BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF043O12

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011086171.1|  PREDICTED: thiamine thiazole synthase 2, chl...    272   1e-86   Sesamum indicum [beniseed]
emb|CDO99712.1|  unnamed protein product                                271   2e-86   Coffea canephora [robusta coffee]
gb|KDO52969.1|  hypothetical protein CISIN_1g018414mg                   270   2e-86   Citrus sinensis [apfelsine]
ref|XP_006452193.1|  hypothetical protein CICLE_v10008765mg             271   3e-86   Citrus clementina [clementine]
ref|NP_001275783.1|  thiamine thiazole synthase, chloroplastic          271   4e-86   Citrus sinensis [apfelsine]
gb|KDO52968.1|  hypothetical protein CISIN_1g018414mg                   271   4e-86   Citrus sinensis [apfelsine]
gb|EYU33910.1|  hypothetical protein MIMGU_mgv1a009148mg                270   8e-86   Erythranthe guttata [common monkey flower]
ref|XP_011096106.1|  PREDICTED: thiamine thiazole synthase 2, chl...    267   8e-85   Sesamum indicum [beniseed]
gb|ABI84250.1|  thiamine biosynthetic enzyme                            260   3e-84   Arachis hypogaea [goober]
ref|XP_002317206.1|  hypothetical protein POPTR_0011s00500g             263   2e-83   Populus trichocarpa [western balsam poplar]
ref|XP_002305603.1|  hypothetical protein POPTR_0004s01990g             263   2e-83   Populus trichocarpa [western balsam poplar]
ref|XP_011037712.1|  PREDICTED: thiamine thiazole synthase 2, chl...    263   2e-83   Populus euphratica
ref|XP_008463440.1|  PREDICTED: thiamine thiazole synthase, chlor...    263   3e-83   Cucumis melo [Oriental melon]
ref|XP_004152916.1|  PREDICTED: thiamine thiazole synthase, chlor...    263   4e-83   Cucumis sativus [cucumbers]
ref|XP_010267751.1|  PREDICTED: thiamine thiazole synthase 2, chl...    262   6e-83   Nelumbo nucifera [Indian lotus]
ref|XP_006449089.1|  hypothetical protein CICLE_v10015727mg             261   2e-82   Citrus clementina [clementine]
ref|XP_004496776.1|  PREDICTED: thiamine thiazole synthase 2, chl...    260   5e-82   Cicer arietinum [garbanzo]
ref|XP_002267414.1|  PREDICTED: thiamine thiazole synthase 2, chl...    259   9e-82   Vitis vinifera
gb|KJB67127.1|  hypothetical protein B456_010G176000                    259   1e-81   Gossypium raimondii
ref|XP_011000691.1|  PREDICTED: thiamine thiazole synthase 2, chl...    259   1e-81   Populus euphratica
gb|KHG29710.1|  Thiamine thiazole synthase 2, chloroplastic             259   1e-81   Gossypium arboreum [tree cotton]
ref|XP_006467989.1|  PREDICTED: thiamine thiazole synthase 2, chl...    259   1e-81   Citrus sinensis [apfelsine]
ref|XP_002281769.1|  PREDICTED: thiamine thiazole synthase 1, chl...    259   2e-81   Vitis vinifera
ref|XP_004244150.1|  PREDICTED: thiamine thiazole synthase, chlor...    258   2e-81   Solanum lycopersicum
ref|XP_010105570.1|  Thiamine thiazole synthase 2                       258   2e-81   
ref|XP_010545204.1|  PREDICTED: thiamine thiazole synthase, chlor...    258   2e-81   Tarenaya hassleriana [spider flower]
gb|AFM35683.1|  thiamin biosynthetic protein                            258   3e-81   Vitis pseudoreticulata
gb|KJB57702.1|  hypothetical protein B456_009G176400                    256   4e-81   Gossypium raimondii
ref|XP_007213805.1|  hypothetical protein PRUPE_ppa007657mg             258   4e-81   Prunus persica
gb|AAP03875.1|  putative chloroplast thiazole biosynthetic protein      257   5e-81   Nicotiana tabacum [American tobacco]
ref|XP_008244366.1|  PREDICTED: thiamine thiazole synthase, chlor...    257   6e-81   Prunus mume [ume]
ref|XP_009774029.1|  PREDICTED: thiamine thiazole synthase, chlor...    257   6e-81   Nicotiana sylvestris
ref|XP_004294669.1|  PREDICTED: thiamine thiazole synthase, chlor...    257   7e-81   Fragaria vesca subsp. vesca
ref|XP_010062976.1|  PREDICTED: thiamine thiazole synthase 1, chl...    257   8e-81   
ref|XP_004294348.1|  PREDICTED: thiamine thiazole synthase, chlor...    257   8e-81   Fragaria vesca subsp. vesca
ref|XP_009590342.1|  PREDICTED: thiamine thiazole synthase, chlor...    257   8e-81   Nicotiana tomentosiformis
ref|XP_003536550.1|  PREDICTED: thiamine thiazole synthase 2, chl...    257   8e-81   Glycine max [soybeans]
gb|KJB57700.1|  hypothetical protein B456_009G176400                    257   1e-80   Gossypium raimondii
ref|XP_007143207.1|  hypothetical protein PHAVU_007G052900g             257   1e-80   Phaseolus vulgaris [French bean]
emb|CDY42479.1|  BnaA10g08550D                                          253   1e-80   Brassica napus [oilseed rape]
gb|KHG06769.1|  Thiamine thiazole synthase 1, chloroplastic             256   1e-80   Gossypium arboreum [tree cotton]
gb|AFK49080.1|  unknown                                                 250   2e-80   Medicago truncatula
ref|XP_007025992.1|  Thiazole biosynthetic enzyme                       257   2e-80   
gb|KDP39066.1|  hypothetical protein JCGZ_00823                         255   3e-80   Jatropha curcas
ref|XP_009358110.1|  PREDICTED: thiamine thiazole synthase, chlor...    255   4e-80   
gb|EPS63253.1|  hypothetical protein M569_11533                         254   5e-80   Genlisea aurea
ref|XP_003556028.1|  PREDICTED: thiamine thiazole synthase 2, chl...    254   6e-80   Glycine max [soybeans]
ref|XP_008366026.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    255   7e-80   
ref|XP_009120006.1|  PREDICTED: thiamine thiazole synthase, chlor...    254   7e-80   Brassica rapa
gb|KEH43920.1|  thiazole biosynthetic enzyme                            254   8e-80   Medicago truncatula
gb|KHG02821.1|  Thiamine thiazole synthase 2, chloroplastic             254   9e-80   Gossypium arboreum [tree cotton]
gb|AAW66657.1|  thiamine biosynthetic enzyme                            254   9e-80   Picrorhiza kurrooa
ref|XP_008386070.1|  PREDICTED: thiamine thiazole synthase, chlor...    253   1e-79   
ref|XP_003563001.1|  PREDICTED: thiamine thiazole synthase 2, chl...    254   1e-79   Brachypodium distachyon [annual false brome]
ref|XP_010448624.1|  PREDICTED: thiamine thiazole synthase, chlor...    254   1e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010670817.1|  PREDICTED: thiamine thiazole synthase, chlor...    254   1e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010443053.1|  PREDICTED: thiamine thiazole synthase, chlor...    254   1e-79   Camelina sativa [gold-of-pleasure]
ref|XP_003607681.1|  Thiazole biosynthetic enzyme                       254   1e-79   Medicago truncatula
ref|XP_010670818.1|  PREDICTED: thiamine thiazole synthase 2, chl...    254   1e-79   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS63028.1|  thiazole biosynthetic enzyme, chloroplastic             252   1e-79   Genlisea aurea
ref|XP_004504342.1|  PREDICTED: thiamine thiazole synthase, chlor...    254   1e-79   Cicer arietinum [garbanzo]
gb|AFK44470.1|  unknown                                                 254   1e-79   Medicago truncatula
ref|XP_002864354.1|  hypothetical protein ARALYDRAFT_918614             254   1e-79   Arabidopsis lyrata subsp. lyrata
ref|XP_010670808.1|  PREDICTED: thiamine thiazole synthase 2, chl...    253   2e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009378870.1|  PREDICTED: thiamine thiazole synthase, chlor...    253   2e-79   Pyrus x bretschneideri [bai li]
gb|EYU19221.1|  hypothetical protein MIMGU_mgv1a009132mg                253   2e-79   Erythranthe guttata [common monkey flower]
ref|XP_001755171.1|  predicted protein                                  253   3e-79   
ref|XP_001767548.1|  predicted protein                                  253   3e-79   
ref|XP_006845176.1|  hypothetical protein AMTR_s00005p00239290          253   3e-79   Amborella trichopoda
gb|KJB13600.1|  hypothetical protein B456_002G083700                    253   4e-79   Gossypium raimondii
gb|ADG27845.1|  thiazole biosynthetic enzyme                            253   4e-79   Gossypium hirsutum [American cotton]
ref|XP_009408664.1|  PREDICTED: thiamine thiazole synthase 2, chl...    253   4e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK46185.1|  unknown                                                 252   5e-79   Medicago truncatula
ref|NP_001236812.1|  thiamin biosynthetic enzyme                        251   7e-79   Glycine max [soybeans]
ref|XP_002522858.1|  electron transfer flavoprotein-ubiquinone ox...    252   7e-79   Ricinus communis
ref|XP_001767495.1|  predicted protein                                  251   8e-79   
gb|EMS66450.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         251   8e-79   Triticum urartu
ref|XP_006401539.1|  hypothetical protein EUTSA_v10013978mg             251   1e-78   Eutrema salsugineum [saltwater cress]
gb|KCW70139.1|  hypothetical protein EUGRSUZ_F03433                     255   1e-78   Eucalyptus grandis [rose gum]
emb|CDY47441.1|  BnaC09g31160D                                          251   1e-78   Brassica napus [oilseed rape]
gb|AHA84206.1|  thiamin biosynthetic enzyme                             251   1e-78   Phaseolus vulgaris [French bean]
ref|XP_007132954.1|  hypothetical protein PHAVU_011G139100g             251   1e-78   Phaseolus vulgaris [French bean]
ref|XP_011030844.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    251   1e-78   Populus euphratica
emb|CDY52570.1|  BnaC03g71780D                                          251   2e-78   Brassica napus [oilseed rape]
dbj|BAA88225.1|  thiamin biosynthetic enzyme                            251   2e-78   Glycine max [soybeans]
ref|XP_001753819.1|  predicted protein                                  251   2e-78   
ref|XP_001753698.1|  predicted protein                                  250   3e-78   
emb|CDY43024.1|  BnaA03g11710D                                          250   3e-78   Brassica napus [oilseed rape]
emb|CDY28754.1|  BnaA02g09460D                                          250   4e-78   Brassica napus [oilseed rape]
gb|ACF85034.1|  unknown                                                 248   4e-78   Zea mays [maize]
ref|XP_009132425.1|  PREDICTED: thiamine thiazole synthase, chlor...    250   4e-78   Brassica rapa
ref|NP_001236824.1|  thiamin biosynthetic enzyme                        249   5e-78   
gb|AGT17015.1|  thiazole biosynthetic enzyme                            249   7e-78   Saccharum hybrid cultivar R570
gb|AGT16846.1|  Thiazole biosynthetic enzyme Thi4 family                249   7e-78   Saccharum hybrid cultivar R570
gb|AGT16507.1|  Thiazole biosynthetic enzyme Thi4 family                249   7e-78   Saccharum hybrid cultivar R570
gb|AGT15954.1|  Thiazole biosynthetic enzyme Thi4 family                249   1e-77   Saccharum hybrid cultivar R570
ref|XP_006280726.1|  hypothetical protein CARUB_v10026695mg             248   1e-77   Capsella rubella
ref|XP_004965741.1|  PREDICTED: thiamine thiazole synthase 2, chl...    248   1e-77   Setaria italica
dbj|BAA88226.1|  thiamin biosynthetic enzyme                            248   2e-77   Glycine max [soybeans]
ref|XP_006360084.1|  PREDICTED: thiamine thiazole synthase 1, chl...    248   2e-77   Solanum tuberosum [potatoes]
ref|XP_002316981.2|  hypothetical protein POPTR_0011s13820g             248   2e-77   Populus trichocarpa [western balsam poplar]
ref|XP_004505443.1|  PREDICTED: thiamine thiazole synthase, chlor...    248   3e-77   Cicer arietinum [garbanzo]
ref|XP_010485129.1|  PREDICTED: thiamine thiazole synthase, chlor...    253   3e-77   
ref|XP_009127069.1|  PREDICTED: thiamine thiazole synthase, chlor...    248   3e-77   Brassica rapa
ref|XP_007021022.1|  Thiazole biosynthetic enzyme, chloroplast (A...    248   3e-77   Theobroma cacao [chocolate]
gb|AGT16062.1|  Thiazole biosynthetic enzyme Thi4 family                248   4e-77   Saccharum hybrid cultivar R570
ref|NP_001105697.1|  thiamine thiazole synthase 2, chloroplastic ...    247   5e-77   
gb|AFK48432.1|  unknown                                                 247   5e-77   Lotus japonicus
sp|Q38709.1|THI4_ALNGL  RecName: Full=Thiamine thiazole synthase,...    247   5e-77   Alnus glutinosa
emb|CBI23176.3|  unnamed protein product                                246   6e-77   Vitis vinifera
ref|NP_200288.1|  thiazole biosynthetic enzyme                          246   7e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463222.1|  hypothetical protein SORBIDRAFT_02g040060          246   1e-76   Sorghum bicolor [broomcorn]
ref|XP_004957903.1|  PREDICTED: thiamine thiazole synthase 2, chl...    246   1e-76   Setaria italica
gb|ABK22862.1|  unknown                                                 246   1e-76   Picea sitchensis
