1| PREDICTED: uncharacterized protein LOC103940070 [Pyrus x bretschneideri]
Length=580

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 121/171 (71%), Positives = 140/171 (82%), Gaps = 7/171 (4%)
 Frame = +1

Query  142  VSDGGVHSAGEGSGVLRLGVLAPEE------ETCEQSYGFLPCTTTALGNLFLILVYGYL  303
            VSDG VH     S V  L +  P +        CE++YGFLPCT + LGNLFLILVYGYL
Sbjct  38   VSDG-VHRRSNNSTVPYLTLNRPGDIAAEAEGECEETYGFLPCTDSVLGNLFLILVYGYL  96

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            M+LAATYLS+GSELLLEILGPG++GGLFLP+LG+LPDA+LILVSGLSGS   AQSQVSVG
Sbjct  97   MYLAATYLSNGSELLLEILGPGIVGGLFLPVLGSLPDAILILVSGLSGSKETAQSQVSVG  156

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTV++LT+IWG+ VVVGKCDIQ +VA+D KDT  FSLTGSGV+TD
Sbjct  157  MGLLAGSTVLILTLIWGSCVVVGKCDIQNSVAIDNKDTKGFSLTGSGVSTD  207



>ref|XP_006451747.1| hypothetical protein CICLE_v10007809mg [Citrus clementina]
 ref|XP_006494847.1| PREDICTED: uncharacterized protein LOC102612450 [Citrus sinensis]
 gb|ESR64987.1| hypothetical protein CICLE_v10007809mg [Citrus clementina]
 gb|KDO58493.1| hypothetical protein CISIN_1g048038mg [Citrus sinensis]
Length=591

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAP--------EEETCEQSYGFLPCTTTALGNLFLI  285
             SDL+SDG   +        +  +L P           TCEQ+YGFLPCTTT LGNLFLI
Sbjct  33   PSDLISDGINSNNNHNQRGPQYLLLNPFIKAEEESSSSTCEQTYGFLPCTTTVLGNLFLI  92

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VYGYLM++AATYLS+GSELLLEILGPG++GGLFLPILGALPDAMLILVSGLSG+   AQ
Sbjct  93   IVYGYLMYVAATYLSNGSELLLEILGPGVVGGLFLPILGALPDAMLILVSGLSGTKETAQ  152

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQX--AVAVDLKDTXAFSLTGSGVTTD  636
            SQVSVGMGLLAGSTVML TVIWGT VVVGKCD++   +VA+D ++T  F LTG+GV+TD
Sbjct  153  SQVSVGMGLLAGSTVMLSTVIWGTCVVVGKCDLRESDSVAIDGQNTKGFRLTGTGVSTD  211



>ref|XP_004968611.1| PREDICTED: uncharacterized protein LOC101771765 [Setaria italica]
Length=575

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 136/171 (80%), Gaps = 5/171 (3%)
 Frame = +1

Query  139  LVSDGGV-HSAGEGSGVLRLG---VLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            L+SDGG   SA   + V+RL    V A  E  CEQSYGFLPCTTT LGNLFLILVYG+LM
Sbjct  30   LISDGGAAPSAPLLASVIRLASPAVAAAVEGKCEQSYGFLPCTTTVLGNLFLILVYGFLM  89

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
            F AATYLSSGSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS   AQSQV +GM
Sbjct  90   FKAATYLSSGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKETAQSQVLIGM  149

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            GLLAGSTV LLT++WGT VVVGKCD      AVDL +T  FSLTG+ +TTD
Sbjct  150  GLLAGSTVFLLTLLWGTCVVVGKCDAGPNGEAVDLTNTKGFSLTGTCITTD  200



>ref|XP_008673552.1| PREDICTED: uncharacterized protein LOC103649588 [Zea mays]
Length=575

 Score =   157 bits (397),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 136/174 (78%), Gaps = 10/174 (6%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRLGVLAPEEET-------CEQSYGFLPCTTTALGNLFLILVYG  297
            L+SDGG   + +   V+RL   +P           CEQSYGFLPCTTT LGNLFL+L YG
Sbjct  29   LISDGG--PSAQLLSVIRLSGSSPAAGAAAKAEEKCEQSYGFLPCTTTVLGNLFLVLTYG  86

Query  298  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  477
            YLM+ AATYLS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS  EAQSQV 
Sbjct  87   YLMYKAATYLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSKEEAQSQVL  146

Query  478  VGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            +GMGLLAGSTV LLT++WGT VVVGKCD+     AVD+ DT  FSLTG+G+TTD
Sbjct  147  IGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPNREAVDVTDTKGFSLTGTGITTD  200



>ref|XP_003565462.1| PREDICTED: uncharacterized protein LOC100838274 [Brachypodium 
distachyon]
Length=582

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 136/180 (76%), Gaps = 14/180 (8%)
 Frame = +1

Query  139  LVSDGG----------VHSAGEGSGVLRLGVLAP---EEETCEQSYGFLPCTTTALGNLF  279
            L+SDG           + S    S V+RL   +P   E E CEQSYGFLPCTTT  GNLF
Sbjct  28   LISDGSPASTASSSILIASPVSSSDVIRLNTSSPAAAEAEQCEQSYGFLPCTTTVFGNLF  87

Query  280  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  459
            L+L YG+LMF AAT+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSG+   
Sbjct  88   LVLTYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGTKET  147

Query  460  AQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            AQSQV +GMGLLAGSTV LLT++WGT VVVGKCD+    VA+D  DT  FSLTG+G++TD
Sbjct  148  AQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDVGPNNVAIDSTDTKGFSLTGAGISTD  207



>ref|XP_006446746.1| hypothetical protein CICLE_v10018123mg, partial [Citrus clementina]
 gb|ESR59986.1| hypothetical protein CICLE_v10018123mg, partial [Citrus clementina]
Length=575

 Score =   157 bits (396),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 135/176 (77%), Gaps = 2/176 (1%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEG-SGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  288
            R I + S+ ++SDG  H   E  S  L    L    + CEQ+YGFLPCTT+ LGN+FLI 
Sbjct  26   RPITNLSTVVISDG-THDVREPVSTQLNNKYLISPSDMCEQTYGFLPCTTSLLGNVFLIA  84

Query  289  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
            VYGYLM LAA  LS+GSE+LL+I+GPG+IGGLFLP+L ++PDA +IL SGLSGS   AQ+
Sbjct  85   VYGYLMLLAAKLLSNGSEILLQIIGPGIIGGLFLPVLSSVPDAAIILASGLSGSKETAQN  144

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            QVSVGMGLLAGS VMLLTV+WG+ ++VGKCDI+   AVDLKDT  FS TGSGV+TD
Sbjct  145  QVSVGMGLLAGSIVMLLTVLWGSCLLVGKCDIEGTTAVDLKDTKRFSFTGSGVSTD  200



>ref|XP_010277718.1| PREDICTED: uncharacterized protein LOC104612097 isoform X2 [Nelumbo 
nucifera]
Length=199

 Score =   149 bits (377),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 133/171 (78%), Gaps = 3/171 (2%)
 Frame = +1

Query  112  RLIVDR-SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  288
            R I +  SS+LVSDG  +   +  G+    + A   ETCEQ+YGFLPCTT  +GNLFLI+
Sbjct  26   RFITESFSSNLVSDGVENGRVQSPGIFLKRLRA--SETCEQTYGFLPCTTNVVGNLFLII  83

Query  289  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
            VYG+LMF  A YLS GSELLL +LGPG+IGGLFLPILGALPDAMLILVSGLSGS   AQS
Sbjct  84   VYGFLMFHGARYLSDGSELLLSVLGPGIIGGLFLPILGALPDAMLILVSGLSGSRETAQS  143

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGS  621
            QV VGMGLLAGSTVMLLT +WG+ ++VGKCDI+ + AVDL+DT   SL+ +
Sbjct  144  QVLVGMGLLAGSTVMLLTSLWGSCIIVGKCDIEDSTAVDLQDTKGLSLSAN  194



>ref|XP_010277717.1| PREDICTED: uncharacterized protein LOC104612097 isoform X1 [Nelumbo 
nucifera]
Length=200

 Score =   149 bits (376),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 132/169 (78%), Gaps = 3/169 (2%)
 Frame = +1

Query  112  RLIVDR-SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  288
            R I +  SS+LVSDG  +   +  G+    + A   ETCEQ+YGFLPCTT  +GNLFLI+
Sbjct  26   RFITESFSSNLVSDGVENGRVQSPGIFLKRLRA--SETCEQTYGFLPCTTNVVGNLFLII  83

Query  289  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
            VYG+LMF  A YLS GSELLL +LGPG+IGGLFLPILGALPDAMLILVSGLSGS   AQS
Sbjct  84   VYGFLMFHGARYLSDGSELLLSVLGPGIIGGLFLPILGALPDAMLILVSGLSGSRETAQS  143

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLT  615
            QV VGMGLLAGSTVMLLT +WG+ ++VGKCDI+ + AVDL+DT   SL+
Sbjct  144  QVLVGMGLLAGSTVMLLTSLWGSCIIVGKCDIEDSTAVDLQDTKGLSLS  192



>ref|XP_010060650.1| PREDICTED: uncharacterized protein LOC104448506 [Eucalyptus grandis]
 gb|KCW67435.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=589

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 133/159 (84%), Gaps = 4/159 (3%)
 Frame = +1

Query  172  EGSGVLRLGVLAPEE----ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgs  339
             GS  L+L   +P +     +CE++YGFLPCT +  GNLFLI+VYG LMFLAATYLS+GS
Sbjct  53   PGSPYLQLLRSSPADAESASSCEETYGFLPCTASWPGNLFLIVVYGSLMFLAATYLSNGS  112

Query  340  ellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLL  519
            ELLLEILGPG++GGLFLP+LGALPDAMLILVSGLSGS   AQSQVSVGMGLLAGSTVMLL
Sbjct  113  ELLLEILGPGIVGGLFLPMLGALPDAMLILVSGLSGSTETAQSQVSVGMGLLAGSTVMLL  172

Query  520  TVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            TVIWG+ ++VGKCD+  +VA+D +DT  FSL GSGV+TD
Sbjct  173  TVIWGSCIIVGKCDLHNSVAMDKQDTKGFSLKGSGVSTD  211



>emb|CDM82192.1| unnamed protein product [Triticum aestivum]
Length=579

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 137/177 (77%), Gaps = 11/177 (6%)
 Frame = +1

Query  139  LVSDG-------GVHSAGEGSGVLRLGVLAPE---EETCEQSYGFLPCTTTALGNLFLIL  288
            L+SDG        V ++   S VLRL   +P     E CEQ+YGFLPCTTT  GN+FL+L
Sbjct  28   LISDGMPATPSSSVLASPLSSAVLRLNSSSPATAAAEECEQTYGFLPCTTTVFGNMFLVL  87

Query  289  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
             YG+LMF AAT+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSG+   AQS
Sbjct  88   TYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGTKETAQS  147

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            QV +GMGLLAGSTV LLT++WGT VVVGKCD+ +  VA+D  DT  FSLTGSG+TTD
Sbjct  148  QVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDVGENGVAIDSTDTKGFSLTGSGITTD  204



>ref|XP_007213018.1| hypothetical protein PRUPE_ppa023026mg [Prunus persica]
 gb|EMJ14217.1| hypothetical protein PRUPE_ppa023026mg [Prunus persica]
Length=575

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  318
            +VSDG +    + + +   G L    ++C+Q+YGFLPCTTT LGN FLI+VYGYLMFL+A
Sbjct  34   MVSDGVLEKTPKPNSIWLPGRLF-SSDSCDQTYGFLPCTTTVLGNTFLIIVYGYLMFLSA  92

Query  319  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  498
              LS+GSE+LL+ILGPG++GG FLP+L ++PDA +IL SGLSG    AQSQVSVGMGLLA
Sbjct  93   KLLSNGSEILLQILGPGIVGGFFLPLLSSIPDATIILASGLSGDTETAQSQVSVGMGLLA  152

Query  499  GSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GS VMLLT++WGT ++VGKCD++ +VAVD KD   FSLTGSGV+TD
Sbjct  153  GSNVMLLTILWGTCLLVGKCDLENSVAVDQKDEKRFSLTGSGVSTD  198



>ref|XP_006643900.1| PREDICTED: uncharacterized protein LOC102712578 [Oryza brachyantha]
Length=577

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 137/179 (77%), Gaps = 5/179 (3%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEE---ETCEQSYGFLPCTTTALGNLFL  282
            RLI D  S       + S+   S VLRL   A      E CEQSYGFLPCTTT LGN+FL
Sbjct  25   RLISD-GSPAAPSTSLLSSNPVSAVLRLSTSASPAAAGEKCEQSYGFLPCTTTVLGNVFL  83

Query  283  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  462
            +L YG+LM+ AAT+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSGS   A
Sbjct  84   VLAYGFLMYKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGSRETA  143

Query  463  QSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            QSQV +GMGLLAGSTV LLTV+WGT VVVGKCDI    VAVDL++   FSLTG+G++TD
Sbjct  144  QSQVLIGMGLLAGSTVFLLTVLWGTCVVVGKCDIGPNGVAVDLQNNKGFSLTGTGISTD  202



>ref|XP_004305436.1| PREDICTED: uncharacterized protein LOC101295737 [Fragaria vesca 
subsp. vesca]
Length=580

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 138/171 (81%), Gaps = 6/171 (4%)
 Frame = +1

Query  124  DRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYL  303
            D   +LVSDG   S+ +    + L       ++C+++YGFLPCT+T LGN+FLI+VYGY+
Sbjct  32   DSLFNLVSDGVNQSSWDELNYIWLS------DSCDETYGFLPCTSTVLGNIFLIIVYGYV  85

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            MFL+A  LS+GSE+LL+ILGPG+IGGLFLP+L A+PDA +IL SGLSG  A AQSQVSVG
Sbjct  86   MFLSAKLLSAGSEILLQILGPGIIGGLFLPLLSAVPDATIILASGLSGDTATAQSQVSVG  145

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGS VMLLT++WGT ++VGKCD++ +VAVD KDT +FSLTGSGV+TD
Sbjct  146  MGLLAGSNVMLLTILWGTCLIVGKCDLENSVAVDEKDTKSFSLTGSGVSTD  196



>ref|XP_008229131.1| PREDICTED: uncharacterized protein LOC103328510 [Prunus mume]
Length=575

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 132/166 (80%), Gaps = 1/166 (1%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  318
            +VSDG +    + + +   G L    ++C+Q+YGFLPCTTT LGN FLI+VYGYLMFL+A
Sbjct  34   MVSDGVLEKTPKPNSIWLPGRLF-SSDSCDQTYGFLPCTTTVLGNTFLIIVYGYLMFLSA  92

Query  319  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  498
              LS+GSE+LL+ILGPG++GG FLP+L ++PDA +IL SGLSG    AQSQVSVGMGLLA
Sbjct  93   KLLSNGSEILLQILGPGIVGGFFLPLLSSIPDATIILASGLSGDTETAQSQVSVGMGLLA  152

Query  499  GSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GS VMLLT++WGT ++VGKCD++ +VAVD KD   FSLTGSGV+TD
Sbjct  153  GSNVMLLTILWGTCLLVGKCDLENSVAVDQKDEKRFSLTGSGVSTD  198



>ref|NP_001042378.1| Os01g0212400 [Oryza sativa Japonica Group]
 dbj|BAD73036.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04292.1| Os01g0212400 [Oryza sativa Japonica Group]
 dbj|BAG89983.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70160.1| hypothetical protein OsI_00872 [Oryza sativa Indica Group]
 gb|EEE54102.1| hypothetical protein OsJ_00857 [Oryza sativa Japonica Group]
Length=584

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 124/142 (87%), Gaps = 1/142 (1%)
 Frame = +1

Query  214  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  393
            EE CEQSYGFLPCTTT LGNLFL+L YG+LM+ AAT+LS+GSELLLEI+GPGL+GGL LP
Sbjct  68   EEKCEQSYGFLPCTTTVLGNLFLVLAYGFLMYKAATFLSAGSELLLEIMGPGLVGGLLLP  127

Query  394  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QX  570
            ILGALPDA+L+LVSGLSGS   AQSQV +GMGLLAGSTV LLT++WGT VVVGKCDI   
Sbjct  128  ILGALPDALLVLVSGLSGSRETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDIGPN  187

Query  571  AVAVDLKDTXAFSLTGSGVTTD  636
             VAVDL++   FSLTG+G++TD
Sbjct  188  GVAVDLQNNKGFSLTGTGISTD  209



>ref|XP_009354324.1| PREDICTED: uncharacterized protein LOC103945475 [Pyrus x bretschneideri]
Length=585

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/172 (62%), Positives = 135/172 (78%), Gaps = 6/172 (3%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLR------LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGY  300
            +V+DGG     +   V +      +  L   + +CEQ+YGFLPCT+T LGN+FL+LVYGY
Sbjct  37   MVTDGGNQLLLQNQNVWKPFFSGLMDSLFSSDSSCEQTYGFLPCTSTVLGNIFLVLVYGY  96

Query  301  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  480
            LMFL+A  LS+GSE+LL+ILGPG++GGLFLP+LG+LPDA +IL SGLSG    AQSQVSV
Sbjct  97   LMFLSAKLLSNGSEILLQILGPGIVGGLFLPLLGSLPDATIILASGLSGDTETAQSQVSV  156

Query  481  GMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GMGL+AGS VMLLT++WGT ++VGKCDI+ ++AVD KD   FSLTGSGV+TD
Sbjct  157  GMGLMAGSNVMLLTILWGTCLIVGKCDIENSIAVDQKDEKLFSLTGSGVSTD  208



>ref|XP_008362437.1| PREDICTED: uncharacterized protein LOC103426126 [Malus domestica]
Length=549

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 135/172 (78%), Gaps = 6/172 (3%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLR------LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGY  300
            +V+DGG     +   V +      +  L   + +CEQ+YGFLPCT+T LGN+FL+LVYGY
Sbjct  1    MVTDGGNQLLLQNQNVWKPFFSGLMDSLFSSDSSCEQTYGFLPCTSTVLGNIFLVLVYGY  60

Query  301  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  480
            +MFL+A  LS+GSE+LL+ILGPG++GGLFLP+LG+LPDA +IL SGLSG    AQSQVSV
Sbjct  61   MMFLSAKLLSNGSEILLQILGPGIVGGLFLPLLGSLPDATIILASGLSGDTETAQSQVSV  120

Query  481  GMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GMGL+AGS VMLLT++WGT ++VGKCDI+ ++AVD KD   FSLTGSGV+TD
Sbjct  121  GMGLMAGSNVMLLTILWGTCLIVGKCDIENSIAVDQKDEKRFSLTGSGVSTD  172



>ref|XP_008368645.1| PREDICTED: uncharacterized protein LOC103432241 [Malus domestica]
Length=585

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 135/172 (78%), Gaps = 6/172 (3%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLR------LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGY  300
            +V+DGG     +   V +      +  L   + +CEQ+YGFLPCT+T LGN+FL+LVYGY
Sbjct  37   MVTDGGNQLLLQNQNVWKPFFSGLMDSLFSSDSSCEQTYGFLPCTSTVLGNIFLVLVYGY  96

Query  301  LMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSV  480
            +MFL+A  LS+GSE+LL+ILGPG++GGLFLP+LG+LPDA +IL SGLSG    AQSQVSV
Sbjct  97   MMFLSAKLLSNGSEILLQILGPGIVGGLFLPLLGSLPDATIILASGLSGDTETAQSQVSV  156

Query  481  GMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GMGL+AGS VMLLT++WGT ++VGKCDI+ ++AVD KD   FSLTGSGV+TD
Sbjct  157  GMGLMAGSNVMLLTILWGTCLIVGKCDIENSIAVDQKDEKRFSLTGSGVSTD  208



>dbj|BAJ93500.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 136/177 (77%), Gaps = 11/177 (6%)
 Frame = +1

Query  139  LVSDG-------GVHSAGEGSGVLRLGVLAPE---EETCEQSYGFLPCTTTALGNLFLIL  288
            L+SDG        + ++   S  +RL   +P     E CEQSYGFLPCTTT  GN+FL+L
Sbjct  28   LISDGMPATPSSSILASPLSSAAIRLNSSSPATAAAEECEQSYGFLPCTTTVFGNMFLVL  87

Query  289  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
             YG+LMF AAT+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSG+   AQS
Sbjct  88   TYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGTKETAQS  147

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            QV +GMGLLAGST+ LLT++WGT VVVGKCD+ +  VA+D  DT  FSLTGSG+TTD
Sbjct  148  QVLIGMGLLAGSTIFLLTLLWGTCVVVGKCDVGENGVAIDSTDTKGFSLTGSGITTD  204



>gb|EAZ04370.1| hypothetical protein OsI_26513 [Oryza sativa Indica Group]
Length=502

 Score =   154 bits (388),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 138/170 (81%), Gaps = 4/170 (2%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
             +SDGG  +A   + VLRL      A E+  CE SYGFLPCTTTA GNLFL+L YG+LMF
Sbjct  32   FISDGGNANANANASVLRLPSAAAAAGEDIGCEMSYGFLPCTTTAWGNLFLVLAYGFLMF  91

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
             +ATYLSSGSE+LL+ILGPG++GGLFLPILGALPDA+LILVSGLSG+   AQSQV +GMG
Sbjct  92   KSATYLSSGSEMLLQILGPGIVGGLFLPILGALPDALLILVSGLSGTKEVAQSQVLIGMG  151

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            LLAGSTVMLLT++WG+ VVVGKCD+ + + A+D +DT  FSL GSGV+TD
Sbjct  152  LLAGSTVMLLTLLWGSCVVVGKCDLSENSTAIDSRDTKGFSLLGSGVSTD  201



>dbj|BAD19956.1| putative drought-induced protein RDI [Oryza sativa Japonica Group]
 dbj|BAD19782.1| putative drought-induced protein RDI [Oryza sativa Japonica Group]
Length=571

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 138/170 (81%), Gaps = 4/170 (2%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
             +SDGG  +A   + VLRL      A E+  CE SYGFLPCTTTA GNLFL+L YG+LMF
Sbjct  32   FISDGGNANANANASVLRLPSAAAAAGEDMGCEMSYGFLPCTTTAWGNLFLVLAYGFLMF  91

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
             +ATYLSSGSE+LL+ILGPG++GGLFLPILGALPDA+LILVSGLSG+   AQSQV +GMG
Sbjct  92   KSATYLSSGSEMLLQILGPGIVGGLFLPILGALPDALLILVSGLSGTKEVAQSQVLIGMG  151

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            LLAGSTVMLLT++WG+ VVVGKCD+ + + A+D +DT  FSL GSGV+TD
Sbjct  152  LLAGSTVMLLTLLWGSCVVVGKCDLSENSTAIDSRDTKGFSLLGSGVSTD  201



>gb|EEE56655.1| hypothetical protein OsJ_06069 [Oryza sativa Japonica Group]
Length=575

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 138/170 (81%), Gaps = 4/170 (2%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
             +SDGG  +A   + VLRL      A E+  CE SYGFLPCTTTA GNLFL+L YG+LMF
Sbjct  32   FISDGGNANANANASVLRLPSAAAAAGEDMGCEMSYGFLPCTTTAWGNLFLVLAYGFLMF  91

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
             +ATYLSSGSE+LL+ILGPG++GGLFLPILGALPDA+LILVSGLSG+   AQSQV +GMG
Sbjct  92   KSATYLSSGSEMLLQILGPGIVGGLFLPILGALPDALLILVSGLSGTKEVAQSQVLIGMG  151

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            LLAGSTVMLLT++WG+ VVVGKCD+ + + A+D +DT  FSL GSGV+TD
Sbjct  152  LLAGSTVMLLTLLWGSCVVVGKCDLSENSTAIDSRDTKGFSLLGSGVSTD  201



>ref|XP_007050030.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 2 [Theobroma cacao]
 gb|EOX94187.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 2 [Theobroma cacao]
Length=462

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            E+CEQ+YGFLPCTTT LGN+FLILVYGYLMF AA  L  G E+LLEILGPG+IGGLFLP+
Sbjct  58   ESCEQTYGFLPCTTTVLGNVFLILVYGYLMFRAAKLLCDGCEILLEILGPGIIGGLFLPV  117

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAV  576
            L +LPDA++IL SGLSGS   AQSQVSVG+GLLAGSTVMLLTV+WG+ +++GKCD++ A+
Sbjct  118  LSSLPDAIIILASGLSGSQETAQSQVSVGIGLLAGSTVMLLTVLWGSCLILGKCDLESAL  177

Query  577  AVDLKDTXAFSLTGSGVTTD  636
            + DL DT  FSLTGSGV+TD
Sbjct  178  SKDLVDTKGFSLTGSGVSTD  197



>gb|KDP31770.1| hypothetical protein JCGZ_12231 [Jatropha curcas]
Length=577

 Score =   153 bits (386),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 141/178 (79%), Gaps = 5/178 (3%)
 Frame = +1

Query  112  RLIVD-RSSDLVSDGGVHSA--GEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFL  282
            R ++D  SS +VSDG V+S+   +    +RL      + +C+++YGFLPCTTT LGN+FL
Sbjct  24   RHLIDYPSSSMVSDG-VNSSFNHQQQAFIRLYNFL-SDSSCDETYGFLPCTTTILGNIFL  81

Query  283  ILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEA  462
            ILVYG LMFL+A  LS GSE+LL+ILGPG+IGGL LP+L  LPDA +IL SGLSGS   A
Sbjct  82   ILVYGCLMFLSAKLLSDGSEILLQILGPGIIGGLLLPVLSCLPDAAIILASGLSGSKETA  141

Query  463  QSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            QSQVSVGMGL+AGSTV+LLT++WG+ ++VGKCDI+ +VAVD KDT  FSLTGSGVTTD
Sbjct  142  QSQVSVGMGLMAGSTVLLLTLLWGSCLIVGKCDIESSVAVDSKDTKIFSLTGSGVTTD  199



>ref|XP_010500958.1| PREDICTED: uncharacterized protein LOC104778258 [Camelina sativa]
Length=585

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = +1

Query  229  QSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgal  408
            Q+YGF+PCT TALGN+FLILVYG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGAL
Sbjct  67   QTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGAL  126

Query  409  pDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDL  588
            PDAMLI+VSGLSG  A AQSQVSVGMGLLAGSTVMLLTVIWGT  VVGKCD++  +AV+ 
Sbjct  127  PDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNN  186

Query  589  KDTXAFSLTGSGVTTD  636
            +DT  FSLT SGVT D
Sbjct  187  QDTKRFSLTDSGVTVD  202



>ref|XP_006307086.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
 gb|EOA39984.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
Length=585

 Score =   152 bits (385),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +1

Query  148  DGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATY  324
            DGG + AG GS +  +      +EE CEQ+YGF+PCT TALGN+FLILVYG+LMF AATY
Sbjct  39   DGGRNLAGSGSVIKTVVSAEEEKEEACEQTYGFMPCTKTALGNVFLILVYGFLMFTAATY  98

Query  325  lssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGS  504
            LS+GSELLLEILGPG++GGLFLP+LGALPDAMLI+VSGLSG  A AQSQVSVGMGLLAGS
Sbjct  99   LSAGSELLLEILGPGIVGGLFLPMLGALPDAMLIMVSGLSGDAATAQSQVSVGMGLLAGS  158

Query  505  TVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            TVMLLTVIWGT  VVGKCD++  +AV+ +DT  FSL  SGVT D
Sbjct  159  TVMLLTVIWGTCTVVGKCDLRDTIAVNNQDTKRFSLKDSGVTVD  202



>ref|XP_010052481.1| PREDICTED: uncharacterized protein LOC104441166 isoform X1 [Eucalyptus 
grandis]
Length=576

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            + C+Q+YGFLPCTTT  GN+FLIL YGYLMFLAA  LS GSE+LL+ILGPG+IGGLFLP+
Sbjct  57   DDCDQTYGFLPCTTTVWGNVFLILAYGYLMFLAAKLLSDGSEILLQILGPGIIGGLFLPV  116

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAV  576
            L +LPDA +IL SG+SGS  +AQSQVSVGMGLLAGSTVMLLTV+WGT ++VGKCDI+ + 
Sbjct  117  LSSLPDATIILASGVSGSAEDAQSQVSVGMGLLAGSTVMLLTVLWGTCIIVGKCDIENST  176

Query  577  AVDLKDTXAFSLTGSGVTTD  636
             +D KDT  FSL GSGV+TD
Sbjct  177  TMDQKDTKKFSLAGSGVSTD  196



>ref|XP_007050029.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
 gb|EOX94186.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein isoform 1 [Theobroma cacao]
Length=586

 Score =   151 bits (382),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            E+CEQ+YGFLPCTTT LGN+FLILVYGYLMF AA  L  G E+LLEILGPG+IGGLFLP+
Sbjct  75   ESCEQTYGFLPCTTTVLGNVFLILVYGYLMFRAAKLLCDGCEILLEILGPGIIGGLFLPV  134

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAV  576
            L +LPDA++IL SGLSGS   AQSQVSVG+GLLAGSTVMLLTV+WG+ +++GKCD++ A+
Sbjct  135  LSSLPDAIIILASGLSGSQETAQSQVSVGIGLLAGSTVMLLTVLWGSCLILGKCDLESAL  194

Query  577  AVDLKDTXAFSLTGSGVTTD  636
            + DL DT  FSLTGSGV+TD
Sbjct  195  SKDLVDTKGFSLTGSGVSTD  214



>ref|XP_010479874.1| PREDICTED: uncharacterized protein LOC104758667 [Camelina sativa]
Length=585

 Score =   151 bits (381),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +1

Query  229  QSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgal  408
            Q+YGF+PCT TALGN+FLILVYG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGAL
Sbjct  67   QTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGAL  126

Query  409  pDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDL  588
            PDAMLI+VSGLSG  A AQSQVSVGMGLLAGSTVMLLTVIWGT  VVGKCD++  +AV+ 
Sbjct  127  PDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNN  186

Query  589  KDTXAFSLTGSGVTTD  636
            +DT  FSL  SGVT D
Sbjct  187  QDTKRFSLKDSGVTVD  202



>ref|XP_010041151.1| PREDICTED: uncharacterized protein LOC104430086 [Eucalyptus grandis]
Length=579

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            R SD VSDG   + G  S  L L   A    +C+++YGF+PCTTT +GNLFLILVY YLM
Sbjct  31   RLSDPVSDGLGKALGRRSP-LYLPSSAASSYSCDETYGFMPCTTTWIGNLFLILVYIYLM  89

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
            + AA  LS GSE+LLEILGPGLI GL LP+LGA+P+A+LILVSGLSGS   AQSQVS+G 
Sbjct  90   YTAAMCLSRGSEMLLEILGPGLISGLVLPMLGAIPNALLILVSGLSGSTETAQSQVSIGK  149

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            GLLAGSTVMLLTVIWG+ V+VGKCD+Q + AVD  DT  FSLTGSG+T D
Sbjct  150  GLLAGSTVMLLTVIWGSCVLVGKCDLQDSTAVDKLDTKGFSLTGSGITID  199



>ref|XP_010462200.1| PREDICTED: uncharacterized protein LOC104742841 [Camelina sativa]
Length=581

 Score =   150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +1

Query  229  QSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgal  408
            Q+YGF+PCT TALGN+FLILVYG+LMF AATYLS+GSELLLEILGPG++GGLFLP+LGAL
Sbjct  63   QTYGFMPCTKTALGNVFLILVYGFLMFTAATYLSAGSELLLEILGPGIVGGLFLPMLGAL  122

Query  409  pDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDL  588
            PDAMLI+VSGLSG  A AQSQVSVGMGLLAGSTVMLLTVIWGT  VVGKCD++  +AV+ 
Sbjct  123  PDAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNN  182

Query  589  KDTXAFSLTGSGVTTD  636
            +DT  FSL  SGVT D
Sbjct  183  QDTKRFSLKDSGVTVD  198



>ref|XP_009380498.1| PREDICTED: uncharacterized protein LOC103968880 [Musa acuminata 
subsp. malaccensis]
Length=589

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 125/141 (89%), Gaps = 1/141 (1%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            E+CE +YGFLPCTTT +GNLFL+LVYG+LMF AATYLSSGSELLL+ILGPG++GGLFLPI
Sbjct  75   ESCEPTYGFLPCTTTVVGNLFLVLVYGFLMFKAATYLSSGSELLLQILGPGIVGGLFLPI  134

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXA  573
            LGALPDAMLILVSGLSGS   AQSQV +GMGLLAGSTVMLLT++WG+ VVVGKCD+   +
Sbjct  135  LGALPDAMLILVSGLSGSKETAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSDSS  194

Query  574  VAVDLKDTXAFSLTGSGVTTD  636
             +VDL+DT  FSL  SG++TD
Sbjct  195  TSVDLQDTRGFSLFASGISTD  215



>ref|XP_004951320.1| PREDICTED: uncharacterized protein LOC101782315 [Setaria italica]
Length=572

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 131/158 (83%), Gaps = 8/158 (5%)
 Frame = +1

Query  175  GSGVLRLGVLAPEE---ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsel  345
            G+ VLRL    P E   E CE +YGFLPCT TALGNLFL+L YG+LMF AATYLS+GSEL
Sbjct  44   GATVLRL----PSEAAAEGCEMTYGFLPCTDTALGNLFLVLAYGFLMFKAATYLSAGSEL  99

Query  346  lleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTV  525
            LLEILGPG++GGLFLPILGALPDAMLILVSGLSGS   AQSQV +GMGLLAGSTVMLLT+
Sbjct  100  LLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKEVAQSQVLIGMGLLAGSTVMLLTL  159

Query  526  IWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            +WG+ VVVGKCD+ + + A D +DT  FSL GSGV+TD
Sbjct  160  LWGSCVVVGKCDLWENSTATDSQDTKRFSLFGSGVSTD  197



>ref|XP_010915578.1| PREDICTED: uncharacterized protein LOC105040648 [Elaeis guineensis]
Length=590

 Score =   149 bits (377),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 137/178 (77%), Gaps = 7/178 (4%)
 Frame = +1

Query  124  DRSSDLVSDG-GVHSAGEGSGVLRLGVLA-----PEEETCEQSYGFLPCTTTALGNLFLI  285
            D    L+SDG  + SA      L L   A        E CEQ+YGFLPCTTT +GNLFL 
Sbjct  38   DEEDQLISDGVALGSAARSDPFLLLRRSAGYSRLFSAEECEQTYGFLPCTTTVVGNLFLA  97

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            L YG+LMF AATYLS+GSE+LLEILGPG++GGLFLPILGALPDAMLILVSGLSGS   AQ
Sbjct  98   LAYGFLMFKAATYLSTGSEMLLEILGPGIVGGLFLPILGALPDAMLILVSGLSGSKETAQ  157

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            +QV +GMGLLAGSTVMLLT++WG+ VVVGKCD+ + + ++D +DT +FSL GSGV+TD
Sbjct  158  NQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTSIDSQDTKSFSLFGSGVSTD  215



>ref|XP_010276580.1| PREDICTED: uncharacterized protein LOC104611295 [Nelumbo nucifera]
Length=577

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 138/172 (80%), Gaps = 5/172 (3%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
            +S+ VSDG +H+    S ++ L        TCEQ+YGFLPCTTT +GN+FLI+ YGYLMF
Sbjct  32   TSNTVSDG-IHNVQTESPLILLKRQV-ASGTCEQTYGFLPCTTTVVGNIFLIIAYGYLMF  89

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
            LAAT LS+GSELLLEILGPG+IGGLFLPILG+ PDAMLILVSGLSGS   AQSQ+ VGMG
Sbjct  90   LAATNLSNGSELLLEILGPGIIGGLFLPILGSFPDAMLILVSGLSGSSQTAQSQILVGMG  149

Query  490  LLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFS---LTGSGVTTD  636
            LL+GSTV+LLT++WG+ VVVGKCD+  + AVDL+DT   +   LTGSGV+TD
Sbjct  150  LLSGSTVLLLTLLWGSCVVVGKCDLDGSTAVDLQDTEGLTIAALTGSGVSTD  201



>ref|XP_008645573.1| PREDICTED: uncharacterized protein LOC103626994 [Zea mays]
Length=579

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 134/175 (77%), Gaps = 6/175 (3%)
 Frame = +1

Query  124  DRSSDLVSDGGVHSAGEGSGVLRLGVLA---PEEETCEQSYGFLPCTTTALGNLFLILVY  294
            DRS  L+  G        + VLRL   A   P  E CE +YGFLPCT TA GNLFL+L Y
Sbjct  32   DRS--LLLAGSSDEVAAATSVLRLPSAAGEDPAPEACEMTYGFLPCTDTAPGNLFLVLAY  89

Query  295  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  474
            G LMF AATYLS+GSELLLE+LGPG++GGLFLPILGALPDAMLILVSGL+G+   AQSQV
Sbjct  90   GLLMFKAATYLSAGSELLLEVLGPGVVGGLFLPILGALPDAMLILVSGLAGTKEVAQSQV  149

Query  475  SVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
             +GMGLLAGSTVMLLT++WG+ VVVGKCD+ + + A D +DT  FSL GSGV+TD
Sbjct  150  LIGMGLLAGSTVMLLTLLWGSCVVVGKCDMSENSTATDSQDTKGFSLFGSGVSTD  204



>ref|XP_008783929.1| PREDICTED: uncharacterized protein LOC103703017 [Phoenix dactylifera]
Length=641

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            E CEQ+YGFLPCTTT +GNLFL + YG+LMF  ATYLS+GSELLLEILGPG++GGLFLPI
Sbjct  125  EECEQTYGFLPCTTTVVGNLFLAVAYGFLMFKGATYLSTGSELLLEILGPGIVGGLFLPI  184

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXA  573
            LGALPDAMLILVSGLSGS   AQ+QV +GMGLLAGSTVMLLT++WG+ VVVGKCD+ + +
Sbjct  185  LGALPDAMLILVSGLSGSKETAQNQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENS  244

Query  574  VAVDLKDTXAFSLTGSGVTTD  636
             ++DL+DT  FSL GSG++TD
Sbjct  245  TSIDLQDTKGFSLFGSGISTD  265



>ref|XP_009405607.1| PREDICTED: uncharacterized protein LOC103988717 [Musa acuminata 
subsp. malaccensis]
Length=593

 Score =   147 bits (370),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 138/178 (78%), Gaps = 9/178 (5%)
 Frame = +1

Query  130  SSDLVSDGGVHS--AGEGSGVLRLGVLAPEEET------CEQSYGFLPCTTTALGNLFLI  285
            S+DL+   GV S  A E   +L   +  P          CEQ+YGFLPCTTT +GN+FL+
Sbjct  42   SADLLLSDGVSSRPASESQTLLLPRLPWPRSSRVFAAGQCEQTYGFLPCTTTVVGNMFLV  101

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            + YG+LM+ AATYLSSGSELLLEI+GPG++GGLFLPILGALPDAMLILVSGLSGS   AQ
Sbjct  102  IAYGFLMYKAATYLSSGSELLLEIMGPGIVGGLFLPILGALPDAMLILVSGLSGSRETAQ  161

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            +QV +GMGLLAGSTVMLLTV+WG+ ++VGKCD+   + ++D +DT AFSL GSGV+TD
Sbjct  162  NQVLIGMGLLAGSTVMLLTVLWGSCIIVGKCDLSDNSTSIDSQDTKAFSLFGSGVSTD  219



>gb|KCW89606.1| hypothetical protein EUGRSUZ_A01890 [Eucalyptus grandis]
Length=557

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  226  EQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilga  405
            + +YGFLPCTTT  GN+FLIL YGYLMFLAA  LS GSE+LL+ILGPG+IGGLFLP+L +
Sbjct  41   QYTYGFLPCTTTVWGNVFLILAYGYLMFLAAKLLSDGSEILLQILGPGIIGGLFLPVLSS  100

Query  406  lpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVD  585
            LPDA +IL SG+SGS  +AQSQVSVGMGLLAGSTVMLLTV+WGT ++VGKCDI+ +  +D
Sbjct  101  LPDATIILASGVSGSAEDAQSQVSVGMGLLAGSTVMLLTVLWGTCIIVGKCDIENSTTMD  160

Query  586  LKDTXAFSLTGSGVTTD  636
             KDT  FSL GSGV+TD
Sbjct  161  QKDTKKFSLAGSGVSTD  177



>ref|XP_003571165.2| PREDICTED: uncharacterized protein LOC100833492 isoform X1 [Brachypodium 
distachyon]
Length=639

 Score =   145 bits (366),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +1

Query  145  SDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATY  324
            SD  +    E        + A  EE CE +YGFLPCTTTA GNLFL L YG+LMF AATY
Sbjct  100  SDAALRLPSEQQQQQPAPLRAAGEEGCEMTYGFLPCTTTAGGNLFLALAYGFLMFKAATY  159

Query  325  lssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGS  504
            LS+GSELLLEILGPG++GGLFLPILGALPDA+LILVSG+SG+   AQSQV +GMGLLAGS
Sbjct  160  LSAGSELLLEILGPGIVGGLFLPILGALPDALLILVSGISGTKEVAQSQVLIGMGLLAGS  219

Query  505  TVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            TVMLLTV+WG+ VVVGKCD+ + +  +D +DT  FSL GSGV+TD
Sbjct  220  TVMLLTVLWGSCVVVGKCDLTEDSTPIDSRDTKRFSLFGSGVSTD  264



>ref|XP_010234099.1| PREDICTED: uncharacterized protein LOC100833492 isoform X2 [Brachypodium 
distachyon]
Length=666

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 129/165 (78%), Gaps = 1/165 (1%)
 Frame = +1