gb|ACF87708.1|  unknown                                                 246   2e-76   Zea mays [maize]
gb|AFO59577.1|  thiamine biosynthetic enzyme                            245   3e-76   Saccharum hybrid cultivar GT28
gb|ABK23376.1|  unknown                                                 245   4e-76   Picea sitchensis
pdb|1RP0|A  Chain A, Crystal Structure Of Thi1 Protein From Arabi...    242   6e-76   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC79982.1|  putative thiamine biosynthesis protein                 243   7e-76   Oryza sativa Japonica Group [Japonica rice]
gb|KFK27084.1|  hypothetical protein AALP_AA8G331900                    244   9e-76   Arabis alpina [alpine rockcress]
ref|NP_001105696.1|  thiamine thiazole synthase 1, chloroplastic ...    244   1e-75   Zea mays [maize]
ref|XP_009388868.1|  PREDICTED: thiamine thiazole synthase 2, chl...    244   1e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002458014.1|  hypothetical protein SORBIDRAFT_03g025520          243   2e-75   Sorghum bicolor [broomcorn]
ref|XP_006657781.1|  PREDICTED: thiamine thiazole synthase 2, chl...    243   2e-75   Oryza brachyantha
gb|AFW83047.1|  hypothetical protein ZEAMMB73_797739                    243   3e-75   
gb|AAV92535.1|  thiazole biosynthetic enzyme                            242   3e-75   Pseudotsuga menziesii var. menziesii
dbj|BAC45141.1|  putative thiamine biosynthesis protein                 242   3e-75   Oryza sativa Japonica Group [Japonica rice]
gb|AAV92531.1|  thiazole biosynthetic enzyme                            242   3e-75   Pseudotsuga menziesii var. menziesii
gb|AAV92539.1|  thiazole biosynthetic enzyme                            242   4e-75   Pseudotsuga menziesii var. menziesii
gb|AAV92529.1|  thiazole biosynthetic enzyme                            242   4e-75   Pseudotsuga menziesii var. menziesii
gb|AAV92538.1|  thiazole biosynthetic enzyme                            242   4e-75   Pseudotsuga menziesii var. menziesii
ref|NP_001059841.1|  Os07g0529600                                       242   4e-75   
gb|AAZ93636.1|  pathogen-induced defense-responsive protein 8           242   4e-75   Oryza sativa Indica Group [Indian rice]
gb|EAZ04139.1|  hypothetical protein OsI_26282                          242   4e-75   Oryza sativa Indica Group [Indian rice]
gb|AAV92537.1|  thiazole biosynthetic enzyme                            242   4e-75   Pseudotsuga menziesii var. menziesii
gb|AAV92552.1|  thiazole biosynthetic enzyme                            241   5e-75   Pseudotsuga menziesii var. menziesii
ref|XP_010923945.1|  PREDICTED: thiamine thiazole synthase, chlor...    242   6e-75   Elaeis guineensis
gb|AAV92554.1|  thiazole biosynthetic enzyme                            242   6e-75   Pseudotsuga menziesii var. menziesii
ref|XP_010930933.1|  PREDICTED: LOW QUALITY PROTEIN: thiamine thi...    242   6e-75   
ref|XP_002973063.1|  hypothetical protein SELMODRAFT_271002             242   6e-75   Selaginella moellendorffii
gb|AFK49632.1|  unknown                                                 241   8e-75   Lotus japonicus
ref|XP_008809851.1|  PREDICTED: thiamine thiazole synthase 1, chl...    241   1e-74   Phoenix dactylifera
ref|XP_002994429.1|  hypothetical protein SELMODRAFT_163429             241   1e-74   
ref|XP_008803216.1|  PREDICTED: thiamine thiazole synthase 2, chl...    238   1e-73   Phoenix dactylifera
gb|EMT30436.1|  Thiazole biosynthetic enzyme 1-2, chloroplastic         231   5e-71   
gb|ABK95834.1|  unknown                                                 226   7e-70   Populus trichocarpa [western balsam poplar]
emb|CDM85402.1|  unnamed protein product                                224   3e-68   Triticum aestivum [Canadian hard winter wheat]
emb|CDY41008.1|  BnaA02g27980D                                          220   2e-67   Brassica napus [oilseed rape]
gb|EPB86412.1|  thiazole biosynthetic enzyme, chloroplastic             221   2e-67   Mucor circinelloides f. circinelloides 1006PhL
emb|CDP05793.1|  unnamed protein product                                219   6e-67   Coffea canephora [robusta coffee]
dbj|GAN03507.1|  thiamin biosynthetic enzyme                            220   6e-67   Mucor ambiguus
gb|KFH67165.1|  thiazole biosynthetic enzyme, chloroplastic             218   2e-66   Mortierella verticillata NRRL 6337
gb|EIE83081.1|  thiazole biosynthetic enzyme, chloroplastic             216   1e-65   Rhizopus delemar RA 99-880
emb|CEI86767.1|  Putative Thiamine thiazole synthase                    211   4e-65   Rhizopus microsporus
emb|CEI86769.1|  Putative Thiamine thiazole synthase                    214   5e-65   Rhizopus microsporus
gb|EYU27823.1|  hypothetical protein MIMGU_mgv1a009995mg                215   6e-65   Erythranthe guttata [common monkey flower]
emb|CEG62855.1|  Putative Thiamine thiazole synthase                    214   1e-64   Rhizopus microsporus
emb|CEP18429.1|  hypothetical protein                                   214   2e-64   Parasitella parasitica
ref|XP_005648929.1|  thiazole biosynthetic enzyme                       214   2e-64   Coccomyxa subellipsoidea C-169
emb|CEG76808.1|  Putative Thiamine thiazole synthase                    211   3e-64   Rhizopus microsporus
ref|XP_006441062.1|  hypothetical protein CICLE_v10024231mg             214   5e-64   
gb|KDO47270.1|  hypothetical protein CISIN_1g039605mg                   213   6e-64   Citrus sinensis [apfelsine]
gb|EPB91714.1|  thiazole biosynthetic enzyme, chloroplastic             212   8e-64   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_004496859.1|  PREDICTED: thiamine thiazole synthase, chlor...    213   9e-64   Cicer arietinum [garbanzo]
ref|XP_002784437.1|  conserved hypothetical protein                     209   2e-62   Perkinsus marinus ATCC 50983
gb|ACV52582.1|  thiazole biosynthetic enzyme                            201   1e-61   Nicotiana benthamiana
ref|XP_009844132.1|  thiazole biosynthesis enzyme                       202   7e-60   Aphanomyces astaci
gb|KDO30626.1|  hypothetical protein SPRG_04526                         201   2e-59   Saprolegnia parasitica CBS 223.65
ref|XP_008616182.1|  thiamine biosynthetic enzyme                       200   4e-59   Saprolegnia diclina VS20
ref|XP_008877253.1|  thiazole biosynthetic enzyme, chloroplastic,...    200   4e-59   Aphanomyces invadans
ref|XP_005847930.1|  hypothetical protein CHLNCDRAFT_22703              194   3e-57   Chlorella variabilis
emb|CAA57779.1|  nmt2                                                   194   5e-57   Schizosaccharomyces pombe
gb|ABR01228.1|  thiazole biosynthetic enzyme                            195   7e-57   Chlorella vulgaris
ref|NP_596642.1|  thiazole biosynthetic enzyme                          194   9e-57   Schizosaccharomyces pombe
ref|XP_005834399.1|  putative THI4, thiamine                            194   1e-56   Guillardia theta CCMP2712
emb|CAH25337.1|  thiazole biosynthetic enzyme                           194   1e-56   Guillardia theta
gb|EMG50374.1|  hypothetical protein G210_4595                          194   1e-56   Candida maltosa Xu316
ref|XP_009853231.1|  hypothetical protein NEUTE1DRAFT_95662             193   3e-56   Neurospora tetrasperma FGSC 2508
ref|XP_007376158.1|  hypothetical protein SPAPADRAFT_51398              193   3e-56   Spathaspora passalidarum NRRL Y-27907
gb|KIW79545.1|  thiamine thiazole synthase                              192   4e-56   Fonsecaea pedrosoi CBS 271.37
gb|KDB14289.1|  thiazole biosynthetic enzyme variant 1                  192   5e-56   Ustilaginoidea virens
ref|XP_003044703.1|  predicted protein                                  191   8e-56   [Nectria] haematococca mpVI 77-13-4
ref|XP_001386426.1|  hypothetical protein PICST_50942                   192   9e-56   Scheffersomyces stipitis CBS 6054
gb|KIW92677.1|  thiamine thiazole synthase                              191   1e-55   Cladophialophora bantiana CBS 173.52
ref|XP_007807526.1|  thiazole biosynthetic enzyme variant 1             192   1e-55   Metarhizium acridum CQMa 102
gb|KIY92671.1|  thiamine biosynthetic enzyme                            192   1e-55   Monoraphidium neglectum
gb|EDK40113.2|  conserved hypothetical protein                          191   1e-55   Meyerozyma guilliermondii ATCC 6260
ref|XP_001483482.1|  conserved hypothetical protein                     191   1e-55   Meyerozyma guilliermondii ATCC 6260
gb|KID90425.1|  thiazole biosynthetic enzyme variant 1                  191   1e-55   Metarhizium guizhouense ARSEF 977
gb|KID99833.1|  thiazole biosynthetic enzyme variant 1                  191   2e-55   Metarhizium majus ARSEF 297
ref|XP_007821738.1|  thiazole biosynthetic enzyme variant 1             191   2e-55   Metarhizium robertsii ARSEF 23
ref|XP_002548228.1|  hypothetical protein CTRG_02525                    191   2e-55   Candida tropicalis MYA-3404
gb|KIY99977.1|  thiamine biosynthetic enzyme                            191   2e-55   Monoraphidium neglectum
ref|XP_007913237.1|  putative thiazole biosynthetic enzyme protein      190   3e-55   Phaeoacremonium minimum UCRPA7
gb|KHN95056.1|  thiazole biosynthetic enzyme variant 1                  190   3e-55   Metarhizium album ARSEF 1941
gb|KIX99472.1|  thiamine thiazole synthase                              190   4e-55   Fonsecaea multimorphosa CBS 102226
ref|XP_007835960.1|  Thiamine thiazole synthase                         190   4e-55   Pestalotiopsis fici W106-1
ref|XP_007745751.1|  thiazole biosynthetic enzyme, mitochondrial        190   5e-55   Cladophialophora psammophila CBS 110553
ref|XP_007591792.1|  thiazole biosynthetic enzyme                       189   5e-55   
gb|KIW29175.1|  thiamine thiazole synthase                              189   6e-55   Cladophialophora immunda
ref|XP_009154920.1|  thiazole biosynthetic enzyme, mitochondrial        189   6e-55   Exophiala dermatitidis NIH/UT8656
pdb|3JSK|A  Chain A, Thiazole Synthase From Neurospora Crassa           189   8e-55   Neurospora crassa
emb|CCK70574.1|  hypothetical protein KNAG_0E03150                      189   8e-55   Kazachstania naganishii CBS 8797
ref|XP_011395239.1|  thiazole biosynthetic enzyme, variant 2            189   9e-55   Neurospora crassa OR74A
gb|KIL95952.1|  hypothetical protein FAVG1_00690                        189   9e-55   Fusarium avenaceum
gb|KHE80990.1|  hypothetical protein GE21DRAFT_10110                    189   9e-55   Neurospora crassa
gb|ABN45968.1|  thiazole biosynthetic enzyme variant 1                  188   1e-54   Epichloe typhina
ref|XP_002951140.1|  hypothetical protein VOLCADRAFT_74900              189   1e-54   Volvox carteri f. nagariensis
ref|XP_002951138.1|  hypothetical protein VOLCADRAFT_74899              189   1e-54   Volvox carteri f. nagariensis
gb|KHC63824.1|  thiazole biosynthesis enzyme                            189   1e-54   Candida albicans P75010
ref|XP_007728533.1|  thiazole biosynthetic enzyme, mitochondrial        189   1e-54   Capronia epimyces CBS 606.96
gb|KIW21130.1|  thiamine thiazole synthase                              189   1e-54   Exophiala spinifera
ref|XP_002172093.1|  thiazole biosynthetic enzyme                       188   1e-54   Schizosaccharomyces japonicus yFS275
ref|XP_007721137.1|  thiazole biosynthetic enzyme, mitochondrial        188   1e-54   Capronia coronata CBS 617.96
gb|EHK27008.1|  hypothetical protein TRIVIDRAFT_215037                  188   2e-54   Trichoderma virens Gv29-8
gb|AGO09853.1|  AaceriAAL137Wp                                          188   2e-54   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_004198891.1|  Piso0_002284                                       188   2e-54   
gb|KIV92747.1|  thiamine thiazole synthase                              188   2e-54   Exophiala mesophila
sp|P23618.2|THI4_FUSOX  RecName: Full=Thiamine thiazole synthase;...    187   2e-54   Fusarium oxysporum
ref|XP_011318395.1|  hypothetical protein FGSG_02469                    187   2e-54   Fusarium graminearum PH-1
emb|CCE33143.1|  probable CyPBP37 protein (protein binding to CyP41)    187   3e-54   Claviceps purpurea 20.1
ref|XP_009253330.1|  hypothetical protein FPSE_01936                    187   3e-54   Fusarium pseudograminearum CS3096
gb|EWG49587.1|  thiamine biosynthetic enzyme                            187   3e-54   Fusarium verticillioides 7600
ref|XP_004199741.1|  Piso0_002284                                       187   3e-54   
gb|EMT70803.1|  Thiazole biosynthetic enzyme, mitochondrial             187   3e-54   Fusarium oxysporum f. sp. cubense race 4