Query  145  SDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATY  324
            SD  +    E        + A  EE CE +YGFLPCTTTA GNLFL L YG+LMF AATY
Sbjct  100  SDAALRLPSEQQQQQPAPLRAAGEEGCEMTYGFLPCTTTAGGNLFLALAYGFLMFKAATY  159

Query  325  lssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGS  504
            LS+GSELLLEILGPG++GGLFLPILGALPDA+LILVSG+SG+   AQSQV +GMGLLAGS
Sbjct  160  LSAGSELLLEILGPGIVGGLFLPILGALPDALLILVSGISGTKEVAQSQVLIGMGLLAGS  219

Query  505  TVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            TVMLLTV+WG+ VVVGKCD+ + +  +D +DT  FSL GSGV+TD
Sbjct  220  TVMLLTVLWGSCVVVGKCDLTEDSTPIDSRDTKRFSLFGSGVSTD  264



>ref|XP_002451861.1| hypothetical protein SORBIDRAFT_04g008850 [Sorghum bicolor]
 gb|EES04837.1| hypothetical protein SORBIDRAFT_04g008850 [Sorghum bicolor]
Length=562

 Score =   144 bits (362),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = +1

Query  223  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  402
            CE +YGFLPCT TA GNLFL+L YG+LMF AATYLS+GSELLL+ILGPG++GGLFLPILG
Sbjct  83   CEMTYGFLPCTDTAPGNLFLVLAYGFLMFKAATYLSAGSELLLQILGPGIVGGLFLPILG  142

Query  403  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVA  579
            ALPDAMLILVSGLSG+   AQSQV +GMGLLAGSTVMLLT++WG+ VVVGKCD+ + + A
Sbjct  143  ALPDAMLILVSGLSGTKEVAQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTA  202

Query  580  VDLKDTXAFSLTGSGVTTD  636
            +D +DT  FSL GSGV+TD
Sbjct  203  IDSRDTKGFSLFGSGVSTD  221



>ref|XP_009409407.1| PREDICTED: uncharacterized protein LOC103991626 [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 131/167 (78%), Gaps = 3/167 (2%)
 Frame = +1

Query  145  SDG--GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAA  318
            SDG  G  +AG     L +       E CE SYGFLPCTTT  GNLFL+LVYG+LM+ AA
Sbjct  50   SDGISGYAAAGYKHSPLLVLPRGSAAEACEPSYGFLPCTTTVAGNLFLVLVYGFLMYKAA  109

Query  319  TYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLA  498
            T LS+GSE+LLEILGPG++GGLFLPILGALPDA+LILVSGLSGS   AQ+QV +GMGLLA
Sbjct  110  TCLSAGSEMLLEILGPGIVGGLFLPILGALPDALLILVSGLSGSKEVAQNQVLIGMGLLA  169

Query  499  GSTVMLLTVIWGTYVVVGKCD-IQXAVAVDLKDTXAFSLTGSGVTTD  636
            GSTVML+T++WG+ VVVGKCD ++ + +VD +DT  FSL  SG+TTD
Sbjct  170  GSTVMLITLLWGSCVVVGKCDLLENSTSVDSQDTNGFSLFASGITTD  216



>emb|CAN78652.1| hypothetical protein VITISV_033128 [Vitis vinifera]
Length=598

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 21/161 (13%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            ++C+Q+YGFLPCTTT LGN+FLILVYGYLMF+AA +LS GSE+LL ILGPG+IGGLFLP+
Sbjct  58   DSCDQTYGFLPCTTTVLGNIFLILVYGYLMFIAAKFLSDGSEILLGILGPGIIGGLFLPV  117

Query  397  lgalpDAMLILVS---------------------GLSGSVAEAQSQVSVGMGLLAGSTVM  513
            L A PDA++IL S                     G   +  + + QVS+GMGLLAGSTVM
Sbjct  118  LSAFPDAVIILESSTLLTPLSDPRFPMGAIIIHLGYLEAKKQLKVQVSIGMGLLAGSTVM  177

Query  514  LLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            LLT++WG+ ++VGKCDI+ +VA DLKDT  FSLTGSGV+TD
Sbjct  178  LLTILWGSCIIVGKCDIENSVATDLKDTRGFSLTGSGVSTD  218



>ref|XP_010279180.1| PREDICTED: uncharacterized protein LOC104613163 [Nelumbo nucifera]
Length=565

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 120/177 (68%), Gaps = 3/177 (2%)
 Frame = +1

Query  112  RLIVDRSSDLVSDG-GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLIL  288
            RL+ + S++L+SDG     A +GS  L L  L+    TCE  YGFLPCTT   G LF+I+
Sbjct  22   RLVTENSTNLISDGIDDDHASDGSPFLALKRLS-SPVTCEPEYGFLPCTTNIWGQLFIIV  80

Query  289  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
            VY YL+FL   Y+S+G+EL+ ++LGPG+ G     ILG+LP+A+L+LV+G+SGS+  AQ 
Sbjct  81   VYEYLLFLGENYISAGTELIFKLLGPGIFGASAFHILGSLPEAVLVLVAGVSGSIEIAQE  140

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            Q  +GM LLAGSTVMLLT++WG+ V VGK D+   +   D+  T    LTG GV TD
Sbjct  141  QAVIGMALLAGSTVMLLTILWGSIVAVGKYDLSNDSKPTDISVTRRSHLTGFGVVTD  197



>ref|XP_002987555.1| hypothetical protein SELMODRAFT_42348, partial [Selaginella moellendorffii]
 gb|EFJ11391.1| hypothetical protein SELMODRAFT_42348, partial [Selaginella moellendorffii]
Length=531

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 114/146 (78%), Gaps = 4/146 (3%)
 Frame = +1

Query  211  EEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglfl  390
            +EE+CE +YGFLPC+T   GN+FL++VYG+L+  AA +LS GSELLL +L PG+IGGL L
Sbjct  1    KEESCEPNYGFLPCSTGVAGNIFLLIVYGFLLLKAAQFLSEGSELLLLVLNPGIIGGLLL  60

Query  391  pilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQX  570
            PILGALPDA+LILVSGL  S AE  SQV VGMGLLAGST+MLLT++WG+ ++VG+CD+Q 
Sbjct  61   PILGALPDAILILVSGLFASEAEVLSQVLVGMGLLAGSTIMLLTLLWGSSLIVGRCDLQE  120

Query  571  A----VAVDLKDTXAFSLTGSGVTTD  636
                 VA D   T  F ++ +GVTTD
Sbjct  121  VNGNLVAKDKTLTRKFDVSKTGVTTD  146



>ref|XP_002992821.1| hypothetical protein SELMODRAFT_42349, partial [Selaginella moellendorffii]
 gb|EFJ06111.1| hypothetical protein SELMODRAFT_42349, partial [Selaginella moellendorffii]
Length=531

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 113/146 (77%), Gaps = 4/146 (3%)
 Frame = +1

Query  211  EEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglfl  390
            +EE+CE +YGFLPC+T   GN+FL++VYG+L+  AA +LS GSELLL +L PG+IGGL L
Sbjct  1    KEESCEPNYGFLPCSTGVAGNIFLLIVYGFLLLKAAQFLSEGSELLLLVLNPGIIGGLLL  60

Query  391  pilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQX  570
            PILGALPDA+LILVSGL  S  E  SQV VGMGLLAGST+MLLT++WG+ ++VG+CD+Q 
Sbjct  61   PILGALPDAILILVSGLFASEEEVLSQVLVGMGLLAGSTIMLLTLLWGSSLIVGRCDLQE  120

Query  571  A----VAVDLKDTXAFSLTGSGVTTD  636
                 VA D   T  F ++ +GVTTD
Sbjct  121  VNGNLVAKDKTLTRKFDVSKTGVTTD  146



>ref|XP_010064464.1| PREDICTED: uncharacterized protein LOC104451526 [Eucalyptus grandis]
Length=197

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +1

Query  238  GFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDA  417
            G  P    A   ++LI+VY Y ++ A TYLS+GS LLL ILGPG+I  LF P+LGALP+A
Sbjct  2    GSCPAPPLASAGMYLIVVYEYKIYTAVTYLSNGSALLLRILGPGIISNLFSPMLGALPNA  61

Query  418  MLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDT  597
            +LILVSGLSGS   AQSQVSVGMGLLAGSTVMLLTVIWG+ ++VGKCD+  +VA+D +DT
Sbjct  62   ILILVSGLSGSTETAQSQVSVGMGLLAGSTVMLLTVIWGSCIIVGKCDLHNSVAMDKQDT  121

Query  598  XAFSLTGSGVTTD  636
              FSL  SGV+TD
Sbjct  122  KGFSLKSSGVSTD  134



>ref|XP_007213956.1| hypothetical protein PRUPE_ppa004823mg [Prunus persica]
 gb|EMJ15155.1| hypothetical protein PRUPE_ppa004823mg [Prunus persica]
Length=490

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  412  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLK  591
            DA+LILVSGLSGS   AQSQVSVGMGLLAGSTV++LT+IWG+ VVVGKCDIQ +VA+D K
Sbjct  37   DAILILVSGLSGSTETAQSQVSVGMGLLAGSTVLILTLIWGSCVVVGKCDIQNSVAIDNK  96

Query  592  DTXAFSLTGSGVTTD  636
            DT  FSLTGSGV+TD
Sbjct  97   DTKGFSLTGSGVSTD  111



>ref|XP_002974272.1| hypothetical protein SELMODRAFT_52345, partial [Selaginella moellendorffii]
 gb|EFJ24494.1| hypothetical protein SELMODRAFT_52345, partial [Selaginella moellendorffii]
Length=525

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 109/142 (77%), Gaps = 4/142 (3%)
 Frame = +1

Query  223  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  402
            C +SYG LPC+T  +GNL+L+  YG++M  AA  LS GSELLL +L PG+IGGL LPILG
Sbjct  1    CSESYGMLPCSTRVVGNLYLLATYGFVMLKAAQLLSDGSELLLTVLNPGIIGGLLLPILG  60

Query  403  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXA---  573
            +LPDA+LILVSGL G+   AQSQVSVGMGLLAGST+MLLT++WG+ + VG+CD+      
Sbjct  61   SLPDALLILVSGLGGNQETAQSQVSVGMGLLAGSTIMLLTLLWGSCLFVGRCDLYPVHAD  120

Query  574  -VAVDLKDTXAFSLTGSGVTTD  636
             VA D   T  FSLTG+G+TTD
Sbjct  121  LVAKDRTLTRGFSLTGTGITTD  142



>ref|XP_002522156.1| calcium ion binding protein, putative [Ricinus communis]
 gb|EEF40235.1| calcium ion binding protein, putative [Ricinus communis]
Length=588

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 129/178 (72%), Gaps = 8/178 (4%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRL---GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYG  297
            + ++ VSDG VH     S  L     G    EEE CEQ+YGF+PC+TTA+GNL LI+ YG
Sbjct  35   QPANSVSDGSVHPHRSTSPYLLTSISGTEEAEEEWCEQTYGFMPCSTTAMGNLLLIIGYG  94

Query  298  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLIL--VSGLS-GSVAEAQS  468
            Y MFLAATYLS GSE+L EILGPG++GGL LP+L AL DA+++L  +  L  GS A AQ 
Sbjct  95   YAMFLAATYLSKGSEMLHEILGPGIVGGLLLPVLCALSDAVIVLGKLEYLDFGSKAVAQK  154

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQX--AVAVDLKDTXAFSLTGSGVTTD  636
            ++SVGMGLLAGST +LLT++WG+ +  GKCDI+   ++A+D   T  F+LTG+GV+TD
Sbjct  155  EISVGMGLLAGSTALLLTLVWGSCIFFGKCDIRKIDSLAIDGHGTKGFNLTGTGVSTD  212



>emb|CDP05978.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  412  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLK  591
            DAMLILVSGLSGS   AQSQVSVG+GLLAGSTVMLLTVIWG  V VGKCDI+  VA DL+
Sbjct  37   DAMLILVSGLSGSAETAQSQVSVGIGLLAGSTVMLLTVIWGACVTVGKCDIENHVAKDLQ  96

Query  592  DTXAFSLTGSGVTTD  636
            DT  FSLTGSGV+TD
Sbjct  97   DTKGFSLTGSGVSTD  111



>ref|XP_007212014.1| hypothetical protein PRUPE_ppa004833mg [Prunus persica]
 gb|EMJ13213.1| hypothetical protein PRUPE_ppa004833mg [Prunus persica]
Length=489

 Score =   113 bits (283),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  412  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLK  591
            DAMLILVSGLSG+   AQSQVSVGMGLLAGSTVMLLTVIWG+ ++VGKCDI+ ++A+D K
Sbjct  37   DAMLILVSGLSGTTETAQSQVSVGMGLLAGSTVMLLTVIWGSCILVGKCDIENSIAIDNK  96

Query  592  DTXAFSLTGSGVTTD  636
            DT   SLTGSGV+TD
Sbjct  97   DTKGLSLTGSGVSTD  111



>emb|CBI20223.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 0/75 (0%)
 Frame = +1

Query  412  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLK  591
            DA+LILVSGLSGS   AQSQVSVGMGLLAGSTV+LLT++WG+ V+VGKCD+Q +VA DL+
Sbjct  37   DAILILVSGLSGSTETAQSQVSVGMGLLAGSTVILLTIMWGSCVIVGKCDLQDSVAKDLQ  96

Query  592  DTXAFSLTGSGVTTD  636
            DT  FSLTGSGV+TD
Sbjct  97   DTKGFSLTGSGVSTD  111



>gb|EMS61578.1| hypothetical protein TRIUR3_22187 [Triticum urartu]
Length=497

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = +1

Query  274  LFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSV  453
            +FL+L YG+LMF AAT+LS+GSELLLEI+GPGL+GGL LPILGALPDA+L+LVSGLSG+ 
Sbjct  1    MFLVLTYGFLMFKAATFLSAGSELLLEIMGPGLVGGLLLPILGALPDALLVLVSGLSGTK  60

Query  454  AEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVT  630
              AQSQV +GMGLLAGSTV LLT++WGT VVVGKCD+ +  VA+D  DT  FSL+GSG+T
Sbjct  61   ETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDVGEDGVAIDSTDTKGFSLSGSGIT  120

Query  631  TD  636
            TD
Sbjct  121  TD  122



>ref|XP_002985644.1| hypothetical protein SELMODRAFT_181929 [Selaginella moellendorffii]
 gb|EFJ13222.1| hypothetical protein SELMODRAFT_181929 [Selaginella moellendorffii]
Length=528

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 111/143 (78%), Gaps = 6/143 (4%)
 Frame = +1

Query  223  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  402
            C +SYG LPC+T  +GN++L+  YG++M  AA  LS GSELLL +L PG+IGGL LPILG
Sbjct  3    CSESYGMLPCSTRVVGNVYLLATYGFVMLKAAQLLSDGSELLLTVLNPGIIGGLLLPILG  62

Query  403  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAV  582
            +LPDA+LILVSGL G+   AQSQVSVGMGLLAGST+MLLT++WG+ + VG+CD+   V  
Sbjct  63   SLPDALLILVSGLGGNQETAQSQVSVGMGLLAGSTIMLLTLLWGSCLFVGRCDL-YPVNA  121

Query  583  DL--KD---TXAFSLTGSGVTTD  636
            DL  KD   T  FSLTG+G+TTD
Sbjct  122  DLVAKDGTLTRGFSLTGTGITTD  144



>gb|KDP36272.1| hypothetical protein JCGZ_09837 [Jatropha curcas]
Length=522

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 94/114 (82%), Gaps = 0/114 (0%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            E+C+Q+YGF+PC++   GNL LI+ YGYL F+A+T+LS+GSE+L EILGPG+ GGL LP 
Sbjct  44   ESCDQTYGFMPCSSNKFGNLILIIGYGYLFFVASTFLSNGSEILREILGPGIAGGLLLPQ  103

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKC  558
            LG L DA L+LVSGL+GS   AQ QVSVGMGLLAGSTV LLTV+WG+ VV GKC
Sbjct  104  LGELADATLVLVSGLTGSTTTAQRQVSVGMGLLAGSTVTLLTVVWGSCVVAGKC  157



>ref|XP_010644148.1| PREDICTED: uncharacterized protein LOC100241883 [Vitis vinifera]
Length=718

 Score =   109 bits (273),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 81/176 (46%), Positives = 107/176 (61%), Gaps = 9/176 (5%)
 Frame = +1

Query  136  DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
            +LVSDG     G+ S VL L  +    E CEQ YGFLPC+    G+LFLI+VY YLMF  
Sbjct  36   ELVSDGVDEGEGQKSSVLVLRGMEYSSEECEQLYGFLPCSNNIFGHLFLIVVYEYLMFHG  95

Query  316  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  495
             +Y++SG E + +ILGPG+ G     +LGALP+++++L SGL  S   AQ  V   +GLL
Sbjct  96   ESYVASGGEQIFKILGPGVFGASVFQVLGALPESLILLASGLLNSKDTAQEYVLTAVGLL  155

Query  496  AGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFS---------LTGSGVTTD  636
            AGST++LLTV+WGT V+VG C+   A +    D              LTGSG+ TD
Sbjct  156  AGSTILLLTVLWGTCVIVGSCEFPGAGSGATVDANLLQKPYRKILLMLTGSGIATD  211



>ref|XP_010052488.1| PREDICTED: uncharacterized protein LOC104441166 isoform X2 [Eucalyptus 
grandis]
Length=491

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  412  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLK  591
            DA +IL SG+SGS  +AQSQVSVGMGLLAGSTVMLLTV+WGT ++VGKCDI+ +  +D K
Sbjct  37   DATIILASGVSGSAEDAQSQVSVGMGLLAGSTVMLLTVLWGTCIIVGKCDIENSTTMDQK  96

Query  592  DTXAFSLTGSGVTTD  636
            DT  FSL GSGV+TD
Sbjct  97   DTKKFSLAGSGVSTD  111



>gb|AAK32813.1|AF361800_1 At1g53210/F12M16_12 [Arabidopsis thaliana]
 gb|AAM91449.1| At1g53210/F12M16_12 [Arabidopsis thaliana]
Length=493

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +1

Query  412  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLK  591
            DAMLI+VSGLSG  A AQSQVSVGMGLLAGSTVMLLTVIWGT  VVGKCD++ ++AV+ +
Sbjct  37   DAMLIMVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDSIAVNNQ  96

Query  592  DTXAFSLTGSGVTTD  636
            DT  F L  SGVT D
Sbjct  97   DTKGFHLKDSGVTVD  111



>ref|XP_010277716.1| PREDICTED: uncharacterized protein LOC104612096 [Nelumbo nucifera]
Length=688

 Score =   107 bits (268),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 90/182 (49%), Positives = 114/182 (63%), Gaps = 17/182 (9%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEE-ETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            SS LVSDG      + S +L L    P   E CE  YGFLPCT    G+LFL++VY Y++
Sbjct  29   SSQLVSDG----MDDESPMLLLKSQEPSSSEACEHMYGFLPCTENLAGHLFLVVVYEYML  84

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
            F+   YLSSGS+LL EILG G+ G  F  ILG LP++M++LVSGLS S   AQ  V  G+
Sbjct  85   FIGEKYLSSGSKLLFEILGEGVYGASFFHILGTLPESMILLVSGLSNSKEIAQKNVLTGV  144

Query  487  GLLAGSTVMLLTVIWGTYVVVGK-------C----DIQXAVAVDLKDTXAFS-LTGSGVT  630
            GLL GSTV+ LT++WGT V+VGK       C    D+Q + + DL+       LTGSG+T
Sbjct  145  GLLVGSTVLHLTIVWGTCVIVGKHKLSEPECSATEDLQSSASKDLQCKRQLRCLTGSGIT  204

Query  631  TD  636
            TD
Sbjct  205  TD  206



>ref|XP_002275961.1| PREDICTED: uncharacterized protein LOC100260847 [Vitis vinifera]
Length=539

 Score =   106 bits (265),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = +1

Query  208  PEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglf  387
            P   +C+Q++G +PCTTT  GN+FLILVYGYLMF AA  L  GSE+L+E+L PG+ GG+F
Sbjct  55   PSPYSCKQTHGVMPCTTTVFGNVFLILVYGYLMFFAARLLYDGSEILVELLSPGITGGVF  114

Query  388  lpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQ  567
            LP+L +LPDA++IL S L G+   A SQVS G  LL GST MLLT++ G  ++VGKCD++
Sbjct  115  LPLLSSLPDAIIILASRLCGNKDTASSQVSAGSALLGGSTAMLLTLLGGCCIIVGKCDLE  174

Query  568  XAVAVDL-KDTXAFSLTGSGVTTD  636
               A  + K+   FSL GS  +TD
Sbjct  175  NLRAKPVEKNARGFSLVGSAASTD  198



>emb|CBI21945.3| unnamed protein product [Vitis vinifera]
Length=892

 Score =   107 bits (266),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 103/144 (72%), Gaps = 1/144 (1%)
 Frame = +1

Query  208  PEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglf  387
            P   +C+Q++G +PCTTT  GN+FLILVYGYLMF AA  L  GSE+L+E+L PG+ GG+F
Sbjct  112  PSPYSCKQTHGVMPCTTTVFGNVFLILVYGYLMFFAARLLYDGSEILVELLSPGITGGVF  171

Query  388  lpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQ  567
            LP+L +LPDA++IL S L G+   A SQVS G  LL GST MLLT++ G  ++VGKCD++
Sbjct  172  LPLLSSLPDAIIILASRLCGNKDTASSQVSAGSALLGGSTAMLLTLLGGCCIIVGKCDLE  231

Query  568  XAVAVDL-KDTXAFSLTGSGVTTD  636
               A  + K+   FSL GS  +TD
Sbjct  232  NLRAKPVEKNARGFSLVGSAASTD  255


 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 110/174 (63%), Gaps = 12/174 (7%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEE----ETCEQSYGFLPCTTTALGNLFLILVYG  297
            SS LVSDG     GE   V +   +  EE     +C Q+YGF+PCT T  GN+ LILVY 
Sbjct  611  SSGLVSDGD----GE---VQQPAFIVFEEWASSYSCNQTYGFMPCTATVPGNILLILVYV  663

Query  298  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  477
             LM  AA  L  GSE+L+E+L PG+ G +FLP+L +L DA++ + S L G+   AQ+QVS
Sbjct  664  SLMLFAAKLLYDGSEILVELLSPGIAGAVFLPLLSSLLDAIINIASRLCGNGETAQNQVS  723

Query  478  VGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXA-FSLTGSGVTTD  636
             G+GLL GST +LLT++ G  ++V KCD + +     ++T   FSL GS ++TD
Sbjct  724  AGLGLLTGSTAILLTLLGGCCIIVDKCDPENSREKASEETARGFSLAGSAISTD  777



>ref|XP_001755925.1| predicted protein [Physcomitrella patens]
 gb|EDQ79210.1| predicted protein [Physcomitrella patens]
Length=568

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 105/140 (75%), Gaps = 2/140 (1%)
 Frame = +1

Query  223  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  402
            CE++YG LPC+T+  GN+FL+L YGYL+F AA  +S GSELLLE++ PGL+GGL LPILG
Sbjct  59   CEETYGVLPCSTSIGGNVFLMLAYGYLLFTAAKLISDGSELLLEVMNPGLLGGLLLPILG  118

Query  403  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI--QXAV  576
            A PD++LILVSG+ GSV +AQ +V VG+G+LAGS+VMLLT+ W   ++ G+CD+      
Sbjct  119  AFPDSILILVSGVGGSVQQAQEEVMVGVGVLAGSSVMLLTIAWAGSLLAGRCDLDGPNGT  178

Query  577  AVDLKDTXAFSLTGSGVTTD  636
            A DL  T      G+GVTTD
Sbjct  179  ATDLTLTRPLDPFGTGVTTD  198



>ref|XP_011096402.1| PREDICTED: uncharacterized protein LOC105175605 isoform X2 [Sesamum 
indicum]
Length=562

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = +1

Query  187  LRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgp  366
            L    L+   ETCE +YGFLPC+T   G LFLI+ Y +L+ L   Y+++GS+L  +I GP
Sbjct  46   LEWSYLSATTETCEPTYGFLPCSTNVWGLLFLIVAYEFLLSLGGRYVATGSDLFFKITGP  105

Query  367  gligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVV  546
            G+ G      LG +P  +LILVS LSGS+  AQ + S+GMGL+AG+TVMLLT+IWGT VV
Sbjct  106  GIFGASLFQFLGTIPQIVLILVSTLSGSLEAAQQRASLGMGLVAGTTVMLLTLIWGTSVV  165

Query  547  VGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            +G  D+  A+ +D   +   +L G G+ TD
Sbjct  166  LGSYDLSAAITIDKSGSPKSNLKGFGIVTD  195



>gb|KCW67440.1| hypothetical protein EUGRSUZ_F011933, partial [Eucalyptus grandis]
Length=128

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  433  SGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSL  612
            SGLSGS   AQSQVSVGMGLLAGSTVMLLTVIWG+ ++VGKCD+  +VA+D +DT  FSL
Sbjct  1    SGLSGSTETAQSQVSVGMGLLAGSTVMLLTVIWGSCIIVGKCDLHNSVAMDKQDTKGFSL  60

Query  613  TGSGVTTD  636
              SGV+TD
Sbjct  61   KSSGVSTD  68



>gb|ACN27225.1| unknown [Zea mays]
Length=487

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +1

Query  412  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDL  588
            DA+L+LVSGLSGS  EAQSQV +GMGLLAGSTV LLT++WGT VVVGKCD+     AVD+
Sbjct  37   DALLVLVSGLSGSKEEAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDLGPGREAVDV  96

Query  589  KDTXAFSLTGSGVTTD  636
             DT  FSLTG+GVTTD
Sbjct  97   TDTKGFSLTGTGVTTD  112



>ref|XP_001752917.1| predicted protein [Physcomitrella patens]
 gb|EDQ82421.1| predicted protein [Physcomitrella patens]
Length=601

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 109/147 (74%), Gaps = 6/147 (4%)
 Frame = +1

Query  214  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  393
            E+ CE+ YG LPC+TT  GN  L+++YG+++  AA  LS GSELLL ++ PG+IGGL LP
Sbjct  78   EKECEEKYGILPCSTTLGGNASLLVIYGFMLLKAAQLLSDGSELLLAVMSPGIIGGLVLP  137

Query  394  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXA  573
            ILGALPDAML++VSGL  S AEAQ +V VGMGL+AGS++M+LT++WG+ +++G+CD+   
Sbjct  138  ILGALPDAMLVIVSGLGASQAEAQHEVLVGMGLVAGSSIMVLTLLWGSCLILGRCDLVPH  197

Query  574  ------VAVDLKDTXAFSLTGSGVTTD  636
                  +A D   T  F+LT +GVT D
Sbjct  198  PTTGQLIAKDRTLTQGFNLTKTGVTND  224



>ref|XP_001762095.1| predicted protein [Physcomitrella patens]
 gb|EDQ73199.1| predicted protein [Physcomitrella patens]
Length=573

 Score =   103 bits (257),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 103/145 (71%), Gaps = 6/145 (4%)
 Frame = +1

Query  220  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  399
            TCE+ YG +PC+ +  GN  L+++YGY+M  AA  LS GSELLL ++ PG+IGGL LPI 
Sbjct  50   TCEEKYGVMPCSVSLGGNAALLVIYGYMMLQAAQLLSDGSELLLTVMSPGIIGGLLLPIF  109

Query  400  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-----  564
            GA PDA+LI VSG   ++AEAQ +V VGMGLLAGS+VMLLT +WG+ ++VG+CD+     
Sbjct  110  GAFPDALLITVSGFGANLAEAQEKVFVGMGLLAGSSVMLLTALWGSCLIVGRCDLVPHFA  169

Query  565  -QXAVAVDLKDTXAFSLTGSGVTTD  636
                VA D   T  F LT +GVTTD
Sbjct  170  NSKLVAKDRTLTKGFHLTETGVTTD  194



>gb|EMT26919.1| hypothetical protein F775_25869 [Aegilops tauschii]
Length=469

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/76 (70%), Positives = 63/76 (83%), Gaps = 1/76 (1%)
 Frame = +1

Query  412  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDL  588
            DA+L+LVSGLSG+   AQSQV +GMGLLAGSTV LLT++WGT VVVGKCD+ +  VA+D 
Sbjct  19   DALLVLVSGLSGTKETAQSQVLIGMGLLAGSTVFLLTLLWGTCVVVGKCDVTENGVAIDS  78

Query  589  KDTXAFSLTGSGVTTD  636
             DT  FSLTGSG+TTD
Sbjct  79   TDTKGFSLTGSGITTD  94



>gb|KDP21052.1| hypothetical protein JCGZ_21523 [Jatropha curcas]
Length=571

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 99/177 (56%), Gaps = 3/177 (2%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I +  S L+SDG +     GS  L++  L     TCE +YGFLPCTT   G LFL++V
Sbjct  21   RTIREDESILISDG-LMDHKNGSKFLKIDGLRTTTVTCEPTYGFLPCTTEIWGQLFLLVV  79

Query  292  YGYLMFLAATYlss-gsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
            Y YL+ L+A Y+S      L       +       +LG  P  +L+LV+G SG+    QS
Sbjct  80   YEYLLSLSAHYISEGSELFLETSGTDNIFSASVFQMLGMFPQVILVLVAGFSGTSDTVQS  139

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
               +GMGLLAGS +M LT+IWG+ V  G   + Q + + + ++   FSLTG GV TD
Sbjct  140  MAEMGMGLLAGSVIMNLTLIWGSVVAFGSYSLSQASTSSNTENQDKFSLTGYGVRTD  196



>ref|XP_005650712.1| hypothetical protein COCSUDRAFT_61158 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26168.1| hypothetical protein COCSUDRAFT_61158 [Coccomyxa subellipsoidea 
C-169]
Length=555

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            E CE++YG  PC+TT  G + L+L YG+++   A  LS GSELLLE+L PG+IGGL LPI
Sbjct  3    EACEETYGVFPCSTTLPGTIVLMLAYGFMLLQGANLLSDGSELLLEVLNPGIIGGLLLPI  62

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXA  573
            LGALPDA++I+VSGL G+  EA  QVSVG+G LAGST+MLLT+ WG  ++VG+CD+ +  
Sbjct  63   LGALPDALIIVVSGLGGTREEAAEQVSVGVGTLAGSTIMLLTIAWGGSLLVGRCDLNERG  122

Query  574  VAVDLKDTXAFSLTGSGVTTD  636
             A++ K T  F   G+GVTTD
Sbjct  123  KAINKKLTRKFDAMGTGVTTD  143



>ref|XP_011083284.1| PREDICTED: uncharacterized protein LOC105165819 [Sesamum indicum]
Length=714

 Score =   102 bits (254),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 83/191 (43%), Positives = 113/191 (59%), Gaps = 17/191 (9%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVL-------APEEETCEQSYGFLPCTTTALG  270
            R + + S  LVSDG V      S    +G         +  EETCEQ YGFLPC+ T  G
Sbjct  20   RPLTNSSPGLVSDG-VEEENRFSSYNTIGFKGIIGNSGSSREETCEQMYGFLPCSKTIPG  78

Query  271  NLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGS  450
            +LFLILVY YL+F A +Y++SG E + +ILGPG+ G     ++G+LP+A+++L SGLS S
Sbjct  79   HLFLILVYEYLLFHAESYVASGGERIFKILGPGVFGASAFQVIGSLPEALILLASGLSSS  138

Query  451  VAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDT--------XAF  606
               AQ  V  G+GLLAGS+++LLT+IWGT +++G       +  +L D           F
Sbjct  139  DEIAQECVLTGVGLLAGSSILLLTIIWGTCIILGSQSFSSHLHSNLSDNKRYNPLERLLF  198

Query  607  SL-TGSGVTTD  636
            SL  G GV TD
Sbjct  199  SLWPGHGVVTD  209



>ref|XP_011460765.1| PREDICTED: uncharacterized protein LOC105350438 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=240

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 104/177 (59%), Gaps = 6/177 (3%)
 Frame = +1

Query  112  RLIVDRSSDLVSDG--GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            R +   SS+LVSDG   + +  + S ++  G  + E+  C   YG  PC+ T LG LFLI
Sbjct  21   RSLQHSSSNLVSDGTDNIEAVTQTSLLVFGGTYSFED--CSLLYGLFPCSYTVLGKLFLI  78

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            + Y  L  +  +Y+++G EL+ E+ G        +       DA+++LVSGL+ S   AQ
Sbjct  79   VGYVLLYIIGESYVAAGGELIFEVNGSVGANLFHILGAIP--DAIILLVSGLTASTETAQ  136

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            S+VS+G+GLL GSTV  LT +WG  V  GKCD++   + D  DT  FSL GSGV+T+
Sbjct  137  SKVSIGVGLLVGSTVFYLTAVWGLCVYAGKCDLEGKESQDTTDTKMFSLLGSGVSTE  193



>ref|XP_007021646.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
 gb|EOY13171.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
Length=714

 Score =   102 bits (253),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 81/195 (42%), Positives = 109/195 (56%), Gaps = 25/195 (13%)
 Frame = +1

Query  112  RLIVDRSSDLVSDG---------GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTA  264
            R +   SS LVSDG           HS+G     L L  +   EE CEQ YGFLPC+ + 
Sbjct  24   RSLPQSSSQLVSDGIDGDDDPVQASHSSG-----LFLKEMESSEEYCEQMYGFLPCSNSI  78

Query  265  LGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLS  444
             G+LFLILVY YL+F   +YL+SG E + +I GPG  G     IL ALP+A+++L SGL 
Sbjct  79   YGHLFLILVYEYLLFHGESYLASGGEQMFKIPGPGFFGASAFQILSALPEALILLASGLM  138

Query  445  GSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXA-------  603
             +   AQ     G+GLLAGS+++LLT+IWGT ++VG  D+       +  T +       
Sbjct  139  NTKEVAQEYAYTGVGLLAGSSILLLTIIWGTCLIVGSHDLSNGAEYSILSTNSNSRILSC  198

Query  604  ----FSLTGSGVTTD  636
                 SL+G G+ TD
Sbjct  199  NRLLHSLSGFGIITD  213



>gb|EPS57671.1| hypothetical protein M569_17145, partial [Genlisea aurea]
Length=448

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = +1

Query  430  VSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFS  609
            VSGLSGS   AQ QVSVG+GLLAGSTVMLLTVIWG+ VVVGKCD+Q  V++D +DT  FS
Sbjct  1    VSGLSGSKETAQKQVSVGIGLLAGSTVMLLTVIWGSCVVVGKCDLQNNVSIDSQDTKCFS  60

Query  610  LTGSGVTTD  636
             TGSGV+TD
Sbjct  61   PTGSGVSTD  69



>ref|XP_011096401.1| PREDICTED: uncharacterized protein LOC105175605 isoform X1 [Sesamum 
indicum]
Length=563

 Score =   100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 99/151 (66%), Gaps = 1/151 (1%)
 Frame = +1

Query  187  LRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgp  366
            L    L+   ETCE +YGFLPC+T   G LFLI+ Y +L+ L   Y+++GS+L  +I GP
Sbjct  46   LEWSYLSATTETCEPTYGFLPCSTNVWGLLFLIVAYEFLLSLGGRYVATGSDLFFKITGP  105

Query  367  gligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVV  546
            G+ G      LG +P  +LILVS LSGS+  AQ + S+GMGL+AG+TVMLLT+IWGT VV
Sbjct  106  GIFGASLFQFLGTIPQIVLILVSTLSGSLEAAQQRASLGMGLVAGTTVMLLTLIWGTSVV  165

Query  547  VGKCDIQXAVAVDLKDTXAFSLT-GSGVTTD  636
            +G  D+  A+ +D   +   +L  G G+ TD
Sbjct  166  LGSYDLSAAITIDKSGSPKSNLKAGFGIVTD  196



>ref|XP_006307087.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
 gb|EOA39985.1| hypothetical protein CARUB_v10008672mg [Capsella rubella]
Length=461

 Score = 99.4 bits (246),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +1

Query  427  LVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAF  606
            LVSGLSG  A AQSQVSVGMGLLAGSTVMLLTVIWGT  VVGKCD++  +AV+ +DT  F
Sbjct  9    LVSGLSGDAATAQSQVSVGMGLLAGSTVMLLTVIWGTCTVVGKCDLRDTIAVNNQDTKRF  68

Query  607  SLTGSGVTTD  636
            SL  SGVT D
Sbjct  69   SLKDSGVTVD  78



>ref|XP_006594743.1| PREDICTED: uncharacterized protein LOC100798009 isoform X3 [Glycine 
max]
Length=694

 Score =   100 bits (250),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 79/181 (44%), Positives = 114/181 (63%), Gaps = 7/181 (4%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSA---GEGSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNLF  279
            R + +R+++LVSDG VH+     E S ++  G+     EE C+Q YGFLPCT    G+LF
Sbjct  25   RYLPERATELVSDG-VHNNLQHNETSYLVLKGIDDESFEEPCKQMYGFLPCTNNIFGHLF  83

Query  280  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  459
            LILVY YL+F   +YL+ G E + +ILGPG+ G     ILGALP+++++LVSGL  +   
Sbjct  84   LILVYEYLLFHGESYLAKGGEQIFKILGPGIFGASAFQILGALPESLILLVSGLVSNREI  143

Query  460  AQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQ--XAVAVDLKDTXAFSLTGSGVTT  633
            AQ     G+GLLAGS+++LLTV+WG+ V+ G  + +     +     +    LTG G+TT
Sbjct  144  AQEYAFSGVGLLAGSSILLLTVVWGSCVIAGSQEFEHDSPTSNSAHTSLKALLTGCGITT  203

Query  634  D  636
            D
Sbjct  204  D  204



>ref|XP_006594741.1| PREDICTED: uncharacterized protein LOC100798009 isoform X1 [Glycine 
max]
Length=712

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 79/181 (44%), Positives = 114/181 (63%), Gaps = 7/181 (4%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSA---GEGSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNLF  279
            R + +R+++LVSDG VH+     E S ++  G+     EE C+Q YGFLPCT    G+LF
Sbjct  25   RYLPERATELVSDG-VHNNLQHNETSYLVLKGIDDESFEEPCKQMYGFLPCTNNIFGHLF  83

Query  280  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  459
            LILVY YL+F   +YL+ G E + +ILGPG+ G     ILGALP+++++LVSGL  +   
Sbjct  84   LILVYEYLLFHGESYLAKGGEQIFKILGPGIFGASAFQILGALPESLILLVSGLVSNREI  143

Query  460  AQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQ--XAVAVDLKDTXAFSLTGSGVTT  633
            AQ     G+GLLAGS+++LLTV+WG+ V+ G  + +     +     +    LTG G+TT
Sbjct  144  AQEYAFSGVGLLAGSSILLLTVVWGSCVIAGSQEFEHDSPTSNSAHTSLKALLTGCGITT  203

Query  634  D  636
            D
Sbjct  204  D  204



>ref|XP_006594742.1| PREDICTED: uncharacterized protein LOC100798009 isoform X2 [Glycine 
max]
Length=705

 Score =   100 bits (249),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 79/181 (44%), Positives = 114/181 (63%), Gaps = 7/181 (4%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSA---GEGSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNLF  279
            R + +R+++LVSDG VH+     E S ++  G+     EE C+Q YGFLPCT    G+LF
Sbjct  25   RYLPERATELVSDG-VHNNLQHNETSYLVLKGIDDESFEEPCKQMYGFLPCTNNIFGHLF  83

Query  280  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  459
            LILVY YL+F   +YL+ G E + +ILGPG+ G     ILGALP+++++LVSGL  +   
Sbjct  84   LILVYEYLLFHGESYLAKGGEQIFKILGPGIFGASAFQILGALPESLILLVSGLVSNREI  143

Query  460  AQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQ--XAVAVDLKDTXAFSLTGSGVTT  633
            AQ     G+GLLAGS+++LLTV+WG+ V+ G  + +     +     +    LTG G+TT
Sbjct  144  AQEYAFSGVGLLAGSSILLLTVVWGSCVIAGSQEFEHDSPTSNSAHTSLKALLTGCGITT  203

Query  634  D  636
            D
Sbjct  204  D  204



>ref|XP_001751608.1| predicted protein [Physcomitrella patens]
 gb|EDQ83925.1| predicted protein [Physcomitrella patens]
Length=576

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 102/144 (71%), Gaps = 6/144 (4%)
 Frame = +1

Query  223  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  402
            CE+ YG LPC+ +  GN  L+++YGY++  AA  LS GSELLL ++ PG+IGGL LPILG
Sbjct  43   CEEHYGILPCSVSLGGNAALLVIYGYMLLQAAQLLSDGSELLLTVMSPGIIGGLVLPILG  102

Query  403  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXA---  573
            A PDA+LI VSGL  S AEAQ +V VGMGL+AGS+VMLLT +WG  ++ G+CD+      
Sbjct  103  AFPDALLITVSGLGASQAEAQQEVLVGMGLVAGSSVMLLTALWGACLIFGRCDLIPHPAN  162

Query  574  ---VAVDLKDTXAFSLTGSGVTTD  636
               VA D   T  FSLT +GVT+D
Sbjct  163  GKLVAKDRTLTKGFSLTETGVTSD  186



>emb|CBI20222.3| unnamed protein product [Vitis vinifera]
Length=661

 Score = 98.2 bits (243),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 71/149 (48%), Positives = 94/149 (63%), Gaps = 9/149 (6%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            E CEQ YGFLPC+    G+LFLI+VY YLMF   +Y++SG E + +ILGPG+ G     +
Sbjct  6    EECEQLYGFLPCSNNIFGHLFLIVVYEYLMFHGESYVASGGEQIFKILGPGVFGASVFQV  65