gb|KIV86535.1|  thiamine thiazole synthase, variant 2                   187   3e-54   Exophiala sideris
gb|KEZ45124.1|  Thiamine thiazole synthase                              187   4e-54   Scedosporium apiospermum
gb|ABG46357.1|  mitochondrial thiazole biosynthetic enzyme              187   4e-54   Trichoderma harzianum
ref|XP_001819323.1|  thiazole biosynthetic enzyme                       187   4e-54   Aspergillus oryzae RIB40
gb|AAL86771.2|  THI4 enzyme                                             188   5e-54   Candida albicans
gb|AAF25444.1|AF217503_1  putative thiazole synthase                    187   5e-54   Aspergillus oryzae
gb|KIV86533.1|  thiamine thiazole synthase                              187   5e-54   Exophiala sideris
ref|XP_002375225.1|  thiazole biosynthesis enzyme Sti35                 187   5e-54   Aspergillus flavus NRRL3357
ref|XP_006968797.1|  thiazole biosynthetic enzyme                       187   6e-54   Trichoderma reesei QM6a
ref|XP_002419419.1|  thiamine biosynthesis enzyme, putative; thia...    187   6e-54   Candida dubliniensis CD36
gb|KDN61355.1|  putative Thi4 family protein                            187   6e-54   Colletotrichum sublineola
ref|XP_723197.1|  likely thiamine biosynthesis enzyme                   187   6e-54   Candida albicans SC5314
ref|XP_006666857.1|  thiazole biosynthetic enzyme                       187   6e-54   Cordyceps militaris CM01
sp|C4YNP4.1|THI4_CANAW  RecName: Full=Thiamine thiazole synthase;...    187   6e-54   Candida albicans WO-1
gb|KGR10168.1|  thiazole biosynthesis enzyme                            187   7e-54   Candida albicans P57072
gb|KGQ88127.1|  thiazole biosynthesis enzyme                            187   7e-54   Candida albicans P94015
ref|XP_499918.1|  YALI0A09768p                                          186   7e-54   Yarrowia lipolytica CLIB122
gb|KHC37210.1|  thiazole biosynthesis enzyme                            187   7e-54   Candida albicans P76067
ref|XP_001698672.1|  full-length thiazole biosynthetic enzyme           187   7e-54   Chlamydomonas reinhardtii
gb|KEF63437.1|  thiazole biosynthetic enzyme, mitochondrial             186   8e-54   Exophiala aquamarina CBS 119918
ref|NP_982405.1|  AAL137Wp                                              186   8e-54   Eremothecium gossypii ATCC 10895
gb|ACB70465.1|  thiazole biosynthetic enzyme                            186   9e-54   Trichoderma aureoviride
gb|EXK40264.1|  thiamine biosynthetic enzyme                            187   1e-53   Fusarium oxysporum f. sp. melonis 26406
ref|XP_001904665.1|  hypothetical protein                               184   1e-53   Podospora anserina S mat+
gb|KIW39396.1|  thiamine thiazole synthase, variant 1                   186   1e-53   Exophiala oligosperma
gb|ABN45974.1|  thiazole biosynthetic enzyme variant 1                  186   1e-53   Epichloe festucae var. lolii
ref|XP_011273842.1|  Thiazole biosynthetic enzyme                       186   1e-53   Wickerhamomyces ciferrii
gb|EQB43457.1|  hypothetical protein CGLO_17887                         186   1e-53   Colletotrichum gloeosporioides Cg-14
ref|XP_006692218.1|  hypothetical protein CTHT_0017160                  186   1e-53   Chaetomium thermophilum var. thermophilum DSM 1495
gb|KGQ06713.1|  Thiamine thiazole synthase                              186   1e-53   Beauveria bassiana D1-5
ref|XP_007794010.1|  putative thiazole biosynthetic enzyme protein      186   1e-53   
gb|ENH83973.1|  thiazole biosynthetic enzyme                            186   2e-53   
ref|XP_008598283.1|  mitochondrial thiazole biosynthetic enzyme         186   2e-53   Beauveria bassiana ARSEF 2860
gb|ABL63512.1|  mitochondrial thiazole biosynthetic enzyme              186   2e-53   Beauveria bassiana
gb|KIX08964.1|  thiamine thiazole synthase                              185   2e-53   Rhinocladiella mackenziei CBS 650.93
gb|ACN39013.1|  thiazole synthase                                       185   2e-53   Epichloe festucae
sp|P23617.1|THI4_FUSSH  RecName: Full=Thiamine thiazole synthase;...    185   2e-53   Fusarium phaseoli
gb|KIW39395.1|  thiamine thiazole synthase                              186   2e-53   Exophiala oligosperma
gb|EYE95075.1|  Thi4 family thiamine biosynthetic enzyme                185   2e-53   Aspergillus ruber CBS 135680
gb|EFQ30532.1|  Thi4 family protein                                     185   2e-53   Colletotrichum graminicola M1.001
ref|XP_008026201.1|  hypothetical protein SETTUDRAFT_177413             185   2e-53   Exserohilum turcica Et28A
gb|EPY53594.1|  thiazole biosynthetic enzyme                            185   2e-53   Schizosaccharomyces cryophilus OY26
gb|EWG49586.1|  thiamine biosynthetic enzyme                            187   3e-53   Fusarium verticillioides 7600
ref|XP_008726400.1|  thiazole biosynthetic enzyme, mitochondrial        185   3e-53   Cladophialophora carrionii CBS 160.54
ref|XP_661532.1|  THI4_ASPOR Thiazole biosynthetic enzyme, mitoch...    185   3e-53   Aspergillus nidulans FGSC A4
ref|XP_461084.2|  DEHA2F16654p                                          185   3e-53   Debaryomyces hansenii CBS767
ref|XP_002146762.1|  thiazole biosynthesis enzyme                       185   3e-53   Talaromyces marneffei ATCC 18224
emb|CEJ80029.1|  Putative Thiamine thiazole synthase                    185   3e-53   Torrubiella hemipterigena
ref|XP_001394167.1|  thiazole biosynthetic enzyme                       185   3e-53   Aspergillus niger CBS 513.88
gb|EHK44880.1|  hypothetical protein TRIATDRAFT_299703                  184   3e-53   Trichoderma atroviride IMI 206040
ref|XP_003297921.1|  hypothetical protein PTT_08482                     185   4e-53   
dbj|GAM35876.1|  thiazole biosynthetic enzyme                           184   5e-53   Talaromyces cellulolyticus
emb|CCF45087.1|  thiazole biosynthetic enzyme                           184   5e-53   Colletotrichum higginsianum
dbj|GAA84055.1|  thiazole biosynthesis enzyme                           184   6e-53   Aspergillus kawachii IFO 4308
gb|EHN02289.1|  Thi4p                                                   184   7e-53   
ref|XP_001214996.1|  hypothetical protein ATEG_05818                    184   7e-53   
gb|EPX71211.1|  thiazole biosynthetic enzyme                            184   8e-53   
ref|XP_002479053.1|  thiazole biosynthesis enzyme                       184   9e-53   
emb|CDP29968.1|  Putative mitochondrial thiazole biosynthetic enz...    184   9e-53   
ref|XP_007692325.1|  hypothetical protein COCMIDRAFT_30031              184   1e-52   
ref|XP_003868755.1|  Thi4 thiamine biosynthetic enzyme precursor        184   1e-52   
gb|KEY78369.1|  thiazole biosynthesis enzyme                            184   1e-52   
ref|XP_750725.1|  thiazole biosynthesis enzyme                          183   1e-52   
emb|CEJ80028.1|  Putative Thiamine thiazole synthase                    185   1e-52   
gb|KEQ59396.1|  Thi4-domain-containing protein                          183   1e-52   
ref|XP_007701574.1|  hypothetical protein COCSADRAFT_38262              184   1e-52   
gb|EUN24789.1|  hypothetical protein COCVIDRAFT_17857                   184   1e-52   
ref|XP_007757037.1|  thiazole biosynthetic enzyme, mitochondrial        183   1e-52   
ref|XP_002551959.1|  KLTH0B03916p                                       183   1e-52   
ref|XP_001796354.1|  hypothetical protein SNOG_05965                    183   2e-52   
ref|XP_001257952.1|  thiazole biosynthesis enzyme                       183   2e-52   
ref|XP_003842741.1|  similar to thiazole biosynthetic enzyme            183   2e-52   
ref|XP_007713209.1|  hypothetical protein COCCADRAFT_27023              183   2e-52   
ref|XP_009844134.1|  thiazole biosynthesis enzyme, variant 2            181   2e-52   
gb|EGA62236.1|  Thi4p                                                   181   2e-52   
gb|EMD85953.1|  hypothetical protein COCHEDRAFT_1160889                 183   2e-52   
ref|XP_001267966.1|  thiazole biosynthesis enzyme                       183   2e-52   
gb|AGT99181.1|  thiazole biosynthetic enzyme                            182   3e-52   
gb|KIW54196.1|  thiamine thiazole synthase                              182   3e-52   
ref|XP_003665159.1|  hypothetical protein MYCTH_2315910                 182   3e-52   
gb|AJR77233.1|  Thi4p                                                   182   3e-52   
gb|EDN61733.1|  thiamine metabolism-related protein                     182   3e-52   
pdb|3FPZ|A  Chain A, Saccharomyces Cerevisiae Thi4p Is A Suicide ...    182   3e-52   
ref|NP_011660.1|  thiamine thiazole synthase                            182   3e-52   
gb|KFX98431.1|  hypothetical protein O988_04337                         182   4e-52   
gb|KEQ99790.1|  hypothetical protein AUEXF2481DRAFT_35726               182   5e-52   
ref|XP_003066032.1|  thiazole biosynthetic enzyme, mitochondrial ...    182   5e-52   
ref|XP_001247344.1|  thiazole biosynthetic enzyme, mitochondrial ...    182   5e-52   
gb|EFW21941.1|  thiazole biosynthetic enzyme                            182   5e-52   
gb|KIW68442.1|  thiamine thiazole synthase                              182   6e-52   
gb|KFY08103.1|  hypothetical protein V492_06538                         181   7e-52   
gb|KFY84898.1|  hypothetical protein V500_08902                         181   7e-52   
gb|KFZ11494.1|  hypothetical protein V502_07520                         182   7e-52   
ref|XP_003647237.1|  hypothetical protein Ecym_6012                     181   8e-52   
ref|XP_001647032.1|  hypothetical protein Kpol_1050p31                  181   8e-52   
ref|XP_007289177.1|  thiazole biosynthetic enzyme                       181   8e-52   
gb|KFY24905.1|  hypothetical protein V493_04960                         181   8e-52   
ref|XP_001227644.1|  thiazole biosynthetic enzyme, mitochondrial ...    181   9e-52   
ref|XP_001589094.1|  thiazole biosynthetic enzyme                       181   9e-52   
gb|KFZ09843.1|  hypothetical protein V501_05470                         181   9e-52   
gb|EWH18379.1|  Thi4p                                                   181   9e-52   
gb|KFY94986.1|  hypothetical protein V498_03597                         181   1e-51   
gb|KFY43107.1|  hypothetical protein V494_02101                         181   1e-51   
gb|KFY70117.1|  hypothetical protein V499_09439                         181   1e-51   
ref|XP_002498498.1|  ZYRO0G11726p                                       181   1e-51   
emb|CCE44732.1|  hypothetical protein CPAR2_405360                      181   1e-51   
gb|KFY20175.1|  hypothetical protein V491_03934                         181   1e-51   
ref|XP_002842761.1|  thiazole biosynthetic enzyme                       181   1e-51   
ref|XP_004179275.1|  hypothetical protein TBLA_0B09390                  181   1e-51   
ref|XP_004181884.1|  hypothetical protein TBLA_0H00760                  181   1e-51   
ref|XP_449395.1|  hypothetical protein                                  180   2e-51   
emb|CAY79903.1|  Thi4p                                                  180   2e-51   
gb|KIN04678.1|  hypothetical protein OIDMADRAFT_17638                   180   2e-51   
ref|XP_001549602.1|  thiazole biosynthetic enzyme                       180   2e-51   
ref|XP_007586590.1|  putative thiazole biosynthetic enzyme protein      180   2e-51   
gb|AJP38917.1|  Thi4p                                                   180   2e-51   
gb|EGA78748.1|  Thi4p                                                   181   2e-51   
gb|KGO43516.1|  Thiazole biosynthetic enzyme Thi4 family                180   2e-51   
gb|EKV04849.1|  Thiazole biosynthesis enzyme                            180   3e-51   
gb|ELR08851.1|  thiazole biosynthetic enzyme, mitochondrial             180   3e-51   
ref|XP_001526313.1|  hypothetical protein LELG_02871                    181   3e-51   
dbj|GAD93648.1|  thiazole biosynthetic enzyme                           180   3e-51   
ref|XP_010759569.1|  thiazole biosynthetic enzyme, mitochondrial        180   3e-51   
gb|EEH19379.2|  thiazole biosynthetic enzyme, mitochondrial             180   4e-51   
ref|XP_003005955.1|  STI35 protein                                      179   4e-51   
ref|XP_002797266.1|  thiazole biosynthesis enzyme                       179   4e-51   
gb|KEQ70131.1|  putative thiazole synthase THI4_ASPOR thiazole bi...    179   4e-51   
gb|EFW98890.1|  thiazole biosynthetic enzyme                            179   4e-51   
gb|EGD98433.1|  Thi4 family protein                                     179   5e-51   
ref|XP_003169195.1|  thiazole biosynthesis enzyme                       179   5e-51   