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAV  576
            LGALP+++++L SGL  S   AQ  V   +GLLAGST++LLTV+WGT V+VG C+   A 
Sbjct  66   LGALPESLILLASGLLNSKDTAQEYVLTAVGLLAGSTILLLTVLWGTCVIVGSCEFPGAG  125

Query  577  AVDLKDTXAFS---------LTGSGVTTD  636
            +    D              LTGSG+ TD
Sbjct  126  SGATVDANLLQKPYRKILLMLTGSGIATD  154



>ref|XP_011000239.1| PREDICTED: uncharacterized protein LOC105107867 isoform X4 [Populus 
euphratica]
Length=652

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 79/176 (45%), Positives = 106/176 (60%), Gaps = 10/176 (6%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
            LVSDG        S +L L G+    EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  316  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  495
              YL+SG E +  ILGPG+ G     +LGALP+++++L SGL  +   AQ  VS G+GLL
Sbjct  97   EGYLASGGEKIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLL  156

Query  496  AGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFS-LTGS--------GVTTD  636
            AG++++LLTV+WGT V+VG          +   +  FS LTG+        GVTTD
Sbjct  157  AGTSILLLTVLWGTCVIVGSIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVTTD  212



>ref|XP_011000240.1| PREDICTED: uncharacterized protein LOC105107867 isoform X5 [Populus 
euphratica]
Length=652

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 79/176 (45%), Positives = 106/176 (60%), Gaps = 10/176 (6%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
            LVSDG        S +L L G+    EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  316  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  495
              YL+SG E +  ILGPG+ G     +LGALP+++++L SGL  +   AQ  VS G+GLL
Sbjct  97   EGYLASGGEKIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLL  156

Query  496  AGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFS-LTGS--------GVTTD  636
            AG++++LLTV+WGT V+VG          +   +  FS LTG+        GVTTD
Sbjct  157  AGTSILLLTVLWGTCVIVGSIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVTTD  212



>ref|XP_007025465.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
 gb|EOY28087.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein, putative [Theobroma cacao]
Length=574

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 78/189 (41%), Positives = 111/189 (59%), Gaps = 17/189 (9%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I ++SS  VSDG   ++   S VL L +      TCE  YGFLPCTTT  G LFL++V
Sbjct  24   RSIKEKSSP-VSDGMDQTSK--SSVLELDLPITTTVTCEPIYGFLPCTTTLWGQLFLLVV  80

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            Y YL+ L+  ++SSGS L  ++ G G+ G     ILG +P  ML+LVSG S S    +++
Sbjct  81   YEYLLSLSEEFISSGSNLFFQMFGTGIFGASLFHILGIIPQVMLVLVSGASASGETIEAR  140

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI--------------QXAVAVDLKDTXAFS  609
             ++GMGLLAGS V++LT++WG+ +  G  D+                +++ + K+   FS
Sbjct  141  ATIGMGLLAGSAVLMLTLVWGSVIAFGSYDLSDTSSPNSSNPDNADTSISSNSKNKKPFS  200

Query  610  LTGSGVTTD  636
            LTG GV TD
Sbjct  201  LTGYGVRTD  209



>ref|XP_007149414.1| hypothetical protein PHAVU_005G068300g [Phaseolus vulgaris]
 gb|ESW21408.1| hypothetical protein PHAVU_005G068300g [Phaseolus vulgaris]
Length=702

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 70/142 (49%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = +1

Query  223  CEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilg  402
            C+Q YGFLPC++  LG+LFLILVY YL+F   +YL++G E + +ILGPG+ G     ILG
Sbjct  60   CKQMYGFLPCSSNILGHLFLILVYEYLLFHGESYLATGGEQIFKILGPGVFGASAFDILG  119

Query  403  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCD-IQXAVA  579
            ALP+++++LV+G+S     AQ   S G+GLLAGS++ LLTV+WGT V++GK + I  + +
Sbjct  120  ALPESLILLVTGISSDKESAQEYASTGVGLLAGSSIFLLTVVWGTCVIIGKQEIINDSNS  179

Query  580  VDLKDTXA---FSLTGSGVTTD  636
             DL         SLTG G+T D
Sbjct  180  DDLHSWSTGIKKSLTGYGITMD  201



>ref|XP_003540477.1| PREDICTED: uncharacterized protein LOC100800452 [Glycine max]
Length=711

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 68/148 (46%), Positives = 99/148 (67%), Gaps = 4/148 (3%)
 Frame = +1

Query  205  APEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgliggl  384
            + +E  C+Q YGFLPC+   LG+LFLILVY YL+F   +YL++G E + +ILGPG+ G  
Sbjct  63   SSDEHFCKQMYGFLPCSNNILGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGAS  122

Query  385  flpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI  564
               ILGALP++++++V+GLS     AQ   S G+GLLAGS++MLLTV+WGT V +G+  +
Sbjct  123  AFDILGALPESLILVVTGLSSDKESAQEYASTGVGLLAGSSIMLLTVVWGTCVFIGRQKL  182

Query  565  QXAVAVDLKDTXAF----SLTGSGVTTD  636
            +        ++ +     SLTG G+T D
Sbjct  183  KNDSNYGGTNSSSGGIKESLTGYGITMD  210



>gb|ACU19365.1| unknown [Glycine max]
Length=197

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 87/119 (73%), Gaps = 0/119 (0%)
 Frame = +1

Query  211  EEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglfl  390
            +E  C+Q YGFLPC+   LG+LFLILVY YL+F   +YL++G E + +ILGPG+ G    
Sbjct  65   DEHFCKQMYGFLPCSNNILGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGASAF  124

Query  391  pilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQ  567
             ILGALP++++++V+GLS     AQ   S G+GLLAGS++MLLTV+WGT V +G+  ++
Sbjct  125  DILGALPESLILVVTGLSSDKESAQEYASTGVGLLAGSSIMLLTVVWGTCVFIGRQKLK  183



>ref|XP_007021642.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
 gb|EOY13167.1| Sodium/calcium exchanger family protein / calcium-binding EF 
hand family protein [Theobroma cacao]
Length=478

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 107/195 (55%), Gaps = 25/195 (13%)
 Frame = +1

Query  112  RLIVDRSSDLVSDG---------GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTA  264
            R +   SS LVSDG           HS+G     L L  +   E+ CEQ YGFLPC+ + 
Sbjct  24   RSLPQSSSQLVSDGIDGDDDPVQASHSSG-----LFLKEMESSEKYCEQMYGFLPCSNSI  78

Query  265  LGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLS  444
             G+LFLILVY YL+F   +YL+SG E + +I GPG  G     IL ALP+A+++L SGL 
Sbjct  79   YGHLFLILVYEYLLFHGESYLASGGEQMFKIPGPGFFGASAFQILSALPEALILLASGLM  138

Query  445  GSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXA-------  603
             +   A      G+GLLAGS+++LLT+ WGT ++VG  D+       +  T +       
Sbjct  139  NTKEVAHEYAYTGVGLLAGSSILLLTITWGTCLIVGSRDLSNGAEYSILSTESNPRILSC  198

Query  604  ----FSLTGSGVTTD  636
                 SLTG G+ TD
Sbjct  199  NRLLHSLTGFGIITD  213



>ref|XP_002305761.1| hypothetical protein POPTR_0004s05210g [Populus trichocarpa]
 gb|EEE86272.1| hypothetical protein POPTR_0004s05210g [Populus trichocarpa]
Length=560

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I +  SDL+SDG +   G+ +  L+L  L     TCE  YGF+PCTT   GNLFL++V
Sbjct  21   RSIRNEFSDLISDG-LDQKGQNN-FLQLNNLG-TTVTCEPIYGFMPCTTKVWGNLFLLVV  77

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            Y YL+ LA  Y+SSGS L  ++ G G+ GG    ++G  P  +L+LV+ LS S     S 
Sbjct  78   YEYLLSLADKYISSGSNLFFQMFGTGVFGGSVFYVVGKFPQIVLVLVTLLSASENVVGSA  137

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VS+ MG LAGST+M LT+IWG+ +  G  D+Q   + +L++       G GV TD
Sbjct  138  VSMSMGFLAGSTMMSLTIIWGSVIAFGSYDLQQTNSSNLENKTPCLSNGYGVKTD  192



>ref|XP_004489085.1| PREDICTED: uncharacterized protein LOC101490110 [Cicer arietinum]
Length=500

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            E C+Q YGFLPC+    G+LFLILVY YL+F   +YL++G E + +ILGPG+ G     I
Sbjct  59   EYCKQMYGFLPCSNNIFGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGASVFDI  118

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAV  576
            LGALP++++++V+GLS     AQ   S G+GLLAGS+++LLT++WGT V+VGK +++   
Sbjct  119  LGALPESLILVVTGLSSDKESAQEYASTGVGLLAGSSILLLTLVWGTCVIVGKQNLKNDS  178

Query  577  AVDLKDTXAFSLTGSGVTTD  636
                + T   SL G G+T D
Sbjct  179  YSSTR-TIKQSLIGYGITMD  197



>ref|XP_011000236.1| PREDICTED: uncharacterized protein LOC105107867 isoform X2 [Populus 
euphratica]
Length=711

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 104/168 (62%), Gaps = 2/168 (1%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
            LVSDG        S +L L G+    EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  316  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  495
              YL+SG E +  ILGPG+ G     +LGALP+++++L SGL  +   AQ  VS G+GLL
Sbjct  97   EGYLASGGEKIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLL  156

Query  496  AGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFS-LTGSGVTTD  636
            AG++++LLTV+WGT V+VG          +   +  FS LT  GVTTD
Sbjct  157  AGTSILLLTVLWGTCVIVGSIQSSLPTISNTSSSRLFSWLTEFGVTTD  204



>ref|XP_011460767.1| PREDICTED: uncharacterized protein LOC105350439 [Fragaria vesca 
subsp. vesca]
Length=730

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 75/183 (41%), Positives = 109/183 (60%), Gaps = 17/183 (9%)
 Frame = +1

Query  133  SDLVSDGGVHSAG--EGSGVLRL------GVLAPEEETCEQSYGFLPCTTTALGNLFLIL  288
            SD V D   H+ G    +G +R       G+ A   ETCEQ YGFLPC+ +  G++FL++
Sbjct  42   SDGVDDHHHHNVGFNHSNGTIRSSFQLLKGIEAESNETCEQLYGFLPCSDSVYGHVFLMV  101

Query  289  VYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
            VY YL+F   +YL++G E + +ILGPG+ G     +LGALP+++L+L SG   +   A+ 
Sbjct  102  VYEYLLFHGESYLAAGGEQIFKILGPGVFGASAFHVLGALPESLLLLASGFFNTKEIAED  161

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFS-------LTGSGV  627
             V  G+GLLAG++++LLTV+WGT V+VG+         D   + AFS       LT  G+
Sbjct  162  YVYTGVGLLAGTSILLLTVLWGTCVIVGRQHFTS--CNDANSSTAFSWERILALLTNCGI  219

Query  628  TTD  636
            T D
Sbjct  220  TID  222



>ref|XP_002962226.1| hypothetical protein SELMODRAFT_76965 [Selaginella moellendorffii]
 gb|EFJ37486.1| hypothetical protein SELMODRAFT_76965 [Selaginella moellendorffii]
Length=546

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 102/150 (68%), Gaps = 4/150 (3%)
 Frame = +1

Query  193  LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgl  372
            L +L  E + C++SYG  PC+    G++FL++VY Y    AA  L +GSELLLEI  PG+
Sbjct  9    LSLLRREGKACQESYGIFPCSEKLGGSVFLLIVYSYAFVKAAQLLLNGSELLLEIAHPGI  68

Query  373  igglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVG  552
            +GGL LPI+  +PDA +ILVSG+ G    AQSQV +GMG+LAGSTV+LLT++WGT ++VG
Sbjct  69   VGGLCLPIICTIPDAAVILVSGIFGDKETAQSQVMIGMGVLAGSTVLLLTMLWGTALIVG  128

Query  553  KCDIQ----XAVAVDLKDTXAFSLTGSGVT  630
            +CD+        A +   T  F LT +GVT
Sbjct  129  RCDLYEINGHKYAREKTLTKGFHLTETGVT  158



>ref|XP_002272134.1| PREDICTED: uncharacterized protein LOC100243523 [Vitis vinifera]
 emb|CBI30651.3| unnamed protein product [Vitis vinifera]
Length=559

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 93/142 (65%), Gaps = 4/142 (3%)
 Frame = +1

Query  220  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  399
            TCE +YGFLPCTT   G LFLI+VY +L+ L   Y+S+GS+L  +I G G+ G     IL
Sbjct  53   TCEPTYGFLPCTTVVWGELFLIVVYEFLLSLGEQYVSAGSDLFFQIFGTGIFGASLFHIL  112

Query  400  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI---QX  570
            G++P+  +ILV+GLSGS   A+S  ++ M +LAGS VM LTVIWG+ V  G  DI     
Sbjct  113  GSIPEVAMILVTGLSGSTDTAESMATMSMAMLAGSAVMQLTVIWGSCVFFGNYDISDSST  172

Query  571  AVAVDLKDTXAFSLTGSGVTTD  636
            + A++  +   FSLTG GV TD
Sbjct  173  SSALE-NNKKPFSLTGYGVRTD  193



>ref|XP_002965139.1| hypothetical protein SELMODRAFT_82683 [Selaginella moellendorffii]
 gb|EFJ33977.1| hypothetical protein SELMODRAFT_82683 [Selaginella moellendorffii]
Length=546

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 75/150 (50%), Positives = 102/150 (68%), Gaps = 4/150 (3%)
 Frame = +1

Query  193  LGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgl  372
            L +L  E + C++SYG  PC+    G++FL++VY Y    AA  L +GSELLLEI  PG+
Sbjct  9    LSLLRREGKACQESYGIFPCSEKLGGSVFLLIVYSYAFVKAAQLLLNGSELLLEIAHPGI  68

Query  373  igglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVG  552
            +GGL LPI+  +PDA +ILVSG+ G    AQSQV +GMG+LAGSTV+LLT++WGT ++VG
Sbjct  69   VGGLCLPIICTIPDAAVILVSGIFGDKETAQSQVMIGMGVLAGSTVLLLTMLWGTALIVG  128

Query  553  KCDIQ----XAVAVDLKDTXAFSLTGSGVT  630
            +CD+        A +   T  F LT +GVT
Sbjct  129  RCDLYEINGHKYAREKTLTKGFHLTETGVT  158



>gb|EYU28049.1| hypothetical protein MIMGU_mgv1a003825mg [Erythranthe guttata]
Length=561

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 94/161 (58%), Gaps = 0/161 (0%)
 Frame = +1

Query  154  GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlss  333
            GV    +G+       L+   ETCE  YGFLPC+T   G LFLI+VY  L+     ++  
Sbjct  34   GVDWKSKGASSFLEWKLSATTETCEPIYGFLPCSTNVWGLLFLIVVYEILLSTGGKFVGI  93

Query  334  gsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVM  513
            GS L  +I GPG+ G     +LG  P  +L+LVS LSG+   AQ + ++GMGL+AG+TVM
Sbjct  94   GSNLFFQITGPGIFGASLFQLLGVFPQIVLVLVSSLSGTTEAAQQRATLGMGLVAGTTVM  153

Query  514  LLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            LLT+IWG  V++G  D+  A+ VD       +  G GV TD
Sbjct  154  LLTLIWGISVILGSYDLSEAITVDDSGNQKDTPKGHGVVTD  194



>ref|XP_008226451.1| PREDICTED: uncharacterized protein LOC103326025 [Prunus mume]
Length=725

 Score = 92.8 bits (229),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 110/192 (57%), Gaps = 22/192 (11%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGS---------GVLRLGVLAPEEETCEQSYGFLPCTTTALGNLF  279
            R   LVSDGG                  +L  G+ + EEETCEQ YGFLPC+ +  GN+F
Sbjct  25   RYFRLVSDGGTDHHHHPHNQNQSSSSSPLLFKGIDSAEEETCEQLYGFLPCSNSVYGNVF  84

Query  280  LILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE  459
            L++VY YL+F   +YL++G E + +ILGPG+ G     +LGALP+++L+L SG+  S   
Sbjct  85   LMVVYEYLLFHGESYLAAGGEQIFQILGPGVFGASAFHVLGALPESLLLLASGIFNSKDI  144

Query  460  AQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLK-------------DTX  600
            A   V  G+GLLAG++++LLT++WGT ++V   D    ++ D +                
Sbjct  145  AAEYVYTGVGLLAGTSILLLTILWGTCIIVSSQDFPNKLSSDSEASRDSISSPPLSWKRL  204

Query  601  AFSLTGSGVTTD  636
              SLTG G+TTD
Sbjct  205  PASLTGCGITTD  216



>ref|XP_008383659.1| PREDICTED: uncharacterized protein LOC103446347 [Malus domestica]
Length=563

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 102/171 (60%), Gaps = 2/171 (1%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            R S L+SDG      + S V  L  L  +  TCE  YGFLPC T+  G LFLI+VY  L+
Sbjct  25   RDSSLISDGINDETSQSSIVEALN-LKADSVTCESIYGFLPCATSVWGFLFLIIVYEVLL  83

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
             LA  Y+S GSE+  E+ G G+ G     +LG +P   ++LV+G++ +   A+    + M
Sbjct  84   SLADHYVSRGSEIFFELFGTGIFGASAFHLLGLIPQVGVVLVTGITATTETAEEMAKMNM  143

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQXA-VAVDLKDTXAFSLTGSGVTTD  636
             +LAGST+M+LT+IWG+ V  G  D+  +  + + ++   FSLTGSGV TD
Sbjct  144  SMLAGSTIMILTLIWGSVVAFGSSDLSDSQTSSNSENKNPFSLTGSGVRTD  194



>ref|XP_010060649.1| PREDICTED: uncharacterized protein LOC104448505 [Eucalyptus grandis]
Length=727

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 112/184 (61%), Gaps = 15/184 (8%)
 Frame = +1

Query  130  SSDLVSDG-----GVHSAGEGSGVLRLGV---LAPEEETCEQSYGFLPCTTTALGNLFLI  285
            SS L+SDG       H+      +L  G    L  E+E CEQ YGFLPC+ +  G+LFLI
Sbjct  33   SSPLISDGVDCGHDQHNGPPPDLILLKGAAGDLDDEDEVCEQMYGFLPCSYSIAGHLFLI  92

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            LVY YL+F   + ++SGSE + ++LGPG+ G     +LGALP+A+++L SGL  S   AQ
Sbjct  93   LVYEYLLFQGESCVASGSEQIFKMLGPGIFGASAFHVLGALPEALILLASGLLNSEEVAQ  152

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAF-------SLTGSG  624
              V  G+GLLAGS+++LLT++WGT V++G   +   +  +  ++  F       SL GSG
Sbjct  153  EYVVTGVGLLAGSSILLLTLLWGTCVLLGSRKLSDGMEPNTLNSSRFSWKKFLSSLKGSG  212

Query  625  VTTD  636
            + TD
Sbjct  213  IITD  216



>gb|KHN36865.1| hypothetical protein glysoja_001596 [Glycine soja]
Length=640

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 68/145 (47%), Positives = 94/145 (65%), Gaps = 18/145 (12%)
 Frame = +1

Query  235  YGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpD  414
            YGFLPC+   LG+LFLILVY YL+F   +YL++G E + +ILGPG+ G     ILGALP+
Sbjct  2    YGFLPCSNNILGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGASAFDILGALPE  61

Query  415  AMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKD  594
            +++++V+GLS     AQ   S G+GLLAGS++MLLTV+WGT V++GK  ++        D
Sbjct  62   SLILVVTGLSSDKESAQEYASTGVGLLAGSSIMLLTVVWGTCVIIGKQKLK-------ND  114

Query  595  TXAF-----------SLTGSGVTTD  636
              +F           SLTG G+T D
Sbjct  115  PDSFGTNSSNGGIKESLTGYGITMD  139



>ref|XP_011027727.1| PREDICTED: uncharacterized protein LOC105127946 isoform X3 [Populus 
euphratica]
Length=429

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 104/175 (59%), Gaps = 3/175 (2%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I +  S L+SDG +   G+ +  L+L  L     TCE  YGF+PCTT   GNLFL++V
Sbjct  21   RSIRNEFSYLISDG-LDKKGQNN-FLQLNNLGTSV-TCEPIYGFMPCTTKVWGNLFLLVV  77

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            Y YL+ LA  Y+SSGS L  ++ G G+ GG    +LG  P  +L+LV+ LS S     S 
Sbjct  78   YEYLLSLADKYISSGSNLFFQMFGTGIFGGSVFYVLGKFPQIVLVLVTLLSASEDVVGSA  137

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VS+ MG LAGST+M LT+IWG+ +  G  D+Q   + +L++       G GV TD
Sbjct  138  VSMSMGFLAGSTMMSLTIIWGSVIAFGSYDLQQTPSSNLENKMLCLSNGYGVKTD  192



>ref|XP_009352820.1| PREDICTED: uncharacterized protein LOC103944133 [Pyrus x bretschneideri]
Length=567

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 103/171 (60%), Gaps = 2/171 (1%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            R S L+SDG ++     S  +++  L  +  TCE SYGFLPC T+  G LFLI+VY  L+
Sbjct  29   RDSSLISDG-INDETSQSSFVKVLNLKADSVTCEPSYGFLPCATSVWGLLFLIIVYEVLL  87

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
             LA  Y+S GSE+  E+ G G+ G     +LG +P   ++LV+ ++ +   A+    + M
Sbjct  88   SLADHYVSRGSEIFFELFGTGIFGASAFHLLGLIPQVGVVLVTVITATTETAEEMAKMNM  147

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQXA-VAVDLKDTXAFSLTGSGVTTD  636
             +LAGST+M+LT+IWG+ V  G  D+  +  +   ++   FSLTGSGV TD
Sbjct  148  SMLAGSTIMILTLIWGSVVAFGSSDLSDSQTSSKSENKKPFSLTGSGVRTD  198



>ref|XP_009340418.1| PREDICTED: uncharacterized protein LOC103932516 [Pyrus x bretschneideri]
Length=725

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 112/184 (61%), Gaps = 15/184 (8%)
 Frame = +1

Query  130  SSDLVSDGGVH---SAGEGSGVLRLGV--LAPEEETCEQSYGFLPCTTTALGNLFLILVY  294
            SS LVSDG  H   +   GS +L  GV  +   E +CEQ YGFLPC+ +  G++FL++VY
Sbjct  36   SSQLVSDGTDHEYQNQSSGSLLLLKGVENIDSTESSCEQLYGFLPCSDSVFGHVFLMVVY  95

Query  295  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  474
             YL+F   +YL++G E + +ILGPG+ G     ++GALP+++L+L SG   S   AQ  V
Sbjct  96   EYLLFHGESYLAAGGEQIFKILGPGVFGASAFHVIGALPESLLLLASGFFNSKEVAQEYV  155

Query  475  SVGMGLLAGSTVMLLTVIWGTYVVVGK---CDIQXAVAVDLKDTXAF-------SLTGSG  624
              G+GLLAGS+++ LTV+WGT V+V      D Q + A +  D+          SLT  G
Sbjct  156  YTGVGLLAGSSILSLTVLWGTCVIVSSQEFSDHQSSKASNESDSSLLSWKRLPASLTDCG  215

Query  625  VTTD  636
            +TTD
Sbjct  216  ITTD  219



>ref|XP_007214217.1| hypothetical protein PRUPE_ppa023212mg [Prunus persica]
 gb|EMJ15416.1| hypothetical protein PRUPE_ppa023212mg [Prunus persica]
Length=535

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = +1

Query  184  VLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilg  363
            V+++  L  +  TCE  YGFLPC T+  G LFLI+VY  L+ LA  Y+S+GS+L  E+ G
Sbjct  16   VIQIMDLQADTVTCEPIYGFLPCATSVWGLLFLIIVYEVLLSLADQYVSAGSDLFFELFG  75

Query  364  pgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYV  543
             G+ G     +LG +P   L+LV+G++GS   A++   + MGLLAGS +MLLT++WG+ V
Sbjct  76   TGIFGASAFHMLGMIPQVGLVLVTGVTGSTETAEAMAEMSMGLLAGSAIMLLTLVWGSVV  135

Query  544  VVGKCDIQXA-VAVDLKDTXAFSLTGSGVTTD  636
              G  D+  +  + + ++  +FSLTG GVTTD
Sbjct  136  AFGSHDLSVSQTSSNTENKKSFSLTGYGVTTD  167



>ref|XP_008225191.1| PREDICTED: uncharacterized protein LOC103324855 [Prunus mume]
Length=563

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 102/171 (60%), Gaps = 1/171 (1%)
 Frame = +1

Query  127  RSSDLVSDGGV-HSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYL  303
            R S L+S+GG+  +      +L +  L  +  TCE  YGFLPC T+  G LFLI+VY  L
Sbjct  25   RDSGLISNGGIIDNRISQPSILEVVDLQADTVTCEPVYGFLPCATSVWGLLFLIIVYEVL  84

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            + LA  Y+S+GSEL  E+ G G+ G     +LG +P   L+LV+G++GS   A+    + 
Sbjct  85   LSLADQYVSAGSELFFELFGTGIFGASAFHVLGMIPQVGLVLVTGVTGSTETAEVMAEMS  144

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGS +MLLT++WG+ V  G  D+  +      +    +L+G GVTTD
Sbjct  145  MGLLAGSAIMLLTLVWGSVVAFGSHDLSVSQTSSNTENNMHALSGYGVTTD  195



>gb|EMT05376.1| hypothetical protein F775_06447 [Aegilops tauschii]
Length=503

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 58/70 (83%), Gaps = 1/70 (1%)
 Frame = +1

Query  430  VSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAF  606
            VSGLSG+   AQSQV +GMGLLAGST+MLLT++WG+ V+VGKCD+ + +  +D +DT AF
Sbjct  32   VSGLSGTKEVAQSQVLIGMGLLAGSTIMLLTILWGSCVIVGKCDLSENSTTIDSQDTKAF  91

Query  607  SLTGSGVTTD  636
            SL GSGV+TD
Sbjct  92   SLFGSGVSTD  101



>ref|XP_009353170.1| PREDICTED: uncharacterized protein LOC103944425 [Pyrus x bretschneideri]
Length=628

 Score = 90.1 bits (222),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 102/171 (60%), Gaps = 2/171 (1%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            R S L+SDG     G+ S +L    L  +  TCE +YGFLPC T+  G L LI+VY  L+
Sbjct  89   RDSGLISDGINDIRGQSS-ILEAPNLKADSVTCEPTYGFLPCATSVWGLLSLIIVYEVLL  147

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
             LA  Y+S GSE   E+ G G+ G     +LG +P   ++LV+G++ +    +    + M
Sbjct  148  SLADQYVSKGSEFFFELFGTGIFGASAFHMLGLIPQVGMVLVTGVTATSTTVEEMAEMSM  207

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQXA-VAVDLKDTXAFSLTGSGVTTD  636
            G+LAGST+M+LT+IWG+ V  G  D+  +  + + ++   FSLTGSGV TD
Sbjct  208  GMLAGSTIMILTLIWGSVVAFGSYDLSDSQTSSNPENKKPFSLTGSGVRTD  258



>ref|XP_011000235.1| PREDICTED: uncharacterized protein LOC105107867 isoform X1 [Populus 
euphratica]
Length=719

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 106/176 (60%), Gaps = 10/176 (6%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
            LVSDG        S +L L G+    EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  316  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  495
              YL+SG E +  ILGPG+ G     +LGALP+++++L SGL  +   AQ  VS G+GLL
Sbjct  97   EGYLASGGEKIFRILGPGVFGASAFQVLGALPESLILLASGLLYTREAAQEDVSTGVGLL  156

Query  496  AGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFS-LTGS--------GVTTD  636
            AG++++LLTV+WGT V+VG          +   +  FS LTG+        GVTTD
Sbjct  157  AGTSILLLTVLWGTCVIVGSIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVTTD  212



>ref|XP_011027724.1| PREDICTED: uncharacterized protein LOC105127946 isoform X1 [Populus 
euphratica]
 ref|XP_011027725.1| PREDICTED: uncharacterized protein LOC105127946 isoform X1 [Populus 
euphratica]
Length=554

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 104/175 (59%), Gaps = 3/175 (2%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I +  S L+SDG +   G+ +  L+L  L     TCE  YGF+PCTT   GNLFL++V
Sbjct  21   RSIRNEFSYLISDG-LDKKGQNN-FLQLNNLG-TSVTCEPIYGFMPCTTKVWGNLFLLVV  77

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            Y YL+ LA  Y+SSGS L  ++ G G+ GG    +LG  P  +L+LV+ LS S     S 
Sbjct  78   YEYLLSLADKYISSGSNLFFQMFGTGIFGGSVFYVLGKFPQIVLVLVTLLSASEDVVGSA  137

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            VS+ MG LAGST+M LT+IWG+ +  G  D+Q   + +L++       G GV TD
Sbjct  138  VSMSMGFLAGSTMMSLTIIWGSVIAFGSYDLQQTPSSNLENKMLCLSNGYGVKTD  192



>ref|XP_002275985.2| PREDICTED: uncharacterized protein LOC100255777 [Vitis vinifera]
Length=541

 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 110/174 (63%), Gaps = 12/174 (7%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEE----ETCEQSYGFLPCTTTALGNLFLILVYG  297
            SS LVSDG     GE   V +   +  EE     +C Q+YGF+PCT T  GN+ LILVY 
Sbjct  33   SSGLVSDGD----GE---VQQPAFIVFEEWASSYSCNQTYGFMPCTATVPGNILLILVYV  85

Query  298  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  477
             LM  AA  L  GSE+L+E+L PG+ G +FLP+L +L DA++ + S L G+   AQ+QVS
Sbjct  86   SLMLFAAKLLYDGSEILVELLSPGIAGAVFLPLLSSLLDAIINIASRLCGNGETAQNQVS  145

Query  478  VGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXA-FSLTGSGVTTD  636
             G+GLL GST +LLT++ G  ++V KCD + +     ++T   FSL GS ++TD
Sbjct  146  AGLGLLTGSTAILLTLLGGCCIIVDKCDPENSREKASEETARGFSLAGSAISTD  199



>gb|EYU43357.1| hypothetical protein MIMGU_mgv1a003865mg [Erythranthe guttata]
Length=454

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 93/143 (65%), Gaps = 0/143 (0%)
 Frame = +1

Query  136  DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
            D V D G  S+   +       L+  E TC+  YGFLPC+T   G LFLI+VY  L+ + 
Sbjct  38   DGVDDCGRRSSSTSAPSFLEWGLSAAETTCDPIYGFLPCSTNLWGLLFLIVVYEILLSIG  97

Query  316  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  495
              Y+ +GS L  +I GPG+ GG    +LG +P  +++LVS LSG++A AQ + ++GMGL+
Sbjct  98   GQYVVNGSTLFFQITGPGVFGGSLFQLLGTIPQVVMVLVSALSGTIAAAQQRATLGMGLV  157

Query  496  AGSTVMLLTVIWGTYVVVGKCDI  564
            AG+TVMLLT+IWGT V++G  D+
Sbjct  158  AGTTVMLLTLIWGTSVILGSSDL  180



>ref|XP_011082730.1| PREDICTED: uncharacterized protein LOC105165425 [Sesamum indicum]
Length=724

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 58/125 (46%), Positives = 88/125 (70%), Gaps = 0/125 (0%)
 Frame = +1

Query  211  EEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglfl  390
            E E+C Q YGFLPC+ +  G++FLI+VY YL+F   +Y++SG E + +ILGPG+ G    
Sbjct  72   ESESCSQMYGFLPCSESVWGHVFLIVVYEYLLFHGESYVASGGERIFKILGPGVFGACAF  131

Query  391  pilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQX  570
             ++G+LP+++++L SGL  S  EAQ  V  G+GLLAGS+++LLT++WGT V++G  D   
Sbjct  132  QLIGSLPESLILLASGLLNSKEEAQDCVLTGVGLLAGSSILLLTLLWGTCVILGTRDFSD  191

Query  571  AVAVD  585
             +  D
Sbjct  192  YLQSD  196



>gb|KHN28092.1| hypothetical protein glysoja_007824 [Glycine soja]
Length=640

 Score = 89.0 bits (219),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 93/138 (67%), Gaps = 4/138 (3%)
 Frame = +1

Query  235  YGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpD  414
            YGFLPC+   LG+LFLILVY YL+F   +YL++G E + +ILGPG+ G     ILGALP+
Sbjct  2    YGFLPCSNNILGHLFLILVYEYLLFHGESYLAAGGEQIFKILGPGVFGASAFDILGALPE  61

Query  415  AMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKD  594
            +++++V+GLS     AQ   S G+GLLAGS++MLLTV+WGT V +G+  ++        +
Sbjct  62   SLILVVTGLSSDKESAQEYASTGVGLLAGSSIMLLTVVWGTCVFIGRQKLKNDSNYGGTN  121

Query  595  TXAF----SLTGSGVTTD  636
            + +     SLTG G+T D
Sbjct  122  SSSGGIKESLTGYGITMD  139



>ref|XP_007213499.1| hypothetical protein PRUPE_ppa022096mg, partial [Prunus persica]
 gb|EMJ14698.1| hypothetical protein PRUPE_ppa022096mg, partial [Prunus persica]
Length=645

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 100/154 (65%), Gaps = 13/154 (8%)
 Frame = +1

Query  214  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  393
            EETCEQ YGFLPC+ +  G +FL++VY +L+F   +YL++G E + +ILGPG+ G     
Sbjct  1    EETCEQLYGFLPCSNSVYGQVFLMVVYEFLLFHGESYLAAGGEQIFQILGPGVFGASAFH  60

Query  394  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXA  573
            +LGALP+++L+L SGL  S   A   V  G+GLLAG++++LLT++WGT V+VG  D    
Sbjct  61   VLGALPESLLLLASGLFNSKDIAAEYVYTGVGLLAGTSILLLTILWGTCVIVGSQDFPNE  120

Query  574  VAVD---LKDTXA----------FSLTGSGVTTD  636
            ++ D    KD+ +           SLTG G+TTD
Sbjct  121  LSSDSEASKDSISSPPLSWKRLPASLTGCGITTD  154



>emb|CAN78650.1| hypothetical protein VITISV_033126 [Vitis vinifera]
Length=541

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 109/174 (63%), Gaps = 12/174 (7%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEE----ETCEQSYGFLPCTTTALGNLFLILVYG  297
            SS LVSDG     GE   V +   +  EE     +C Q+YGF+PCT T  GN+ LILVY 
Sbjct  33   SSGLVSDGD----GE---VQQPAFIVFEEWASSYSCNQTYGFMPCTATVPGNILLILVYV  85

Query  298  YLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVS  477
             LM  AA  L  GSE+L+E+L PG+ G +FLP+L +L DA++ + S L G+   AQ+QVS
Sbjct  86   SLMLFAAKLLYDGSEILVELLSPGIAGAVFLPLLSSLLDAIINIASRLCGNGETAQNQVS  145

Query  478  VGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXA-FSLTGSGVTTD  636
             G+GLL GST +LLT++ G  ++V KCD + +     ++T   FSL GS  +TD
Sbjct  146  AGLGLLTGSTAILLTLLGGCCIIVDKCDPENSREKASEETARGFSLAGSAXSTD  199



>ref|XP_002979758.1| hypothetical protein SELMODRAFT_177778, partial [Selaginella 
moellendorffii]
 gb|EFJ19160.1| hypothetical protein SELMODRAFT_177778, partial [Selaginella 
moellendorffii]
Length=306

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 102/157 (65%), Gaps = 16/157 (10%)
 Frame = +1

Query  214  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  393
            E  CE+SYGFLPC++   GNLFL+  +G L+ +AA ++S GSE+LLE++ PGLIGGL LP
Sbjct  18   ENLCEESYGFLPCSSNIGGNLFLMATFGCLLLVAARFISKGSEVLLEVMNPGLIGGLLLP  77

Query  394  ilgalpDAMLILVSGLSGSVAE--------------AQSQVSVGMGLLAGSTVMLLTVIW  531
            ILGALPD +LIL SG  GS+ E              AQ +V VG+G+LAGST +LLT+ W
Sbjct  78   ILGALPDTLLILASGTGGSIQEINSELHSFFESFFQAQEEVMVGVGVLAGSTTLLLTLAW  137

Query  532  GTYVVVGKCDIQXA--VAVDLKDTXAFSLTGSGVTTD  636
               ++ G+CD+  +   A D   T  + L  +GVT D
Sbjct  138  AGSLLAGRCDLSSSDGTAKDEVLTKKYDLFHTGVTVD  174



>gb|EYU43358.1| hypothetical protein MIMGU_mgv1a003865mg [Erythranthe guttata]
Length=559

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 93/143 (65%), Gaps = 0/143 (0%)
 Frame = +1

Query  136  DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
            D V D G  S+   +       L+  E TC+  YGFLPC+T   G LFLI+VY  L+ + 
Sbjct  38   DGVDDCGRRSSSTSAPSFLEWGLSAAETTCDPIYGFLPCSTNLWGLLFLIVVYEILLSIG  97

Query  316  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  495
              Y+ +GS L  +I GPG+ GG    +LG +P  +++LVS LSG++A AQ + ++GMGL+
Sbjct  98   GQYVVNGSTLFFQITGPGVFGGSLFQLLGTIPQVVMVLVSALSGTIAAAQQRATLGMGLV  157

Query  496  AGSTVMLLTVIWGTYVVVGKCDI  564
            AG+TVMLLT+IWGT V++G  D+
Sbjct  158  AGTTVMLLTLIWGTSVILGSSDL  180



>ref|XP_002298902.2| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
 gb|EEE83707.2| hypothetical protein POPTR_0001s38430g [Populus trichocarpa]
Length=690

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 94/139 (68%), Gaps = 1/139 (1%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
            LVSDG        S +L L G+ +  EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDSSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  316  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLL  495
              YL+SG E +  ILGPG+ G     +LGALP+++++L SGL  +   AQ  VS G+GLL
Sbjct  97   EGYLASGGEKIFRILGPGVFGASAFQVLGALPESLILLASGLLNTREVAQEYVSTGVGLL  156

Query  496  AGSTVMLLTVIWGTYVVVG  552
            AG++++LLT++WGT V+VG
Sbjct  157  AGTSILLLTMLWGTCVIVG  175



>ref|XP_002522528.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39828.1| conserved hypothetical protein [Ricinus communis]
Length=521

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 92/170 (54%), Gaps = 5/170 (3%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I D SS L+SDG        S +L+L  L     TCE +YGFLPCTT   G LFL++V
Sbjct  21   RSIRDESSILLSDG--MDQKNQSVILQLDDLRTSV-TCEPTYGFLPCTTEVWGQLFLMIV  77

Query  292  YGYLMFLAATYlss-gsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQS  468
            Y YL+ L+A Y+S      L       +       +LG  P  +L+LV+ + G     ++
Sbjct  78   YEYLLSLSAKYISEGSELFLETSGTENIFSANLFQMLGMFPQVILVLVAAVGGEADTVET  137

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLT  615
               +GMGLLAGS +M LT+IWG+ V  G  D+ Q + + + +    FSLT
Sbjct  138  MAEMGMGLLAGSVIMNLTLIWGSVVAFGSYDLSQTSTSSNTESQNKFSLT  187



>gb|ABR26205.1| sodium/calcium exchanger protein [Oryza sativa Indica Group]
Length=313

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 1/60 (2%)
 Frame = +1

Query  460  AQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            AQSQV +GMGLLAGSTVMLLT++WG+ VVVGKCD+ + + A+DL+DT  FSL GSGV+TD
Sbjct  2    AQSQVLIGMGLLAGSTVMLLTLLWGSCVVVGKCDLSENSTAIDLRDTKGFSLLGSGVSTD  61



>emb|CDP05977.1| unnamed protein product [Coffea canephora]
Length=710

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 59/112 (53%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpi  396
            E C+Q YGFLPC+ T LG+LFLI+VY YL+F   + ++SG E + +ILGPG+ G     +
Sbjct  61   EGCKQLYGFLPCSNTLLGHLFLIVVYEYLLFRGESLVASGGERIFKILGPGIFGASAFHV  120

Query  397  lgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVG  552
            LG+LP+A+++L SGL  S   AQ  V  G GLLAGST++LLT++WGT V+V 
Sbjct  121  LGSLPEALILLASGLLNSRETAQEYVLTGAGLLAGSTILLLTIVWGTCVIVA  172



>gb|EYU26347.1| hypothetical protein MIMGU_mgv1a002045mg [Erythranthe guttata]
Length=723

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 57/121 (47%), Positives = 86/121 (71%), Gaps = 2/121 (2%)
 Frame = +1

Query  196  GVLAPEEE--TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpg  369
            G+   EEE   CEQ YGFLPC+ +  G+LFLI+VY +L+F   +Y++SG E + +ILGPG
Sbjct  58   GIDGEEEELMICEQMYGFLPCSKSMTGHLFLIVVYEFLLFRGESYVASGGERIFKILGPG  117

Query  370  ligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVV  549
            + G     ++G+LP+A+++L SGL      A+  V  G+GLLAGST+++LT++WGT V++
Sbjct  118  VFGASAFQVIGSLPEALILLASGLLSKEESAEEFVVTGVGLLAGSTILILTLLWGTCVIL  177

Query  550  G  552
            G
Sbjct  178  G  178



>ref|XP_005839482.1| hypothetical protein GUITHDRAFT_159252 [Guillardia theta CCMP2712]
 gb|EKX52502.1| hypothetical protein GUITHDRAFT_159252 [Guillardia theta CCMP2712]
Length=503

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  412  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLK  591
            D+ +I++SGL G+  +A+ QVSVG+G LAGST+MLL++ WG  + VG+CDIQ  +A+D +
Sbjct  42   DSAMIVMSGLGGTREQAKEQVSVGIGTLAGSTIMLLSIAWGGSLWVGRCDIQDGMAIDRR  101