gb|EPS32049.1|  hypothetical protein PDE_07008                          179   5e-51   
ref|XP_001935439.1|  thiazole biosynthesis enzyme                       179   5e-51   
ref|XP_003013828.1|  hypothetical protein ARB_07940                     179   6e-51   
ref|XP_008714161.1|  thiazole biosynthetic enzyme, mitochondrial        179   6e-51   
gb|EZF72777.1|  thiazole biosynthetic enzyme, mitochondrial             179   6e-51   
ref|XP_003235740.1|  Thi4 family protein                                179   6e-51   
ref|XP_002564812.1|  Pc22g07960                                         179   6e-51   
gb|ESZ95478.1|  thiazole biosynthetic enzyme                            179   9e-51   
emb|CDM36407.1|  Thiazole biosynthetic enzyme, mitochondrial            181   9e-51   
gb|ABQ23424.1|  thiazole biosynthetic enzyme                            179   9e-51   
gb|EQL00755.1|  thiazole biosynthetic enzyme variant 1                  178   9e-51   
gb|KDB24510.1|  thiazole biosynthetic enzyme, mitochondrial             179   9e-51   
emb|CDG58547.1|  Thi4 protein                                           179   1e-50   
emb|CDG58548.1|  Thi4-1 protein                                         179   1e-50   
emb|CDG58549.1|  Thi4-2 protein                                         179   1e-50   
gb|EEH38204.2|  thiazole biosynthesis enzyme                            179   1e-50   
gb|EPE04284.1|  thiazole biosynthetic enzyme                            179   1e-50   
gb|KEQ82031.1|  Thi4-domain-containing protein                          178   2e-50   
gb|EGA86663.1|  Thi4p                                                   178   2e-50   
ref|XP_009648318.1|  STI35 protein                                      177   2e-50   
gb|EHL02685.1|  putative Thiazole biosynthetic enzyme, mitochondrial    177   2e-50   
dbj|GAM85562.1|  hypothetical protein ANO11243_035690                   177   2e-50   
ref|XP_008087498.1|  FAD/NAD(P)-binding protein                         177   2e-50   
ref|XP_003320392.1|  thiazole biosynthetic enzyme, mitochondrial        177   2e-50   
ref|XP_007416429.1|  hypothetical protein MELLADRAFT_53832              177   2e-50   
gb|KDN47179.1|  putative Thiamin biosynthetic enzyme                    177   3e-50   
emb|CEP62770.1|  LALA0S06e03400g1_1                                     177   4e-50   
emb|CDG58546.1|  Thi4 protein                                           177   4e-50   
gb|KDN34978.1|  hypothetical protein RSAG8_11984                        177   4e-50   
ref|XP_009228164.1|  thiazole biosynthetic enzyme                       177   4e-50   
gb|KGO71577.1|  Thiazole biosynthetic enzyme Thi4 family                177   5e-50   
gb|EUC66166.1|  thiamine thiazole synthase                              176   5e-50   
gb|ESW99744.1|  Thiamine thiazole synthase                              176   5e-50   
gb|ERT00649.1|  thiazole biosynthetic enzyme, mitochondrial             177   7e-50   
ref|XP_001538310.1|  hypothetical protein HCAG_05915                    176   7e-50   
sp|C0NSF3.2|THI4_AJECG  RecName: Full=Thiamine thiazole synthase;...    176   7e-50   
ref|XP_003676118.1|  hypothetical protein NCAS_0D01750                  176   8e-50   
emb|CDF87469.1|  BN860_07074g1_1                                        176   8e-50   
emb|CDH15474.1|  probable Thiamine thiazole synthase                    176   9e-50   
emb|CDO93401.1|  unnamed protein product                                176   9e-50   
gb|EER41684.1|  thiazole biosynthetic enzyme                            176   9e-50   
gb|EEH05819.1|  thiazole biosynthetic enzyme                            176   1e-49   
gb|KIH92073.1|  thiamine biosynthetic enzyme                            176   1e-49   
ref|XP_003669189.1|  hypothetical protein NDAI_0C02860                  176   1e-49   
ref|XP_003851349.1|  hypothetical protein MYCGRDRAFT_44262              175   2e-49   
emb|CCO32846.1|  Thiamine thiazole synthase AltName: Full=Stress-...    175   2e-49   
ref|XP_002626178.1|  thiazole biosynthesis enzyme                       174   3e-49   
gb|EEQ92538.1|  thiazole biosynthesis enzyme                            174   3e-49   
ref|XP_002541542.1|  thiazole biosynthesis enzyme                       174   4e-49   
ref|XP_003654402.1|  hypothetical protein THITE_2117402                 174   6e-49   
gb|ELQ36693.1|  hypothetical protein OOU_Y34scaffold00646g4             173   6e-49   
gb|EMF12655.1|  thiazole biosynthetic enzyme, mitochondrial             174   7e-49   
ref|XP_451008.1|  hypothetical protein                                  173   7e-49   
ref|XP_003720575.1|  thiazole biosynthetic enzyme                       173   9e-49   
gb|KFA66874.1|  hypothetical protein S40285_02303                       173   1e-48   
sp|Q9UVF8.1|THI4_UROFA  RecName: Full=Thiamine thiazole synthase;...    173   1e-48   
dbj|BAO40649.1|  thiazole biosynthetic enzyme                           173   1e-48   
ref|XP_002492875.1|  Thiazole synthase, catalyzes formation of th...    173   2e-48   
gb|KFX95262.1|  hypothetical protein V490_03958                         181   2e-48   
gb|KFY37341.1|  hypothetical protein V495_07232                         181   2e-48   
emb|CDI56388.1|  probable Thiamin biosynthetic enzyme                   172   2e-48   
gb|KIJ50951.1|  hypothetical protein M422DRAFT_101777                   167   2e-48   
ref|XP_007928692.1|  hypothetical protein MYCFIDRAFT_211863             172   3e-48   
dbj|GAK64104.1|  thi4-domain-containing protein                         172   4e-48   
gb|EIF46156.1|  thiazole biosynthetic enzyme                            172   4e-48   
dbj|GAC98786.1|  flavin-binding monooxygenase-like                      172   4e-48   
gb|KCW75370.1|  hypothetical protein EUGRSUZ_E04118                     169   5e-48   
gb|KFY50717.1|  hypothetical protein V496_09214                         180   5e-48   
emb|CCX30406.1|  Similar to Thiamine thiazole synthase; acc. no. ...    171   6e-48   
emb|CCF51739.1|  probable Thiamin biosynthetic enzyme                   171   7e-48   
dbj|GAC72397.1|  hypothetical protein PANT_7d00078                      171   7e-48   
gb|KEY67925.1|  hypothetical protein S7711_02133                        171   7e-48   
gb|ETS60793.1|  hypothetical protein PaG_04705                          171   7e-48   
emb|CBI23938.3|  unnamed protein product                                167   8e-48   
ref|XP_007672530.1|  hypothetical protein BAUCODRAFT_62660              171   8e-48   
gb|EME42084.1|  hypothetical protein DOTSEDRAFT_73000                   171   9e-48   
gb|KGK37032.1|  hypothetical protein JL09_g3847                         171   1e-47   
gb|EST05805.1|  flavin-binding monooxygenase-like                       171   1e-47   
gb|KJA21255.1|  hypothetical protein HYPSUDRAFT_42403                   170   1e-47   
ref|XP_009269436.1|  Thiamine thiazole synthase                         169   3e-47   
emb|CBQ71006.1|  probable Thiamin biosynthetic enzyme                   169   5e-47   
ref|XP_006957782.1|  Thi4-domain-containing protein                     169   5e-47   
ref|XP_007882083.1|  hypothetical protein PFL1_06351                    168   1e-46   
ref|XP_007351669.1|  thiazole biosynthetic enzyme                       167   2e-46   
ref|XP_001835983.2|  thiazole biosynthetic enzyme                       166   3e-46   
ref|XP_011388856.1|  putative Thiamin biosynthetic enzyme               167   3e-46   
gb|AGB85035.1|  thiamine biosynthesis thi4 protein                      166   4e-46   
ref|XP_006462581.1|  hypothetical protein AGABI2DRAFT_72787             166   4e-46   
sp|Q4PC85.1|THI4_USTMA  RecName: Full=Thiamine thiazole synthase;...    167   5e-46   
gb|KIJ24322.1|  hypothetical protein M422DRAFT_274931                   166   6e-46   
ref|XP_007271222.1|  thiazole biosynthetic enzyme                       166   9e-46   
gb|EJT96874.1|  thiazole biosynthetic enzyme                            165   1e-45   
ref|XP_003683988.1|  hypothetical protein TPHA_0A04790                  165   2e-45   
gb|KDQ62341.1|  hypothetical protein JAAARDRAFT_170661                  165   2e-45   
gb|ELQ63963.1|  hypothetical protein OOW_P131scaffold00904g6            172   2e-45   
ref|XP_003034505.1|  hypothetical protein SCHCODRAFT_84820              164   2e-45   
ref|XP_001731131.1|  hypothetical protein MGL_1314                      164   3e-45   
emb|CCV00434.1|  unnamed protein product                                164   4e-45   
ref|XP_003683090.1|  hypothetical protein TDEL_0H00200                  164   4e-45   
gb|KIO02829.1|  hypothetical protein M404DRAFT_27718                    163   5e-45   
ref|XP_007866883.1|  Thi4-domain-containing protein                     163   7e-45   
gb|EGU11956.1|  Thiazole biosynthetic enzyme                            164   9e-45   
gb|EMS18749.1|  thiamine biosynthetic enzyme                            164   1e-44   
gb|KIL63207.1|  hypothetical protein M378DRAFT_79929                    162   2e-44   
ref|XP_007319542.1|  hypothetical protein SERLADRAFT_470126             162   2e-44   
gb|KIP06210.1|  hypothetical protein PHLGIDRAFT_468135                  161   3e-44   
gb|KIM86133.1|  hypothetical protein PILCRDRAFT_816673                  161   5e-44   
gb|KIM43217.1|  hypothetical protein M413DRAFT_444027                   160   5e-44   
ref|XP_008037799.1|  Thi4-domain-containing protein                     160   8e-44   
gb|KIK52064.1|  hypothetical protein GYMLUDRAFT_50135                   160   9e-44   
ref|XP_007399642.1|  hypothetical protein PHACADRAFT_177254             160   1e-43   
gb|KIM63333.1|  hypothetical protein SCLCIDRAFT_752494                  159   2e-43   
ref|XP_007304939.1|  Thi4-domain-containing protein                     159   2e-43   
gb|KII90613.1|  hypothetical protein PLICRDRAFT_538929                  159   4e-43   
gb|EPT05287.1|  hypothetical protein FOMPIDRAFT_1112158                 158   4e-43   
gb|KIY62047.1|  thiazole biosynthetic enzyme                            158   4e-43   
gb|KIY43384.1|  Thi4-domain-containing protein                          158   6e-43   
emb|CCM00650.1|  predicted protein                                      157   9e-43   
gb|ACZ34282.1|  thiazole synthase                                       157   1e-42   
gb|EMD39842.1|  hypothetical protein CERSUDRAFT_112109                  157   1e-42   
gb|KIJ17836.1|  hypothetical protein PAXINDRAFT_9774                    156   2e-42   
ref|XP_007768494.1|  Thi4-domain-containing protein                     157   2e-42   
gb|KIJ62636.1|  hypothetical protein HYDPIDRAFT_94083                   156   2e-42   
gb|KFX46359.1|  Thiamine thiazole synthase                              155   4e-42   
gb|KIK99865.1|  hypothetical protein PAXRUDRAFT_822318                  155   4e-42   
ref|XP_007380545.1|  thiazole biosynthetic enzyme                       155   6e-42   
ref|XP_007364009.1|  Thi4-domain-containing protein                     155   8e-42   
gb|KDQ25745.1|  hypothetical protein PLEOSDRAFT_1057999                 154   1e-41   
ref|XP_007853538.1|  thiazole biosynthetic enzyme                       155   1e-41   
ref|XP_009546328.1|  hypothetical protein HETIRDRAFT_440039             156   2e-41   
ref|XP_008336996.1|  PREDICTED: thiamine thiazole synthase, chlor...    144   2e-39   
emb|CDK26023.1|  unnamed protein product                                147   3e-39   
emb|CCJ09780.1|  putative thiazole biosynthetic enzyme                  146   4e-39   
gb|AEO13833.1|  thiazole biosynthetic protein                           142   7e-39   
ref|XP_007277744.1|  thiazole biosynthetic enzyme                       144   3e-38   
gb|KDR82811.1|  hypothetical protein GALMADRAFT_238371                  142   2e-37   
ref|XP_011397717.1|  Thiamine thiazole synthase, chloroplastic          135   7e-34   
gb|ACN36998.1|  unknown                                                 125   2e-31   
gb|EKG16915.1|  Thiamine biosynthesis Thi4 protein                      125   3e-31   
gb|AFG52195.1|  hypothetical protein UMN_CL97Contig1_06                 114   4e-29   
gb|AEW09378.1|  hypothetical protein UMN_CL97Contig1_06                 114   8e-29   
ref|WP_043641419.1|  hypothetical protein                               111   4e-26   
ref|XP_001754158.1|  predicted protein                                  111   4e-26   
gb|ELU45290.1|  thiazole biosynthetic enzyme                            116   9e-26   
ref|XP_003344754.1|  hypothetical protein SMAC_06409                    100   2e-21   