Query  592  DTXAFSLTGSGVTTD  636
             T +F LT +GVTTD
Sbjct  102  LTRSFDLTNTGVTTD  116



>ref|XP_009352959.1| PREDICTED: uncharacterized protein LOC103944258 [Pyrus x bretschneideri]
Length=564

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/171 (38%), Positives = 100/171 (58%), Gaps = 2/171 (1%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            R S LVS  G+++    S +L    L  +  TCE +YGFLPC T+  G LFL++VY  L+
Sbjct  25   RDSGLVS-YGINNVISQSSILEALNLKADYVTCEPTYGFLPCATSVWGLLFLVIVYEVLL  83

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
             LA  Y+S GS +  E+ G G+ G     +L  +P   ++LV G++ +   A+    + M
Sbjct  84   SLADHYVSRGSGIFFELFGTGVFGASAFHMLSLIPQVGMVLVIGVTATTETAEEMAEMSM  143

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQXA-VAVDLKDTXAFSLTGSGVTTD  636
             +LAGS++M+LT+IWG+ V  G  D+  +  + + ++   FSLT SGV TD
Sbjct  144  SMLAGSSIMILTIIWGSVVAFGSSDLSDSQTSSNPENKKPFSLTDSGVRTD  194



>ref|XP_008386229.1| PREDICTED: uncharacterized protein LOC103448738 [Malus domestica]
 ref|XP_008359329.1| PREDICTED: uncharacterized protein LOC103423037 [Malus domestica]
Length=725

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 110/184 (60%), Gaps = 15/184 (8%)
 Frame = +1

Query  130  SSDLVSDG---GVHSAGEGSGVLRLGV--LAPEEETCEQSYGFLPCTTTALGNLFLILVY  294
            SS LVSDG      +    S +L  GV  +   E +CEQ YGFLPC+ +  G++FL++VY
Sbjct  36   SSQLVSDGTDXAYQNQSSCSLLLLKGVENIDSTESSCEQLYGFLPCSDSVFGHVFLMVVY  95

Query  295  GYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQV  474
             YL+F   +YL++G E + +ILGPG+ G     ++GALP+++L+L SG   S   AQ  V
Sbjct  96   EYLLFHGESYLAAGGEQIFKILGPGVFGASAFHVIGALPESLLLLASGFFNSKEVAQEYV  155

Query  475  SVGMGLLAGSTVMLLTVIWGTYVVVGK---CDIQXAVAVDLKDTXAF-------SLTGSG  624
              G+GLLAGS+++ LT++WGT V+V      D Q + A +  D+          SLT  G
Sbjct  156  YTGVGLLAGSSILSLTILWGTCVIVSSQZFSDNQSSKASNESDSSLLSWKRLPASLTXCG  215

Query  625  VTTD  636
            +TTD
Sbjct  216  ITTD  219



>gb|KCW67430.1| hypothetical protein EUGRSUZ_F01186 [Eucalyptus grandis]
Length=649

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 60/141 (43%), Positives = 90/141 (64%), Gaps = 7/141 (5%)
 Frame = +1

Query  235  YGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpD  414
            YGFLPC+ +  G+LFLILVY YL+F   +Y++S +E +  +LGPG+ G     +LGALP+
Sbjct  2    YGFLPCSYSTAGHLFLILVYEYLLFHGESYVASATEQIFNMLGPGIFGASAFHVLGALPE  61

Query  415  AMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKD  594
            A+++L SGL  S   AQ  V  G+GLLAGS+++LLT++WGT +++G  +       +  +
Sbjct  62   ALILLASGLLNSEEVAQEYVVTGVGLLAGSSILLLTLLWGTCILLGSREFSDGRESNPSN  121

Query  595  TXAFSL-------TGSGVTTD  636
            +   SL        GSG+ TD
Sbjct  122  SSKLSLKKFVSTFKGSGIITD  142



>gb|AFK39630.1| unknown [Lotus japonicus]
Length=123

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 46/63 (73%), Gaps = 8/63 (13%)
 Frame = +1

Query  136  DLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
            D VSDGG       S ++RL     EE TCEQ+YGFLPCTTT LGNLFLIL+YG+LMF A
Sbjct  32   DPVSDGG------WSSIIRLP--TAEESTCEQTYGFLPCTTTVLGNLFLILIYGFLMFKA  83

Query  316  ATY  324
            AT+
Sbjct  84   ATF  86



>emb|CAN66793.1| hypothetical protein VITISV_034151 [Vitis vinifera]
Length=354

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +1

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTV+LLT++WG+ V+VGKCD+Q +VA DL+DT  FSLTGSGV+TD
Sbjct  1    MGLLAGSTVILLTIMWGSCVIVGKCDLQDSVAKDLQDTKGFSLTGSGVSTD  51



>ref|XP_006370033.1| hypothetical protein POPTR_0001s38420g [Populus trichocarpa]
 gb|ERP66602.1| hypothetical protein POPTR_0001s38420g [Populus trichocarpa]
Length=632

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +1

Query  214  EETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  393
            EE CEQ YGFLPC++   G+LFLI VY Y++F    YL+SG E +  ILGPG+ G     
Sbjct  6    EEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHGEGYLASGGEKIFRILGPGVFGASAFQ  65

Query  394  ilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVG  552
            +LGALP+++++L SGL  +   AQ  VS G+GLLAG++++LLT++WGT V+ G
Sbjct  66   VLGALPESLILLASGLLNTREVAQEYVSTGVGLLAGTSILLLTMLWGTCVIAG  118



>gb|EYU44995.1| hypothetical protein MIMGU_mgv1a002795mg [Erythranthe guttata]
Length=637

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 57/110 (52%), Positives = 82/110 (75%), Gaps = 1/110 (1%)
 Frame = +1

Query  229  QSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgal  408
            Q YGFLPC+ T  G+ FLILVY YL+F A +Y++SG + + +ILGPGL G     I+G+L
Sbjct  16   QMYGFLPCSQTNPGHFFLILVYQYLLFHAESYVASGGKRIFKILGPGLFGASVFQIIGSL  75

Query  409  pDAMLILVSGLSGSVAE-AQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGK  555
            P+A+++L SGL+    E A+  V  G+GLLAGS+++LLT+IWGT V++G+
Sbjct  76   PEALILLASGLTNRSNETAEELVLTGVGLLAGSSILLLTLIWGTCVLLGR  125



>emb|CAN66796.1| hypothetical protein VITISV_034154 [Vitis vinifera]
Length=247

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 5/75 (7%)
 Frame = +1

Query  112  RLIVDR--SSDLVSDGGVHSAGEGSGVLRLGVLAP--EEETCEQSYGFLPCTTTALGNLF  279
            R+I +R  S+DLVSD  VH    GS  L L   +     ++C+++YGF+PCTTT +GNLF
Sbjct  24   RVISNRTLSTDLVSDD-VHDHRNGSPYLLLRSFSAVSASDSCDETYGFMPCTTTIVGNLF  82

Query  280  LILVYGYLMFLAATY  324
            LI+VYGYLMFLAATY
Sbjct  83   LIVVYGYLMFLAATY  97



>gb|KEH38644.1| calcium ion-binding protein, putative [Medicago truncatula]
Length=133

 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 47/65 (72%), Gaps = 10/65 (15%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
            + DL+SDG        S VLRL   A  + TCEQ+YGFLPCTTT LGNLFLILVYG+LM+
Sbjct  42   TRDLISDG--------SNVLRLPTEA--DSTCEQTYGFLPCTTTVLGNLFLILVYGFLMY  91

Query  310  LAATY  324
             AAT+
Sbjct  92   TAATF  96



>ref|XP_004293919.1| PREDICTED: uncharacterized protein LOC101312324 [Fragaria vesca 
subsp. vesca]
Length=562

 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 93/146 (64%), Gaps = 1/146 (1%)
 Frame = +1

Query  202  LAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligg  381
            L  +  TCE  YGFLPC T+  G  F+++VY  L++LA ++++SGSEL  ++ G GL G 
Sbjct  53   LKADTVTCEPIYGFLPCATSFWGLAFMVIVYEILLYLANSFITSGSELFFQMYGTGLFGA  112

Query  382  lflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCD  561
                +LG +P   ++LV+G++G+   A++  ++ +G++AGS +MLLT++WG+ V  G  D
Sbjct  113  SVFHLLGTVPQVGIVLVTGVTGTAETAEAMATMNIGMVAGSAIMLLTLVWGSVVAFGSYD  172

Query  562  I-QXAVAVDLKDTXAFSLTGSGVTTD  636
            I     + +      FS+TG GVTTD
Sbjct  173  ISDSPTSSNRGHKNRFSITGYGVTTD  198



>gb|KCW67437.1| hypothetical protein EUGRSUZ_F01191 [Eucalyptus grandis]
Length=429

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +1

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTVMLLTVIWG+ ++VGKCD+  +VA+D +DT  FSL GSGV+TD
Sbjct  1    MGLLAGSTVMLLTVIWGSCIIVGKCDLHNSVAMDKQDTKGFSLKGSGVSTD  51



>emb|CAN78275.1| hypothetical protein VITISV_037788 [Vitis vinifera]
Length=529

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 74/105 (70%), Gaps = 0/105 (0%)
 Frame = +1

Query  220  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  399
            TCE +YGFLPCTT   G LFLI+VY +L+ L   Y+S+GS+L  +I G G+ G     IL
Sbjct  53   TCEPTYGFLPCTTVVWGELFLIVVYEFLLSLGEQYVSAGSDLFFQIFGTGIFGASLFHIL  112

Query  400  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWG  534
            G++P+  +ILV+GLSGS   A+S  ++ M +LAGS VM LTVIWG
Sbjct  113  GSIPEVAMILVTGLSGSTDTAESMATMSMAMLAGSAVMQLTVIWG  157



>gb|EYU44996.1| hypothetical protein MIMGU_mgv1a025835mg [Erythranthe guttata]
Length=651

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 79/106 (75%), Gaps = 0/106 (0%)
 Frame = +1

Query  235  YGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpD  414
            YGFLPC+ +  G++FLI+VY YL+F   +Y+++G E + +ILGPG+ G     I+GA P+
Sbjct  2    YGFLPCSKSIWGHVFLIVVYEYLLFHGESYVAAGGERIFKILGPGVFGACAFQIIGAFPE  61

Query  415  AMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVG  552
            A+++LVSGL  +   AQ  V  G+GLLAGS+++LLT++WGT V++G
Sbjct  62   ALILLVSGLLNNKEVAQECVLTGVGLLAGSSILLLTLVWGTCVILG  107



>emb|CAN66375.1| hypothetical protein VITISV_037549 [Vitis vinifera]
Length=1347

 Score = 78.2 bits (191),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 71/95 (75%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = +1

Query  229   QSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgal  408
             Q+Y F+PCTTT +GN+FL++VYGYLM LAATYLSSGSELLLEILG GL+GGLFLPILGAL
Sbjct  1056  QTYRFMPCTTTTVGNIFLVVVYGYLMSLAATYLSSGSELLLEILGLGLVGGLFLPILGAL  1115

Query  409   pDAMLILVSGLSGSVAEAQSQVSVGMGL-LAGSTV  510
             PDAMLILVS LSGS   AQSQ S+  G  + GS V
Sbjct  1116  PDAMLILVSRLSGSTETAQSQDSIAKGFSVIGSGV  1150



>ref|XP_008371442.1| PREDICTED: uncharacterized protein LOC103434855 [Malus domestica]
Length=564

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/171 (40%), Positives = 100/171 (58%), Gaps = 2/171 (1%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            R S L+SDG  +     S +L    L  +  TCE +YGFLPC T+  G L LI+VY  L+
Sbjct  25   RDSGLISDG-XNDVISQSSILEALNLKADSVTCEPTYGFLPCATSVWGLLSLIIVYEVLL  83

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
             LA  Y+S GSE   E+ G G+ G     +LG +P   ++LV+G++ +    +    + M
Sbjct  84   SLADQYVSKGSEFFFELFGTGIFGASAFHMLGLIPQVGMVLVTGVTATTTTVEEMAEMNM  143

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQXAV-AVDLKDTXAFSLTGSGVTTD  636
            G+LAGST+M+LT+IWG+ V  G  D+  +  + + +    FSLTGSGV TD
Sbjct  144  GMLAGSTIMILTLIWGSVVAFGSYDLSDSQSSSNPEXKKPFSLTGSGVRTD  194



>ref|XP_010101519.1| hypothetical protein L484_008850 [Morus notabilis]
 gb|EXB88531.1| hypothetical protein L484_008850 [Morus notabilis]
Length=536

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 95/174 (55%), Gaps = 13/174 (7%)
 Frame = +1

Query  133  SDLVSDGGVHSAGEGSGVLRLGV--LAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            SD V D       E  G  +LG+  L     TC   YGFLPC TT  G LF+I+VY  L+
Sbjct  2    SDTVKD-------ETGGSTKLGLVNLKATTVTCVPIYGFLPCATTFWGLLFMIVVYEVLL  54

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
                 Y+S+GS+L  E  G GL G     +LG +P   +ILV+G+  S      Q  + M
Sbjct  55   SYGGQYISAGSDLFFETFGTGLFGASIFQLLGTIPQVGIILVTGIIASPDSVDEQAEISM  114

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQ---XAVAVDL-KDTXAFSLTGSGVTTD  636
            GLLAG T+M LT+IWG  VV+G  D+     + + DL +D   F+L+G GVT D
Sbjct  115  GLLAGKTIMSLTLIWGLVVVLGSHDLSLPATSTSSDLEQDEKPFTLSGYGVTFD  168



>ref|XP_002113975.1| hypothetical protein TRIADDRAFT_57950 [Trichoplax adhaerens]
 gb|EDV23065.1| hypothetical protein TRIADDRAFT_57950 [Trichoplax adhaerens]
Length=518

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 90/141 (64%), Gaps = 4/141 (3%)
 Frame = +1

Query  217  ETCEQ-SYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflp  393
            +TC Q  + + PC     GNL L++ YG ++ +AA  +S G+ELLL++  P  I G  + 
Sbjct  56   DTCYQMRHSWFPCANNIPGNLILMVFYGTILIMAAKLISDGAELLLDLGLPASIIGGLVL  115

Query  394  ilg-alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-Q  567
             L  A+PDA++ILVSGL G    AQ ++SVGMG LAGST+MLLT+ W   +++G+CD+ +
Sbjct  116  PLLGAIPDAVMILVSGL-GPKELAQRKISVGMGALAGSTIMLLTLAWAGSLIIGRCDLGE  174

Query  568  XAVAVDLKDTXAFSLTGSGVT  630
               A++      FSLT  GVT
Sbjct  175  DGKAIEKTGADKFSLTRQGVT  195



>ref|XP_008383883.1| PREDICTED: uncharacterized protein LOC103446524 [Malus domestica]
Length=594

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 103/199 (52%), Gaps = 30/199 (15%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            R S LVS+G ++     S +L    L  +  TCE  +GFLPC T+  G LFL+++Y  L+
Sbjct  25   RDSGLVSNG-INDEISQSSILEGLNLKSDSVTCEPIFGFLPCATSVWGLLFLVIIYEVLL  83

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
             LA  Y+S GSE+  E+ G G+ G     +LG +P   ++LV G++ +    +    + M
Sbjct  84   SLADQYVSRGSEIFFELFGTGVFGASAFHLLGLIPQVGMVLVIGVTATTETVEEMAEMSM  143

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQX-----------------AVAV---DLKD----  594
             +LAGS++M+LT+IWG+ V  G  D+                   AVA    DL D    
Sbjct  144  SMLAGSSIMILTLIWGSVVAFGSSDLSESQTLSNPENKKPLTGLLAVAFGSSDLSDSQTS  203

Query  595  -----TXAFSLTGSGVTTD  636
                 T  FSLTGSGV TD
Sbjct  204  SNPENTKPFSLTGSGVRTD  222



>ref|XP_002500016.1| Ca2+:Cation antiporter family [Micromonas sp. RCC299]
 gb|ACO61274.1| Ca2+:Cation antiporter family [Micromonas sp. RCC299]
Length=554

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 99/147 (67%), Gaps = 7/147 (5%)
 Frame = +1

Query  217  ETCEQS--YGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglfl  390
            +TC  S  +G  P       ++FL LVYGY +  AA ++S GSELLLEIL PGL+GGL L
Sbjct  3    DTCTTSGPFGVFPDCEGLGASVFLNLVYGYALLTAAGFISDGSELLLEILSPGLVGGLLL  62

Query  391  pilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQX  570
            PILGA+PDA +I+ SGL  S  +AQ QVSVGMG LAGSTVMLLT+ WG  +++G+CD+  
Sbjct  63   PILGAVPDAAVIIASGLGASKEDAQEQVSVGMGTLAGSTVMLLTIAWGGSLILGRCDLSS  122

Query  571  -AVAVDLKDTXAFSLT----GSGVTTD  636
               A++   T   S+T     +GVTTD
Sbjct  123  RGTAINKTLTPKASITEAANETGVTTD  149



>ref|XP_642144.1| hypothetical protein DDB_G0278609 [Dictyostelium discoideum AX4]
 gb|EAL68477.1| hypothetical protein DDB_G0278609 [Dictyostelium discoideum AX4]
Length=574

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = +1

Query  247  PCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLI  426
            PC+ T +G+L L+  YG L+   A ++S GSE L+EIL PGLIGGL LPIL ALPDA++I
Sbjct  105  PCSNTVVGDLMLMAAYGVLLAFGAKFISDGSEGLMEILDPGLIGGLVLPILSALPDAIII  164

Query  427  LVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAF  606
            +V+G  GS    Q+Q+S+G+G LAGST+ML+T+ W   +++ +CDI+   +VD   T  F
Sbjct  165  VVAGAFGS--NPQAQLSIGIGTLAGSTIMLMTIPWSLSLILSRCDIRGGQSVDGTLTNKF  222

Query  607  SLTGSGVTTD  636
            SLT +G T D
Sbjct  223  SLTKTGTTVD  232



>ref|XP_010058976.1| PREDICTED: uncharacterized protein LOC104446874 [Eucalyptus grandis]
 gb|KCW74042.1| hypothetical protein EUGRSUZ_E02666 [Eucalyptus grandis]
Length=561

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 83/142 (58%), Gaps = 3/142 (2%)
 Frame = +1

Query  220  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  399
            TCE +YGFLPCTT   G LFL+ VY  L+ LA  Y+SSGSEL   + G G+ G     +L
Sbjct  52   TCEPTYGFLPCTTELWGELFLVAVYECLLALAGKYVSSGSELFFRMFGTGIFGASLFQML  111

Query  400  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI--QXA  573
            G  P  +++L + +S S  + +S  ++ M +LAGS +  L+++WG+ V  G CD      
Sbjct  112  GTFPQVIIMLANAISASSDKTESVATMAMAMLAGSAIFSLSLVWGSIVAFGSCDFSSSSP  171

Query  574  VAVDLKDTX-AFSLTGSGVTTD  636
             + D + T     LTGSGV TD
Sbjct  172  SSSDRQPTREPCRLTGSGVETD  193



>ref|XP_011000237.1| PREDICTED: uncharacterized protein LOC105107867 isoform X3 [Populus 
euphratica]
Length=702

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 90/182 (49%), Gaps = 39/182 (21%)
 Frame = +1

Query  139  LVSDGGVHSAGEGSGVLRL-GVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLA  315
            LVSDG        S +L L G+    EE CEQ YGFLPC++   G+LFLI VY Y++F  
Sbjct  37   LVSDGINDVQENQSSILLLKGMDTSSEEKCEQLYGFLPCSSNIFGHLFLIAVYEYMLFHG  96

Query  316  ATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAE------AQSQVS  477
              YL+SG E +                         IL  G+ G+ A        +S + 
Sbjct  97   EGYLASGGEKI-----------------------FRILGPGVFGASAFQVLGALPESLIL  133

Query  478  VGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFS-LTGS--------GVT  630
            +G+GLLAG++++LLTV+WGT V+VG          +   +  FS LTG+        GVT
Sbjct  134  LGVGLLAGTSILLLTVLWGTCVIVGSIQSSLPTISNTSSSRLFSWLTGACVLSFIQFGVT  193

Query  631  TD  636
            TD
Sbjct  194  TD  195



>tpg|DAA52870.1| TPA: hypothetical protein ZEAMMB73_004216 [Zea mays]
Length=144

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 45/70 (64%), Gaps = 9/70 (13%)
 Frame = +1

Query  136  DLVSDGGVHSAGEGSGVLRLGVLAPEEET-------CEQSYGFLPCTTTALGNLFLILVY  294
             L+SDGG   + +   V+RL   +P           CEQSYGFLPCTTT LGNLFL+L Y
Sbjct  28   RLISDGG--PSAQLLSVIRLSGSSPAAGAAAKAEEKCEQSYGFLPCTTTVLGNLFLVLTY  85