>ref|XP_011086171.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=353

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +2

Query  188  QAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            Q ++A+ H NLSV+ S  PY+LD+FKF PIKESIV+REMTRRYMTDMI YADTDV+VVGA
Sbjct  35   QPIRATPH-NLSVTMSSAPYNLDNFKFHPIKESIVSREMTRRYMTDMITYADTDVVVVGA  93

Query  368  GSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            GSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+
Sbjct  94   GSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELEIEYD  153

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            E D+YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  154  EQDDYVVIKHAALFTSTIMSKLLARPNVKLFNA  186



>emb|CDO99712.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   271 bits (693),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 143/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  185  VQAVKASSHH-NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            VQ VK+S  + ++++SAS   Y+ D+FKFQPI+ESIV+REMTRRYMTDMI YADTDV+VV
Sbjct  32   VQPVKSSPQNFSVTMSASTPQYNFDAFKFQPIQESIVSREMTRRYMTDMITYADTDVVVV  91

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELEVE
Sbjct  92   GAGSAGLSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHKFLDELEVE  151

Query  542  YEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  152  YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  186



>gb|KDO52969.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=321

 Score =   270 bits (690),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            +Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+REMTRRYMTDMI YADTDV+VV
Sbjct  37   LQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVV  96

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL ++
Sbjct  97   GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGID  156

Query  542  YEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  157  YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  191



>ref|XP_006452193.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
 gb|ESR65433.1| hypothetical protein CICLE_v10008765mg [Citrus clementina]
Length=356

 Score =   271 bits (692),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            +Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+REMTRRYMTDMI YADTDV+VV
Sbjct  37   LQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVV  96

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL ++
Sbjct  97   GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGID  156

Query  542  YEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  157  YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  191



>ref|NP_001275783.1| thiamine thiazole synthase, chloroplastic [Citrus sinensis]
 sp|O23787.1|THI4_CITSI RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Citrus 
sinensis]
 emb|CAB05370.1| thi [Citrus sinensis]
Length=356

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            +Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+REMTRRYMTDMI YADTDV+VV
Sbjct  37   LQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVV  96

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL ++
Sbjct  97   GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGID  156

Query  542  YEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  157  YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  191



>gb|KDO52968.1| hypothetical protein CISIN_1g018414mg [Citrus sinensis]
Length=356

 Score =   271 bits (692),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 144/155 (93%), Gaps = 1/155 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            +Q +K+S  +NLS+SAS +P Y L++FKF PIKESIV+REMTRRYMTDMI YADTDV+VV
Sbjct  37   LQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSREMTRRYMTDMITYADTDVVVV  96

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SKNPN+++AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL ++
Sbjct  97   GAGSAGLSCAYELSKNPNIQIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGID  156

Query  542  YEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  157  YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  191



>gb|EYU33910.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
 gb|EYU33911.1| hypothetical protein MIMGU_mgv1a009148mg [Erythranthe guttata]
Length=351

 Score =   270 bits (689),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 141/153 (92%), Gaps = 1/153 (1%)
 Frame = +2

Query  188  QAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            Q +K S+  NL+V+ + TPY+LD FKFQPIKESIVAREMTRRYMTDMI YADTDV+VVGA
Sbjct  36   QPIK-STPKNLAVAMASTPYNLDDFKFQPIKESIVAREMTRRYMTDMITYADTDVVVVGA  94

Query  368  GSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            GSAGLSCAYE+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+
Sbjct  95   GSAGLSCAYELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHKFLDELEIEYD  154

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            E D+YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  155  EQDHYVVIKHAALFTSTIMSKLLARPNVKLFNA  187



>ref|XP_011096106.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Sesamum 
indicum]
Length=354

 Score =   267 bits (683),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 142/156 (91%), Gaps = 2/156 (1%)
 Frame = +2

Query  182  CVQAVKASSHHNLSVSASHT-PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIV  358
             VQ +K S+  +L+++ S   PY+LD+FKFQPIKESIV+REMTRRYMTDMI YADTDV+V
Sbjct  33   AVQPIK-SAPQSLAITMSAAAPYNLDNFKFQPIKESIVSREMTRRYMTDMITYADTDVVV  91

Query  359  VGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VGAGSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELEV
Sbjct  92   VGAGSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHKFLDELEV  151

Query  539  EYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EY+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  152  EYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  187



>gb|ABI84250.1| thiamine biosynthetic enzyme [Arachis hypogaea]
Length=201

 Score =   260 bits (665),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
             +S+S +  PY L SFKFQPIKESIVAREMTRRYMTDMI YADTDVIVVGAGSAGLSCAY
Sbjct  42   TISMSMATPPYDLQSFKFQPIKESIVAREMTRRYMTDMITYADTDVIVVGAGSAGLSCAY  101

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            E+SKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELEV Y+E ++YVVIK
Sbjct  102  ELSKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELEVAYDEQEDYVVIK  161

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNV LFNA
Sbjct  162  HAALFTSTIMSKLLARPNVNLFNA  185



>ref|XP_002317206.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
 gb|EEE97818.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa]
Length=350

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +S+S +   Y L SFKFQPIKESIV+REMTRRYMTDM+ YADTDV++VGAGSAGL
Sbjct  40   STSPAISMSLTQPSYDLQSFKFQPIKESIVSREMTRRYMTDMVTYADTDVVIVGAGSAGL  99

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
            SCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFSAM+VRKPA  FLDELE+EY+EADNY
Sbjct  100  SCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDELEIEYDEADNY  159

Query  563  VVIKHAALFTSTIMSKLLARPNVKLFNA  646
            VVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  VVIKHAALFTSTIMSKLLARPNVKLFNA  187



>ref|XP_002305603.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
 gb|ABK94925.1| unknown [Populus trichocarpa]
 gb|EEE86114.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa]
Length=350

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +++S +   Y L SFKFQPIKESIV+REMTRRYMTDM+ YADTDV+VVGAGSAGL
Sbjct  40   STSPAITMSLTQPSYDLQSFKFQPIKESIVSREMTRRYMTDMVTYADTDVVVVGAGSAGL  99

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
            SCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFSAM+VRKPA  FLDELE+EY+EADNY
Sbjct  100  SCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDELEIEYDEADNY  159

Query  563  VVIKHAALFTSTIMSKLLARPNVKLFNA  646
            VVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  VVIKHAALFTSTIMSKLLARPNVKLFNA  187



>ref|XP_011037712.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 136/148 (92%), Gaps = 0/148 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +++S +   Y L SFKFQPIKESIV+REMTRRYMTDM+ YADTDV++VGAGSAGL
Sbjct  40   STSSAITMSLAQPSYDLQSFKFQPIKESIVSREMTRRYMTDMVTYADTDVVIVGAGSAGL  99

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
            SCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFSAM+VRKPA  FLDELE+EY+EADNY
Sbjct  100  SCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDELEIEYDEADNY  159

Query  563  VVIKHAALFTSTIMSKLLARPNVKLFNA  646
            VVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  VVIKHAALFTSTIMSKLLARPNVKLFNA  187



>ref|XP_008463440.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Cucumis 
melo]
Length=359

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            A++   +S SAS  PY L+ FKF PI+ESIV+REMTRRYMTDMI YADTDVI+VGAGSAG
Sbjct  40   AATSLTISASASQPPYDLNQFKFNPIRESIVSREMTRRYMTDMITYADTDVIIVGAGSAG  99

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADN  559
            LSCAYE+SKNPN+R+AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VEY+E D+
Sbjct  100  LSCAYELSKNPNIRIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEVGVEYDEQDD  159

Query  560  YVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  YVVIKHAALFTSTIMSKLLARPNVKLFNA  188



>ref|XP_004152916.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004172748.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN56149.1| hypothetical protein Csa_3G078800 [Cucumis sativus]
Length=359

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            A++   +S SAS  PY L+ FKF PI+ESIV+REMTRRYMTDMI YADTDV++VGAGSAG
Sbjct  40   AATSLTISASASQPPYDLNQFKFNPIRESIVSREMTRRYMTDMITYADTDVVIVGAGSAG  99

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADN  559
            LSCAYE+SKNPN+R+AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VEY+E D+
Sbjct  100  LSCAYELSKNPNIRIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEVGVEYDEQDD  159

Query  560  YVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  YVVIKHAALFTSTIMSKLLARPNVKLFNA  188



>ref|XP_010267751.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Nelumbo 
nucifera]
Length=356

 Score =   262 bits (670),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 138/149 (93%), Gaps = 1/149 (1%)
 Frame = +2

Query  203  SSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            SS  +LS+S S TP Y L SFKF+PI+ESIV+REMTRRYM DMI YADTDV++VGAGSAG
Sbjct  41   SSPQSLSISMSSTPPYDLQSFKFEPIRESIVSREMTRRYMMDMITYADTDVVIVGAGSAG  100

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADN  559
            LSCAYE+SKNP+VRVAIIEQSVSPGGG+WLGGQLFSAMVVRKPAQ+FLDEL +EY+E +N
Sbjct  101  LSCAYELSKNPSVRVAIIEQSVSPGGGSWLGGQLFSAMVVRKPAQLFLDELGIEYDEQEN  160

Query  560  YVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  161  YVVIKHAALFTSTIMSKLLARPNVKLFNA  189



>ref|XP_006449089.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
 gb|ESR62329.1| hypothetical protein CICLE_v10015727mg [Citrus clementina]
Length=359

 Score =   261 bits (667),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = +2

Query  185  VQAVKASSHHNL-SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIV  358
            V  +++SS     ++S S TP Y  +SF F PIKESIV+REMTRRYMTDM+ YADTDVIV
Sbjct  37   VTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSREMTRRYMTDMVTYADTDVIV  96

Query  359  VGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VGAGSAGLSCAYEISKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQ+FLDEL V
Sbjct  97   VGAGSAGLSCAYEISKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQIFLDELGV  156

Query  539  EYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EY+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  157  EYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  192



>ref|XP_004496776.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Cicer 
arietinum]
Length=350

 Score =   260 bits (664),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 139/153 (91%), Gaps = 2/153 (1%)
 Frame = +2

Query  194  VKASSHHNLSVSASHT--PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            +K++SH+  SVS S    PY L SFKFQPIKESIV+REMTRRYMTDMI YADTDV++VGA
Sbjct  32   IKSTSHNYSSVSMSLNTPPYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTDVVIVGA  91

Query  368  GSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            GSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V+Y+
Sbjct  92   GSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVDYD  151

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            E ++YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  152  EQEDYVVIKHAALFTSTIMSKLLARPNVKLFNA  184



>ref|XP_002267414.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Vitis 
vinifera]
 sp|F6H7K5.1|THI42_VITVI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Vitis vinifera]
Length=355

 Score =   259 bits (662),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +2

Query  206  SHHNLSVSASH-TPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            SH + ++S S  +PY L SFKF+PIKESIVAREMTRRYM DMI YADTDV++VGAGSAGL
Sbjct  41   SHQSPTISMSSVSPYDLQSFKFEPIKESIVAREMTRRYMMDMITYADTDVVIVGAGSAGL  100

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
            SCAYE+SKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +EY+E DNY
Sbjct  101  SCAYELSKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELGIEYDEQDNY  160

Query  563  VVIKHAALFTSTIMSKLLARPNVKLFNA  646
            VVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  161  VVIKHAALFTSTIMSKLLARPNVKLFNA  188



>gb|KJB67127.1| hypothetical protein B456_010G176000 [Gossypium raimondii]
Length=356

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = +2

Query  203  SSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            SS HN ++S S TP Y L SF+FQPIKES V+REMTRRYM DMI YADTDVI+VGAGSAG
Sbjct  41   SSSHNSAISMSLTPPYDLQSFEFQPIKESYVSREMTRRYMMDMITYADTDVIIVGAGSAG  100

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADN  559
            LSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL ++Y+E ++
Sbjct  101  LSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIQYDEQED  160

Query  560  YVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  161  YVVIKHAALFTSTIMSKLLARPNVKLFNA  189



>ref|XP_011000691.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Populus 
euphratica]
Length=350

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 134/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +S+S +       SFKFQPIKESIV+REMTRRYMTDM+ YADTDV++VGAGSAGL
Sbjct  40   STSPAISMSLTQPSCDFQSFKFQPIKESIVSREMTRRYMTDMVTYADTDVVIVGAGSAGL  99

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
            SCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQLFSAM+VRKPA  FLDELE+EY+EADNY
Sbjct  100  SCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDELEIEYDEADNY  159

Query  563  VVIKHAALFTSTIMSKLLARPNVKLFNA  646
            VVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  VVIKHAALFTSTIMSKLLARPNVKLFNA  187



>gb|KHG29710.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=356

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/149 (83%), Positives = 135/149 (91%), Gaps = 1/149 (1%)
 Frame = +2

Query  203  SSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            SS HN ++S S TP Y L SFKFQPIKES V+REMTRRYM D+I YADTDVI+VGAGSAG
Sbjct  41   SSSHNSAISMSLTPPYDLQSFKFQPIKESYVSREMTRRYMMDIITYADTDVIIVGAGSAG  100

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADN  559
            LSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL ++Y+E ++
Sbjct  101  LSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIQYDEQED  160

Query  560  YVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  161  YVVIKHAALFTSTIMSKLLARPNVKLFNA  189



>ref|XP_006467989.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Citrus 
sinensis]
 gb|KDO75540.1| hypothetical protein CISIN_1g018188mg [Citrus sinensis]
Length=359

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 138/156 (88%), Gaps = 2/156 (1%)
 Frame = +2

Query  185  VQAVKASSHHNL-SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIV  358
            V  +++SS     ++S S TP Y  +SF F PIKESIV+REMTRRYMTDM+ YADTDVIV
Sbjct  37   VTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSREMTRRYMTDMVTYADTDVIV  96

Query  359  VGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VGAGSAGLSCAYEISKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQ FLDEL V
Sbjct  97   VGAGSAGLSCAYEISKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQRFLDELGV  156

Query  539  EYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EY+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  157  EYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  192



>ref|XP_002281769.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Vitis 
vinifera]
 sp|F6H9A9.1|THI41_VITVI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Vitis vinifera]
Length=353

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            NL+V+A+  PY L SFKF+PIKESIV+REMTRRYM DMI YADTDV+VVGAGSAGLSCAY
Sbjct  44   NLAVTAAAMPYDLRSFKFEPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSAGLSCAY  103

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            E+SKNP+V+VAIIEQSVSPGGGAWLGGQLFS+MVVRKPA  FLDEL +EY+E DNYVVIK
Sbjct  104  ELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSSMVVRKPAHRFLDELGLEYDEQDNYVVIK  163

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNVKLFNA
Sbjct  164  HAALFTSTIMSKLLARPNVKLFNA  187



>ref|XP_004244150.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Solanum 
lycopersicum]
Length=354

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  SSHHNLSVSAS---HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            S+  N+SVS S     PY L SF F PIKESIVAREMTRRYMTDMI YADTDV++VGAGS
Sbjct  39   STPQNMSVSMSADASPPYDLGSFSFNPIKESIVAREMTRRYMTDMITYADTDVVIVGAGS  98

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEA  553
            AGLSCAYE+SKNPNV+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++Y+E 
Sbjct  99   AGLSCAYELSKNPNVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEQ  158

Query  554  DNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  159  DNYVVIKHAALFTSTIMSKLLARPNVKLFNA  189



>ref|XP_010105570.1| Thiamine thiazole synthase 2 [Morus notabilis]
 gb|EXC05099.1| Thiamine thiazole synthase 2 [Morus notabilis]
Length=353

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 140/155 (90%), Gaps = 1/155 (1%)
 Frame = +2

Query  182  CVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            C++   A +  ++S+SA+  PY L +F+F+PIKESIV+REMTRRYM DMI YADTDV+VV
Sbjct  34   CLRLQPAKAGFSVSMSAA-APYDLKNFRFEPIKESIVSREMTRRYMMDMITYADTDVVVV  92

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +E
Sbjct  93   GAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIE  152

Query  542  YEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  153  YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  187



>ref|XP_010545204.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Tarenaya 
hassleriana]
Length=359

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S  +S  PY L++F+F PIKESIV+REMTRRYMTDMI YA+TDV++VGAGSAGLSCAYEI
Sbjct  52   SAESSSPPYDLNNFRFSPIKESIVSREMTRRYMTDMITYAETDVVIVGAGSAGLSCAYEI  111

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SKNPNV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL++EY+E D+YVVIKHA
Sbjct  112  SKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHMFLDELDIEYDEQDDYVVIKHA  171

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTSTIMSKLLARPNVKLFNA
Sbjct  172  ALFTSTIMSKLLARPNVKLFNA  193



>gb|AFM35683.1| thiamin biosynthetic protein [Vitis pseudoreticulata]
Length=355

 Score =   258 bits (659),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +2

Query  206  SHHNLSVS-ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            SH + ++S +S +PY L SFKF+PIKESIVAREMTRRYM DMI YADTDV++VGAGSAGL
Sbjct  41   SHQSPTISMSSASPYDLQSFKFEPIKESIVAREMTRRYMMDMITYADTDVVIVGAGSAGL  100

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
            SCAYE+SKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +EY+E DNY
Sbjct  101  SCAYELSKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELGIEYDEQDNY  160

Query  563  VVIKHAALFTSTIMSKLLARPNVKLFNA  646
            VVIKHAALFTSTIMSKLLARPNVKL NA
Sbjct  161  VVIKHAALFTSTIMSKLLARPNVKLLNA  188



>gb|KJB57702.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=304

 Score =   256 bits (654),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  203  SSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            SS    ++S S TP Y L SFKFQPIKES VAREMTRRYM DMI YADTDVI+VGAGSAG
Sbjct  40   SSSQTATISMSLTPPYDLQSFKFQPIKESYVAREMTRRYMMDMITYADTDVIIVGAGSAG  99

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADN  559
            LSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL ++Y+E ++
Sbjct  100  LSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIQYDEQED  159

Query  560  YVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            YVVIKHAALFTST+MSKLLARPNVKLFNA
Sbjct  160  YVVIKHAALFTSTVMSKLLARPNVKLFNA  188



>ref|XP_007213805.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
 gb|EMJ15004.1| hypothetical protein PRUPE_ppa007657mg [Prunus persica]
Length=360

 Score =   258 bits (658),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 139/157 (89%), Gaps = 4/157 (3%)
 Frame = +2

Query  188  QAVKASSHHNLSVSAS---HTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVI  355
            +A   S++H LSVS S    TP Y L +FKF PIKESIV+REMTRRYMTDMI YADTDV+
Sbjct  39   KAATNSNNHGLSVSMSANGSTPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADTDVV  98

Query  356  VVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELE  535
            VVGAGSAGLSCAYE+SKNPNV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL 
Sbjct  99   VVGAGSAGLSCAYELSKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELG  158

Query  536  VEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            + Y+E D+YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  159  IAYDEKDHYVVIKHAALFTSTIMSKLLARPNVKLFNA  195



>gb|AAP03875.1| putative chloroplast thiazole biosynthetic protein [Nicotiana 
tabacum]
Length=358

 Score =   257 bits (657),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 137/152 (90%), Gaps = 4/152 (3%)
 Frame = +2

Query  203  SSHHNLSVS----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            S+  N+++S    +S  PY L++F F PIKESIV+REMTRRYMTDMI YADTDV++VGAG
Sbjct  42   SAQQNMTISMSADSSPPPYDLNAFSFNPIKESIVSREMTRRYMTDMITYADTDVVIVGAG  101