Query  295  GYLMFLAATY  324
            GYLM+ AATY
Sbjct  86   GYLMYKAATY  95



>ref|XP_009352958.1| PREDICTED: uncharacterized protein LOC103944256 [Pyrus x bretschneideri]
Length=594

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 105/201 (52%), Gaps = 32/201 (16%)
 Frame = +1

Query  127  RSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLM  306
            R S LVS+G ++     S +L    L  +  TCE  +GFLPC T+  G LFL++VY  L+
Sbjct  25   RDSGLVSNG-INDEISQSSILDALNLKADSVTCEPIFGFLPCATSVWGLLFLVIVYEVLL  83

Query  307  FLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGM  486
             LA  Y+S GSE+ LE+ G G+ G     +LG +P   ++LV G++ +    +    + M
Sbjct  84   SLADQYVSRGSEIFLELFGTGVFGASAFHLLGLIPQVGMVLVIGVTAATETVEEMAEMSM  143

Query  487  GLLAGSTVMLLTVIWGTYVVVGKCDIQ-------------------XAVAV---DLKDT-  597
             +LAGS++M+LT+IWG+ V  G  D+                     AVA+   DL D+ 
Sbjct  144  SMLAGSSIMILTLIWGSVVAFGSSDLSDSQTLSNPENKKPFSLTGLLAVALGSSDLSDSQ  203

Query  598  --------XAFSLTGSGVTTD  636
                      FSLTGSGV TD
Sbjct  204  TSSNPENKKPFSLTGSGVRTD  224



>gb|EYU28050.1| hypothetical protein MIMGU_mgv1a023246mg [Erythranthe guttata]
Length=682

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/116 (47%), Positives = 75/116 (65%), Gaps = 0/116 (0%)
 Frame = +1

Query  220  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  399
            TC+  YGFLPC+  A G +F I+VY  L+      +  GS++L  I+G G  GG+   IL
Sbjct  7    TCDHQYGFLPCSENAAGYIFQIMVYQGLLIFGEKQIGKGSKVLFHIIGAGKFGGIIFRIL  66

Query  400  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQ  567
             ALP  ML++VSG+  S   AQ+QVS+G+G+ AG TV  LTV WG  V+VG+ D++
Sbjct  67   MALPSMMLMIVSGVFSSKENAQNQVSLGVGIYAGITVFSLTVQWGICVIVGRRDLK  122



>gb|AFW71107.1| hypothetical protein ZEAMMB73_054247, partial [Zea mays]
Length=179

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 1/52 (2%)
 Frame = +1

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTVMLLT++WG+ VVVGKCD+ + + A D +DT  FSL GSGV+TD
Sbjct  1    MGLLAGSTVMLLTLLWGSCVVVGKCDMSENSTATDSQDTKGFSLFGSGVSTD  52



>ref|XP_002522529.1| calmodulin, putative [Ricinus communis]
 gb|EEF39829.1| calmodulin, putative [Ricinus communis]
Length=703

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 58/148 (39%), Positives = 82/148 (55%), Gaps = 0/148 (0%)
 Frame = +1

Query  112  RLIVDRSSDLVSDGGVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILV  291
            R I   S + +   GV      S +L L  L   + TC   Y FLPC T   G +F I+V
Sbjct  21   RSIRSSSDEQLVPSGVEHLEINSSILSLKPLNSTQHTCVHYYSFLPCATNIPGFIFQIVV  80

Query  292  YGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQ  471
            + YL+ L   +L+ G + L  ILG G+ G     IL  LP  +LIL SGL+ +  +A+++
Sbjct  81   FEYLLILGDKFLTKGRQQLFSILGVGIYGATLFRILAVLPTNVLILASGLAQNREDARAR  140

Query  472  VSVGMGLLAGSTVMLLTVIWGTYVVVGK  555
            +  G GLLAGSTV  LT+ WG  V++G+
Sbjct  141  IENGAGLLAGSTVFCLTLQWGICVLLGR  168



>gb|KIY91568.1| hypothetical protein MNEG_16396, partial [Monoraphidium neglectum]
Length=166

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = +1

Query  412  DAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLK  591
            DA++I+ SGL  S + A+ ++SVGMG LAGSTVMLLT++WG  V++G+CD+         
Sbjct  32   DALIIINSGLHESRSAAREEISVGMGTLAGSTVMLLTIVWGGSVLLGRCDLDDVTGAQRD  91

Query  592  DTXA---FSLTGSGVTTD  636
             T     F L  +GV+TD
Sbjct  92   RTRTRPWFDLVNTGVSTD  109



>ref|XP_001627159.1| predicted protein [Nematostella vectensis]
 gb|EDO35059.1| predicted protein [Nematostella vectensis]
Length=997

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 56/137 (41%), Positives = 84/137 (61%), Gaps = 5/137 (4%)
 Frame = +1

Query  226  EQSYGFLPCTTTALGNLFLILVYGYLMFLAAT-Ylssgsellleilgpgligglflpilg  402
            E+  G  PC++T  GN  L++ YG ++ +AA         LL   L   ++GG+ LP+LG
Sbjct  55   EERNGIYPCSSTITGNFLLMVFYGAILGVAAKCISDGAELLLDLGLPASIVGGMVLPLLG  114

Query  403  alpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVA  579
            A+PD+ +I+VSGL    A+AQ +++VGMG LAGST+MLLT  W   V++G+CD+ +   A
Sbjct  115  AVPDSAIIIVSGLG---ADAQDKLNVGMGTLAGSTIMLLTAAWAGSVLIGRCDLNRHGEA  171

Query  580  VDLKDTXAFSLTGSGVT  630
            ++       S T  GVT
Sbjct  172  IEKTGYGKLSCTKQGVT  188



>ref|XP_003288984.1| hypothetical protein DICPUDRAFT_153287 [Dictyostelium purpureum]
 gb|EGC34495.1| hypothetical protein DICPUDRAFT_153287 [Dictyostelium purpureum]
Length=574

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 93/130 (72%), Gaps = 2/130 (2%)
 Frame = +1

Query  247  PCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLI  426
            PCT   +G LFL+ VYG ++ L A ++S GSE LLEIL PGLIGGL LPIL A PDA++I
Sbjct  114  PCTNNIVGMLFLMAVYGSILALGAKFISDGSEGLLEILDPGLIGGLVLPILSAAPDAIII  173

Query  427  LVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAF  606
            LVSG   S    Q+Q+++G+G LAGST+MLLT+ + + +++ +CD++   +VD   T  +
Sbjct  174  LVSGAFSS--NPQAQLAIGIGTLAGSTIMLLTIPFSSSLILARCDLRGGESVDGVLTHKW  231

Query  607  SLTGSGVTTD  636
            SLT +GVT D
Sbjct  232  SLTKTGVTVD  241



>emb|CDY27823.1| BnaC09g28500D [Brassica napus]
Length=124

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  469  QVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
             VSVGMGLLAGSTV LL++IW T  VVGKC+I+  +AV+ +DT  F L  SGV+ D
Sbjct  49   SVSVGMGLLAGSTVTLLSIIWRTCKVVGKCNIRDTIAVNNQDTRTFHLKDSGVSVD  104



>gb|AFW71108.1| hypothetical protein ZEAMMB73_635590 [Zea mays]
Length=160

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 42/70 (60%), Gaps = 5/70 (7%)
 Frame = +1

Query  124  DRSSDLVSDGGVHSAGEGSGVLRLGVLA---PEEETCEQSYGFLPCTTTALGNLFLILVY  294
            DRS  L+  G        + VLRL   A   P  E CE +YGFLPCT TA GNLFL+L Y
Sbjct  32   DRS--LLLAGSSDEVAAATSVLRLPSAAGEDPAPEACEMTYGFLPCTDTAPGNLFLVLAY  89

Query  295  GYLMFLAATY  324
            G LMF AATY
Sbjct  90   GLLMFKAATY  99



>gb|ACN36915.1| unknown [Zea mays]
Length=455

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = +1

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTV LLT++WGT VVVGKCD+     AVD+ DT  FSLTG+GVTTD
Sbjct  1    MGLLAGSTVFLLTLLWGTCVVVGKCDLGPGREAVDVTDTKGFSLTGTGVTTD  52



>gb|EMS45634.1| hypothetical protein TRIUR3_11261 [Triticum urartu]
Length=427

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 44/52 (85%), Gaps = 1/52 (2%)
 Frame = +1

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGST+MLLT++WG+ V+VGKCD+ + +  +D +DT AFSL GSGV+TD
Sbjct  1    MGLLAGSTIMLLTILWGSCVIVGKCDLSEDSTTIDSQDTKAFSLFGSGVSTD  52



>gb|KDP21053.1| hypothetical protein JCGZ_21524 [Jatropha curcas]
Length=686

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 54/145 (37%), Positives = 75/145 (52%), Gaps = 0/145 (0%)
 Frame = +1

Query  178  SGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgselllei  357
            S +L    +   E TC   YGFLPC T   G +F I++  YL+ +    L+ G + L   
Sbjct  39   SSILSPKAINSTEHTCVHYYGFLPCATNVPGFIFQIVILEYLLLVGDKILTKGRQQLFSF  98

Query  358  lgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGT  537
            LG G+ G     IL  LP  +L+L SGL+ +   AQ+++  G G LAGSTV  LT+ WG 
Sbjct  99   LGVGIYGATVFRILAVLPTIVLVLASGLAQNKEAAQARIENGAGTLAGSTVFYLTLQWGI  158

Query  538  YVVVGKCDIQXAVAVDLKDTXAFSL  612
             VV+G+  +          T  FSL
Sbjct  159  CVVLGRTKVTKESPQSTSTTTGFSL  183



>ref|XP_011096404.1| PREDICTED: uncharacterized protein LOC105175608 [Sesamum indicum]
Length=707

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 61/142 (43%), Positives = 83/142 (58%), Gaps = 2/142 (1%)
 Frame = +1

Query  136  DLVSDGGVHS-AGEGSGVLRLGVLAPE-EETCEQSYGFLPCTTTALGNLFLILVYGYLMF  309
            +L+SDG  H    + S  + +   AP    TC   YGFLPC   A G +F ILVY  L+ 
Sbjct  35   ELISDGVDHRFENQSSSSVSVYSSAPSIPSTCNHQYGFLPCAENAAGYIFQILVYQGLLT  94

Query  310  LAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMG  489
                 +  GS++L  I+G G IGG+   IL +LP  ML++VSG+  S   AQSQVS+G+G
Sbjct  95   FGERQIGRGSQVLFHIIGAGKIGGIIFRILMSLPSMMLMIVSGVFSSKENAQSQVSLGVG  154

Query  490  LLAGSTVMLLTVIWGTYVVVGK  555
            + AG TV  LT+ WG  V+ G+
Sbjct  155  IYAGMTVFSLTLQWGICVIFGR  176



>gb|EPS72526.1| sodium/calcium exchanger protein, partial [Genlisea aurea]
Length=116

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +1

Query  217  ETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATY  324
              CEQ+YGFLPCT+T LGNLFL  VYGYLM+LAATY
Sbjct  46   RICEQTYGFLPCTSTVLGNLFLCAVYGYLMYLAATY  81



>ref|XP_004361492.1| hypothetical protein DFA_05775 [Dictyostelium fasciculatum]
 gb|EGG23641.1| hypothetical protein DFA_05775 [Dictyostelium fasciculatum]
Length=582

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 92/135 (68%), Gaps = 6/135 (4%)
 Frame = +1

Query  241  FLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAM  420
            F PC+ T  G + L+ +YG ++   A  +S GSELL+E++  G+IGGL LP+L A PDAM
Sbjct  107  FWPCSGTVGGMILLMAIYGAILAFGAKIISDGSELLMEVIDAGIIGGLLLPLLSAFPDAM  166

Query  421  LILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQ---XAVAVDLK  591
            +I++SG   S  + Q+Q++VG+G LAGST+MLLT+ W   +V+ +CD++      A+D K
Sbjct  167  IIIMSGAFSS--DPQTQLAVGIGTLAGSTIMLLTIPWSASMVLARCDLKDNGNGAAIDNK  224

Query  592  DTXAFSLTGSGVTTD  636
               +FSLT +GVT D
Sbjct  225  -CSSFSLTKTGVTVD  238



>gb|EFA82832.1| hypothetical protein PPL_04527 [Polysphondylium pallidum PN500]
Length=657

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 68/152 (45%), Positives = 92/152 (61%), Gaps = 3/152 (2%)
 Frame = +1

Query  178  SGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgselllei  357
            S V  LG++   EET    +  LPC+ T  G+LFL +VY +L+ + +  +S GSE LLEI
Sbjct  27   SKVKFLGLMETSEET--YCHDILPCSGTITGDLFLQVVYAFLLGVGSRLISLGSEFLLEI  84

Query  358  lgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGT  537
            + PG+IGGL LP+LG LPDA +I VS L G+ AE Q +V+VG+G L G    L+T+ W  
Sbjct  85   IAPGIIGGLVLPLLGTLPDAAIIFVSCLGGTPAEIQHKVTVGVGSLTGGNTFLITIPWAI  144

Query  538  YVVVGKCDI-QXAVAVDLKDTXAFSLTGSGVT  630
             V  G+CDI Q       K    +S   SGV+
Sbjct  145  AVFRGRCDISQVTGLAKNKIYTGWSWKNSGVS  176



>ref|XP_009605371.1| PREDICTED: uncharacterized protein LOC104099939 [Nicotiana tomentosiformis]
Length=706

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 60/179 (34%), Positives = 97/179 (54%), Gaps = 11/179 (6%)
 Frame = +1

Query  115  LIVDRSSDLVSDG---GVHSAGEGSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            L ++ S+ L+SDG    +++   G  +L  G      + C+Q YG  PC  +  G +FLI
Sbjct  23   LRINSSNQLISDGIDDRLNNQEYGQHLLSSG------KICQQLYGIFPCANSIGGYIFLI  76

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VY YL+      +S GS+ L  IL  G+ G     IL   P  ++++ SG+S S  +AQ
Sbjct  77   VVYQYLLITGERLVSRGSKALFNILRTGIFGATIFQILKTFPRIVMVIASGVSASKEKAQ  136

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXAFS-LTGSGVTTD  636
            +Q+S G+    G+TV  LT++WG  V+ G  D+ + + A     + +F  L+ +GVT D
Sbjct  137  NQISSGISTTVGATVFNLTLMWGICVIFGTKDMTEKSAAESSSPSKSFKGLSETGVTID  195



>gb|EMT26603.1| hypothetical protein F775_16568 [Aegilops tauschii]
Length=252

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +1

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDI-QXAVAVDLKDTXA-FSLTGSGVTTD  636
            MGLLAGST+ LLTV+WGT V  GKCDI    VA+D KDT   F  TGSG++TD
Sbjct  1    MGLLAGSTIFLLTVVWGTCVFAGKCDIGPNGVAIDSKDTKGWFRFTGSGISTD  53



>emb|CDY43114.1| BnaC05g36630D [Brassica napus]
Length=71

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +1

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFSLTGSGVTTD  636
            MGLLAGSTV LL++IW T  VVGKC+I+  +AV+ +DT +F L  SGV+ D
Sbjct  1    MGLLAGSTVTLLSIIWRTCTVVGKCNIRDTIAVNNQDTRSFHLKDSGVSVD  51



>emb|CDY09702.1| BnaC07g33590D [Brassica napus]
Length=136

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 48/69 (70%), Gaps = 2/69 (3%)
 Frame = +1

Query  412  DAMLILVSG--LSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVD  585
            DAMLI+ S   L+         VSVGMGLLAGSTVMLL++IW T  V+GKC+I+  +AV+
Sbjct  15   DAMLIMDSRSLLNLICLIVFVSVSVGMGLLAGSTVMLLSIIWRTCTVLGKCNIRDTIAVN  74

Query  586  LKDTXAFSL  612
             +DT +F L
Sbjct  75   NQDTRSFHL  83



>ref|XP_009803286.1| PREDICTED: uncharacterized protein LOC104248681 [Nicotiana sylvestris]
Length=706

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 63/179 (35%), Positives = 95/179 (53%), Gaps = 11/179 (6%)
 Frame = +1

Query  115  LIVDRSSDLVSDGGVHSAGE---GSGVLRLGVLAPEEETCEQSYGFLPCTTTALGNLFLI  285
            L ++ S+ L+SDG  H       G  +L  G      + C+Q YG  PC  +  G +FLI
Sbjct  23   LRLNSSNQLISDGIDHRLNNQEYGQHLLSSG------KICQQLYGIFPCANSIGGYIFLI  76

Query  286  LVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQ  465
            +VY YL+      +S GS+ L  ILGPG+ G     IL  LP  ++++ SG++ S  +AQ
Sbjct  77   IVYQYLLITGERLVSRGSKTLFNILGPGIFGATIFQILKTLPRIVMVIASGVAASKEKAQ  136

Query  466  SQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDI--QXAVAVDLKDTXAFSLTGSGVTTD  636
            +Q+S G+    G+TV  LT++WG  V+ G  D+  + A A          L+ +GVT D
Sbjct  137  NQISSGISTTVGATVFNLTLMWGICVIFGTKDMTEKSAAASSSPFKSLKGLSETGVTID  195



>ref|XP_006340117.1| PREDICTED: uncharacterized protein LOC102587762 [Solanum tuberosum]
Length=703

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 60/174 (34%), Positives = 82/174 (47%), Gaps = 5/174 (3%)
 Frame = +1

Query  130  SSDLVSDGGVHSAGEGSGVLRLGVLA--PEEETCEQSYGFLPCTTTALGNLFLILVYGYL  303
            SS+ +SDG  H     S  L LG L   P  + C   YGF PC     G LF+I+ + YL
Sbjct  33   SSERISDGVEHKLKNQSNYLSLGNLKELPSGDQCNHIYGFFPCAENIGGYLFMIVTFQYL  92

Query  304  MFLAATYlssgsellleilgpgligglflpilgalpDAMLILVSGLSGSVAEAQSQVSVG  483
            + L    L+ GS  L  IL  G+ G    P L   P  ++   SGL  +  +AQ  VS  
Sbjct  93   LILGEKVLAIGSNRLFSILDTGIFGASIFPTLITWPRIVMAFASGLLVTREKAQVSVSSA  152

Query  484  MGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAFS---LTGSGVTTD  636
            +G   GS+V+ LTV+WG  V++G+ +           T       L G GV T+
Sbjct  153  LGSNVGSSVLNLTVLWGICVILGRQNTSTNSNSAESSTSTLKLEDLKGRGVVTN  206



>gb|EFA85983.1| hypothetical protein PPL_01216 [Polysphondylium pallidum PN500]
Length=580

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +1

Query  247  PCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpilgalpDAMLI  426
            PC+ T +G L L+  YG ++   A  +S GSELLLEIL PG+IGGL LP+L A PDA +I
Sbjct  104  PCSGTVVGMLILMAGYGVILAYGAKLISDGSELLLEILDPGIIGGLLLPLLSAFPDAAII  163

Query  427  LVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVGKCDIQXAVAVDLKDTXAF  606
            +VSG   S A AQ+Q+SVG+G LAGSTVMLLT+ +   +++ +CD++   AVD   T   
Sbjct  164  VVSGAFSSQAMAQAQLSVGLGTLAGSTVMLLTIPYSASLLLARCDLRNGYAVDGVCTSR-  222

Query  607  SLTGSGVTTD  636
            SLT +GVT D
Sbjct  223  SLTKTGVTVD  232



>gb|KCW74040.1| hypothetical protein EUGRSUZ_E02663 [Eucalyptus grandis]
Length=567

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +1

Query  220  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  399
            TC+ +Y FLPCTT  LG +FLI+VY +L+  AA  ++SGSEL L + G G+       IL
Sbjct  53   TCDLTYSFLPCTTELLGEIFLIVVYEFLLGYAANCVNSGSELFLRMFGTGIFSSSLFQIL  112

Query  400  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVG  552
            G+LP  +++LVS +S SV   ++  ++GM +L GS V  LT++WG+ V  G
Sbjct  113  GSLPSVIIMLVSSISSSVETVETTAAMGMAMLTGSAVYSLTIVWGSVVAFG  163



>ref|XP_010058973.1| PREDICTED: uncharacterized protein LOC104446871 [Eucalyptus grandis]
Length=542

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +1

Query  220  TCEQSYGFLPCTTTALGNLFLILVYGYLMFLAATYlssgsellleilgpgligglflpil  399
            TC+ +Y FLPCTT  LG +FLI+VY +L+  AA  ++SGSEL L + G G+       IL
Sbjct  53   TCDLTYSFLPCTTELLGEIFLIVVYEFLLGYAANCVNSGSELFLRMFGTGIFSSSLFQIL  112

Query  400  galpDAMLILVSGLSGSVAEAQSQVSVGMGLLAGSTVMLLTVIWGTYVVVG  552
            G+LP  +++LVS +S SV   ++  ++GM +L GS V  LT++WG+ V  G
Sbjct  113  GSLPSVIIMLVSSISSSVETVETTAAMGMAMLTGSAVYSLTIVWGSVVAFG  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 933768211125