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPNV+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++Y+E
Sbjct  102  SAGLSCAYEISKNPNVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDE  161

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  162  QDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  193



>ref|XP_008244366.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Prunus 
mume]
Length=360

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/157 (80%), Positives = 139/157 (89%), Gaps = 4/157 (3%)
 Frame = +2

Query  188  QAVKASSHHNLSVSAS---HTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVI  355
            +A   S++H LSVS S    TP Y L +FKF PIKESIV+REMTRRYMTDMI YADTDV+
Sbjct  39   KAATNSNNHGLSVSMSANGSTPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADTDVV  98

Query  356  VVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELE  535
            VVGAGSAGLSCAYE+SKNPNV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL 
Sbjct  99   VVGAGSAGLSCAYELSKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELG  158

Query  536  VEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            + Y+E D+YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  159  IAYDETDHYVVIKHAALFTSTIMSKLLARPNVKLFNA  195



>ref|XP_009774029.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Nicotiana 
sylvestris]
Length=358

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 137/152 (90%), Gaps = 4/152 (3%)
 Frame = +2

Query  203  SSHHNLSVS----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            S+  N+++S    +S  PY L++F F PIKESIV+REMTRRYMTDMI YADTDV++VGAG
Sbjct  42   SAQQNMTISMSADSSPPPYDLNAFSFNPIKESIVSREMTRRYMTDMITYADTDVVIVGAG  101

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPNV+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++Y+E
Sbjct  102  SAGLSCAYEISKNPNVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDE  161

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  162  QDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  193



>ref|XP_004294669.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=360

 Score =   257 bits (657),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 6/160 (4%)
 Frame = +2

Query  185  VQAVKA--SSHHNLSVS----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            VQ +KA  S+ H LSVS     S + Y L +FKF+PIKESIV+REMTRRYMTDMI YADT
Sbjct  35   VQPLKAATSNGHGLSVSMSAGGSTSAYDLTNFKFEPIKESIVSREMTRRYMTDMITYADT  94

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV+VVGAGSAGLSCAYE+SKNPNV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FL+
Sbjct  95   DVVVVGAGSAGLSCAYELSKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLN  154

Query  527  ELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EL ++Y+E D YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  155  ELGIDYDEKDGYVVIKHAALFTSTIMSKLLARPNVKLFNA  194



>ref|XP_010062976.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic [Eucalyptus 
grandis]
Length=357

 Score =   257 bits (656),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 136/153 (89%), Gaps = 5/153 (3%)
 Frame = +2

Query  203  SSHHNLSVS-----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            SS H+  +S     A+  PY L++F+F PIKESIV+REMTRRYM DMI YADTDV+VVGA
Sbjct  40   SSAHSSGISMSAAAANPPPYDLNAFRFDPIKESIVSREMTRRYMMDMITYADTDVVVVGA  99

Query  368  GSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            GSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+
Sbjct  100  GSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELEIEYD  159

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  EQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  192



>ref|XP_004294348.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 139/156 (89%), Gaps = 2/156 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVS--ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIV  358
            ++A  +S+ H LSVS  AS   Y L +FKF+PIKESIV+REMTRRYMTDMI YADTDV+V
Sbjct  40   LKAASSSNGHGLSVSMSASTNAYDLSNFKFEPIKESIVSREMTRRYMTDMITYADTDVVV  99

Query  359  VGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEV  538
            VGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FL EL +
Sbjct  100  VGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLSELGI  159

Query  539  EYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +Y+E D+YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  DYDEKDDYVVIKHAALFTSTIMSKLLARPNVKLFNA  195



>ref|XP_009590342.1| PREDICTED: thiamine thiazole synthase, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158} 
[Nicotiana tomentosiformis]
Length=359

 Score =   257 bits (657),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 137/152 (90%), Gaps = 4/152 (3%)
 Frame = +2

Query  203  SSHHNLSVS----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            S+  N+++S    +S  PY L++F F PIKESIV+REMTRRYMTDMI YADTDV++VGAG
Sbjct  43   SAQQNMTISMSADSSPPPYDLNAFTFNPIKESIVSREMTRRYMTDMITYADTDVVIVGAG  102

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPNV+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++Y+E
Sbjct  103  SAGLSCAYEISKNPNVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDE  162

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  163  QDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  194



>ref|XP_003536550.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   257 bits (656),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            +S    +S+S +  PY L SFKFQPIKESIV+REMTRRYMTDMI YADTDV++VGAGSAG
Sbjct  37   SSKQGTISMSLTQPPYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAG  96

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADN  559
            LSCAYEISKNP V VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+E ++
Sbjct  97   LSCAYEISKNPAVSVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQED  156

Query  560  YVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            YVVIKHAALFTSTIMS+LLARPNVKLFNA
Sbjct  157  YVVIKHAALFTSTIMSRLLARPNVKLFNA  185



>gb|KJB57700.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
 gb|KJB57701.1| hypothetical protein B456_009G176400 [Gossypium raimondii]
Length=355

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 133/149 (89%), Gaps = 1/149 (1%)
 Frame = +2

Query  203  SSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            SS    ++S S TP Y L SFKFQPIKES VAREMTRRYM DMI YADTDVI+VGAGSAG
Sbjct  40   SSSQTATISMSLTPPYDLQSFKFQPIKESYVAREMTRRYMMDMITYADTDVIIVGAGSAG  99

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADN  559
            LSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL ++Y+E ++
Sbjct  100  LSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIQYDEQED  159

Query  560  YVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            YVVIKHAALFTST+MSKLLARPNVKLFNA
Sbjct  160  YVVIKHAALFTSTVMSKLLARPNVKLFNA  188



>ref|XP_007143207.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
 gb|ESW15201.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris]
Length=355

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            +S    +S+S +  PY L SFKFQPIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAG
Sbjct  41   SSKQPTISMSLTPPPYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAG  100

Query  380  LSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADN  559
            LSCAYE+SKNP V VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V+Y+E ++
Sbjct  101  LSCAYELSKNPAVSVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVDYDEQEH  160

Query  560  YVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  161  YVVIKHAALFTSTIMSKLLARPNVKLFNA  189



>emb|CDY42479.1| BnaA10g08550D [Brassica napus]
Length=258

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  95

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E
Sbjct  96   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVPYDE  155

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  156  QDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  187



>gb|KHG06769.1| Thiamine thiazole synthase 1, chloroplastic [Gossypium arboreum]
Length=357

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 136/151 (90%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  SSHHNLSVS---ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            SSH N S+S   AS  PY  ++F+F PIKESIV+REMTRRYM DMIIYADTDV+VVGAGS
Sbjct  42   SSHCNASISMSAASPPPYDFNNFRFDPIKESIVSREMTRRYMMDMIIYADTDVVVVGAGS  101

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEA  553
            AGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +EY+E 
Sbjct  102  AGLSCAYELSKNPSVQIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELAIEYDEQ  161

Query  554  DNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            D+YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  162  DDYVVIKHAALFTSTIMSKLLARPNVKLFNA  192



>gb|AFK49080.1| unknown [Medicago truncatula]
Length=195

 Score =   250 bits (639),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++FKF PIKESIVAREMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE+SKNPNV++
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPNVKI  113

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+E D+YVVI HAALFTSTIM
Sbjct  114  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELEIEYDEQDDYVVITHAALFTSTIM  173

Query  605  SKLLARPNVKLFNA  646
            SKLLARPNV+LFNA
Sbjct  174  SKLLARPNVRLFNA  187



>ref|XP_007025992.1| Thiazole biosynthetic enzyme [Theobroma cacao]
 gb|EOY28614.1| Thiazole biosynthetic enzyme [Theobroma cacao]
Length=387

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 137/152 (90%), Gaps = 1/152 (1%)
 Frame = +2

Query  194  VKASSHHN-LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            +++SS  + +S+S +  PY L SF FQPIKES VAREMTRRYM DMI YADTDVI+VGAG
Sbjct  69   IRSSSQDSAISMSLNTPPYDLQSFNFQPIKESYVAREMTRRYMMDMITYADTDVIIVGAG  128

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNP++RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL ++Y+E
Sbjct  129  SAGLSCAYEISKNPSIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHIFLDELGIQYDE  188

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             +NYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  189  QENYVVIKHAALFTSTIMSKLLARPNVKLFNA  220



>gb|KDP39066.1| hypothetical protein JCGZ_00823 [Jatropha curcas]
Length=354

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            S+S   Y+L+SF+F PIKESIV+REMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE+SK
Sbjct  52   SSSVPQYNLNSFRFDPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSK  111

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAAL  586
            NP+V+VAI+EQSVSPGGGAWLGGQLFSAM+VRKPA +FLDEL++EY+EADNYVVIKHAAL
Sbjct  112  NPSVKVAIVEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDELDIEYDEADNYVVIKHAAL  171

Query  587  FTSTIMSKLLARPNVKLFNA  646
            FTSTIMSKLLARPNVKLFNA
Sbjct  172  FTSTIMSKLLARPNVKLFNA  191



>ref|XP_009358110.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 6/160 (4%)
 Frame = +2

Query  185  VQAVKASSHHN--LSVSASH---TP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            +Q  KA+  +N  LSVS S    TP Y L +FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  35   LQPAKAAPANNGGLSVSMSANGLTPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADT  94

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+
Sbjct  95   DVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLN  154

Query  527  ELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EL ++Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  155  ELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  194



>gb|EPS63253.1| hypothetical protein M569_11533 [Genlisea aurea]
Length=344

 Score =   254 bits (650),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A+  PY+LD+FKF PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK
Sbjct  40   AAAALPYNLDAFKFNPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSK  99

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAAL  586
            NP+V VA++EQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELEV+Y+E ++YVVIKHAAL
Sbjct  100  NPDVNVALVEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELEVDYDEKEDYVVIKHAAL  159

Query  587  FTSTIMSKLLARPNVKLFNA  646
            FTSTIMS+LLARPNVKLFNA
Sbjct  160  FTSTIMSRLLARPNVKLFNA  179



>ref|XP_003556028.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Glycine 
max]
Length=351

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            + +S    +S+S +  PY L SFKFQPIKESIV+REMTRRYMTDMI YADTDV++VGAGS
Sbjct  35   LSSSKQGTISMSLTPPPYDLQSFKFQPIKESIVSREMTRRYMTDMITYADTDVVIVGAGS  94

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEA  553
            AGLSCAYE+SKNP V VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+E 
Sbjct  95   AGLSCAYELSKNPAVSVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQ  154

Query  554  DNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            ++YVVIKHAALFTSTIMS+LLARPNVKLFNA
Sbjct  155  EDYVVIKHAALFTSTIMSRLLARPNVKLFNA  185



>ref|XP_008366026.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic 
[Malus domestica]
Length=378

 Score =   255 bits (652),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 141/160 (88%), Gaps = 6/160 (4%)
 Frame = +2

Query  185  VQAVKASSHHN--LSVSASH---TP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            +Q  KA+  +N  LSVS S    TP Y L +FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  35   LQLAKAAPANNGGLSVSMSANGLTPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADT  94

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+
Sbjct  95   DVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLN  154

Query  527  ELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EL ++Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  155  ELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  194



>ref|XP_009120006.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Brassica 
rapa]
Length=352

 Score =   254 bits (649),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  95

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E
Sbjct  96   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVPYDE  155

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  156  QDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  187



>gb|KEH43920.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=349

 Score =   254 bits (649),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +++S +  PY +++FKF PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGL
Sbjct  37   STPQKITMSLTTPPYDINTFKFAPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGL  96

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
            SCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VEY+E ++Y
Sbjct  97   SCAYELSKNPNISIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVEYDEQEDY  156

Query  563  VVIKHAALFTSTIMSKLLARPNVKLFNA  646
            VVIKHAALFTSTIMSKLLA+PNVKLFNA
Sbjct  157  VVIKHAALFTSTIMSKLLAKPNVKLFNA  184



>gb|KHG02821.1| Thiamine thiazole synthase 2, chloroplastic [Gossypium arboreum]
Length=355

 Score =   254 bits (649),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            +K+SS  + ++S S TP Y L SFKFQPI+ES VAREMTRRYM DMI YADTDVI+VGAG
Sbjct  38   IKSSSQIS-TISMSLTPPYDLQSFKFQPIQESYVAREMTRRYMMDMITYADTDVIIVGAG  96

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPN+RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL ++Y+E
Sbjct  97   SAGLSCAYEISKNPNIRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIQYDE  156

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             ++YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  157  QEDYVVIKHAALFTSTIMSKLLARPNVKLFNA  188



>gb|AAW66657.1| thiamine biosynthetic enzyme [Picrorhiza kurrooa]
Length=354

 Score =   254 bits (649),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 142/178 (80%), Gaps = 3/178 (2%)
 Frame = +2

Query  119  TQTIFLRCRQIIVQWNARCFFCVQAVKASSHHNLSV--SASHTPYSLDSFKFQPIKESIV  292
            T++ FL  +  I          +Q VK SS  NLSV  SA+   Y LD+  F PIKESIV
Sbjct  13   TKSSFLDTKSSIYGSPLSSRATIQRVK-SSPQNLSVTMSAATPAYDLDNLTFAPIKESIV  71

Query  293  AREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLG  472
            +REMTRRYM DMI YADTDV+VVGAGSAGLSCAYE+SKNPN+ +AIIEQSVSPGGGAWLG
Sbjct  72   SREMTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPNINIAIIEQSVSPGGGAWLG  131

Query  473  GQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             QLFSAMVVRKPA  FLDELE+ Y+E D+YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  132  SQLFSAMVVRKPAPKFLDELEIAYDEQDDYVVIKHAALFTSTIMSKLLARPNVKLFNA  189



>ref|XP_008386070.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Malus 
domestica]
Length=312

 Score =   253 bits (645),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 141/160 (88%), Gaps = 6/160 (4%)
 Frame = +2

Query  185  VQAVKAS--SHHNLSVSAS----HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            +Q  KA+  S+  LSVS S    +  Y+L +FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  35   LQPAKAAPASNGGLSVSMSANGLNPSYNLSAFKFDPIKESIVSREMTRRYMTDMITYADT  94

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+
Sbjct  95   DVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLN  154

Query  527  ELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EL ++Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  155  ELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  194



>ref|XP_003563001.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic [Brachypodium 
distachyon]
Length=352

 Score =   254 bits (649),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+SAS  PY L++FKF PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+
Sbjct  43   SISASTPPYDLNAFKFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYEL  102

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SK+P++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +EY+E ++YVVIKHA
Sbjct  103  SKDPSISIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELNIEYDEQEDYVVIKHA  162

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTST+MS+LLARPNVKLFNA
Sbjct  163  ALFTSTVMSRLLARPNVKLFNA  184



>ref|XP_010448624.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X1 [Camelina sativa]
 ref|XP_010448632.1| PREDICTED: thiamine thiazole synthase, chloroplastic isoform 
X2 [Camelina sativa]
Length=351

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCAY
Sbjct  43   SVSVRASTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  102

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E DNYVV+K
Sbjct  103  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDNYVVVK  162

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNVKLFNA
Sbjct  163  HAALFTSTIMSKLLARPNVKLFNA  186



>ref|XP_010670817.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++S ++S  PY L + KF PI+ESIVAREMTRRYMTDMI YADTDV+++GAGSAGLSCAY
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            E+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VEY+E DNYVVIK
Sbjct  106  ELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVEYDEQDNYVVIK  165

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNVKLFNA
Sbjct  166  HAALFTSTIMSKLLARPNVKLFNA  189



>ref|XP_010443053.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=351

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCAY
Sbjct  43   SVSVRASTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  102

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E DNYVV+K
Sbjct  103  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDNYVVVK  162

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNVKLFNA
Sbjct  163  HAALFTSTIMSKLLARPNVKLFNA  186



>ref|XP_003607681.1| Thiazole biosynthetic enzyme [Medicago truncatula]
 gb|AES89878.1| thiazole biosynthetic enzyme [Medicago truncatula]
Length=350

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++FKF PIKESIVAREMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE+SKNPNV++
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPNVKI  113

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+E D+YVVIKHAALFTSTIM
Sbjct  114  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELEIEYDEQDDYVVIKHAALFTSTIM  173

Query  605  SKLLARPNVKLFNA  646
            SKLLARPNVKLFNA
Sbjct  174  SKLLARPNVKLFNA  187



>ref|XP_010670818.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=352

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++S ++S  PY L + KF PI+ESIVAREMTRRYMTDMI YADTDV+++GAGSAGLSCAY
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            E+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VEY+E DNYVVIK
Sbjct  106  ELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVEYDEQDNYVVIK  165

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNVKLFNA
Sbjct  166  HAALFTSTIMSKLLARPNVKLFNA  189



>gb|EPS63028.1| thiazole biosynthetic enzyme, chloroplastic, partial [Genlisea 
aurea]
Length=291

 Score =   252 bits (643),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 129/135 (96%), Gaps = 0/135 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L+SFKF PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SKNP+VR
Sbjct  2    PYDLNSFKFAPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPSVR  61

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTI  601
            VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V+Y+E ++YVVIKHAALFTST+
Sbjct  62   VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVDYDEQEDYVVIKHAALFTSTV  121

Query  602  MSKLLARPNVKLFNA  646
            MSKLLARPNVKLFNA
Sbjct  122  MSKLLARPNVKLFNA  136



>ref|XP_004504342.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=349

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 135/144 (94%), Gaps = 2/144 (1%)
 Frame = +2

Query  221  SVSASHTP--YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            SV+A+++P  Y L+SFKF PIKESIV+REMTRRYMTDM+ +ADTDV++VGAGSAGL+CAY
Sbjct  43   SVAAANSPPPYDLNSFKFDPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLTCAY  102

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            E+SKNPNV +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++Y+E DNYVVIK
Sbjct  103  ELSKNPNVNIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEKDNYVVIK  162

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNVKLFNA
Sbjct  163  HAALFTSTIMSKLLARPNVKLFNA  186



>gb|AFK44470.1| unknown [Medicago truncatula]
Length=349

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +2

Query  203  SSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGL  382
            S+   +++S +  PY +++FKF PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGL
Sbjct  37   STPQKITMSLTTPPYDINTFKFAPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGL  96

Query  383  SCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
            SCAYE+SKNPN+ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VEY+E ++Y
Sbjct  97   SCAYELSKNPNISIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVEYDEQEDY  156

Query  563  VVIKHAALFTSTIMSKLLARPNVKLFNA  646
            VVIKHAALFTSTIMSKLLA+PNVKLFNA
Sbjct  157  VVIKHAALFTSTIMSKLLAKPNVKLFNA  184



>ref|XP_002864354.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40613.1| hypothetical protein ARALYDRAFT_918614 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   254 bits (648),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSGSVVSVRATTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  95

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E
Sbjct  96   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDE  155

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             DNYVV+KHAALFTSTIMSKLLARPNVKLFNA
Sbjct  156  QDNYVVVKHAALFTSTIMSKLLARPNVKLFNA  187



>ref|XP_010670808.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++S ++S  PY L + KF PI+ESIVAREMTRRYMTDMI YADTDV+++GAGSAGLSCAY
Sbjct  46   SMSATSSPPPYDLGNIKFDPIRESIVAREMTRRYMTDMITYADTDVVIMGAGSAGLSCAY  105

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            E+SKNP++ +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ VEY+E DNYVVIK
Sbjct  106  ELSKNPDINIAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVEYDEQDNYVVIK  165

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNVKLFNA
Sbjct  166  HAALFTSTIMSKLLARPNVKLFNA  189



>ref|XP_009378870.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Pyrus 
x bretschneideri]
Length=359

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 6/160 (4%)
 Frame = +2

Query  185  VQAVKAS--SHHNLSVSAS----HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            +Q  KA+  S+  LSVS S    +  Y L +FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  35   LQPAKAAPASNGGLSVSMSSNGLNPSYDLSAFKFDPIKESIVSREMTRRYMTDMITYADT  94

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV+VVGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+
Sbjct  95   DVVVVGAGSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLN  154

Query  527  ELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EL ++Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  155  ELGIDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  194



>gb|EYU19221.1| hypothetical protein MIMGU_mgv1a009132mg [Erythranthe guttata]
Length=352

 Score =   253 bits (646),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+ F+F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SKNP+VRV
Sbjct  59   YDLNQFRFAPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPSVRV  118

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +EY+E DNYVVIKHAALFTSTIM
Sbjct  119  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGLEYDEQDNYVVIKHAALFTSTIM  178

Query  605  SKLLARPNVKLFNA  646
            SKLLARPNVKLFNA
Sbjct  179  SKLLARPNVKLFNA  192



>ref|XP_001755171.1| predicted protein [Physcomitrella patens]
 gb|EDQ80115.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   253 bits (646),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +2

Query  233  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNP  412
            S   Y L+++KF PIKESIVAREMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  57   SDAKYDLNNYKFDPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  116

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFT  592
            NV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+EV YEE +NYVVIKHAALFT
Sbjct  117  NVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEVPYEEMENYVVIKHAALFT  176

Query  593  STIMSKLLARPNVKLFNA  646
            STIMSKLLARPNVKLFNA
Sbjct  177  STIMSKLLARPNVKLFNA  194



>ref|XP_001767548.1| predicted protein [Physcomitrella patens]
 sp|A9SME1.1|THI42_PHYPA RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67683.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +2

Query  233  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNP  412
            S   Y L+++KF+PIKESIVAREMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  55   SDAKYDLNNYKFEPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  114

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFT  592
            NV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+EV YEE +NYVVIKHAALFT
Sbjct  115  NVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEVPYEELENYVVIKHAALFT  174

Query  593  STIMSKLLARPNVKLFNA  646
            STIMSKLLARPNVKLFNA
Sbjct  175  STIMSKLLARPNVKLFNA  192



>ref|XP_006845176.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
 gb|ERN06851.1| hypothetical protein AMTR_s00005p00239290 [Amborella trichopoda]
Length=355

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L  FKF+PIKESIV+REMTRRYM DMI YADTDV+VVGAGSAGLSCAYE+SKNPNVRV
Sbjct  56   YDLKDFKFEPIKESIVSREMTRRYMMDMITYADTDVVVVGAGSAGLSCAYELSKNPNVRV  115

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V+Y+E DNYVVIKHAALFTSTIM
Sbjct  116  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVDYDEQDNYVVIKHAALFTSTIM  175

Query  605  SKLLARPNVKLFNA  646
            S+LLARPNVKLFNA
Sbjct  176  SRLLARPNVKLFNA  189



>gb|KJB13600.1| hypothetical protein B456_002G083700 [Gossypium raimondii]
Length=357

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  SSHHNLSVS---ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            SS  N S+S   AS  PY L++F+F PIKESIV+REMTRRYM DMI YADTDV+VVGAGS
Sbjct  42   SSPCNASISMSAASPPPYDLNNFRFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGS  101

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEA  553
            AGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +EY+E 
Sbjct  102  AGLSCAYELSKNPSVQIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELAIEYDEQ  161

Query  554  DNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            D+YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  162  DDYVVIKHAALFTSTIMSKLLARPNVKLFNA  192



>gb|ADG27845.1| thiazole biosynthetic enzyme [Gossypium hirsutum]
Length=357

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 135/151 (89%), Gaps = 3/151 (2%)
 Frame = +2

Query  203  SSHHNLSVS---ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            SS  N S+S   AS  PY L++F+F PIKESIV+REMTRRYM DMI YADTDV+VVGAGS
Sbjct  42   SSPCNASISMSAASPPPYDLNNFRFDPIKESIVSREMTRRYMMDMITYADTDVVVVGAGS  101

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEA  553
            AGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +EY+E 
Sbjct  102  AGLSCAYELSKNPSVQIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELAIEYDEQ  161

Query  554  DNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            D+YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  162  DDYVVIKHAALFTSTIMSKLLARPNVKLFNA  192



>ref|XP_009408664.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +2

Query  182  CVQAVKASSHHNLSVSA-SHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVI  355
             ++++      +LSV+A S  P Y LDSF+F+PIKES+V+REMTRRYMTDMI YADTDV+
Sbjct  36   ALRSLPGRGRPSLSVTAASAAPRYDLDSFRFEPIKESVVSREMTRRYMTDMITYADTDVV  95

Query  356  VVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELE  535
            V+GAGSAGLSCAYEISK+P+VRVAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL 
Sbjct  96   VIGAGSAGLSCAYEISKDPSVRVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELG  155

Query  536  VEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            V Y+EAD+YVVI HAALFTSTIMS+LLARPNVKLFNA
Sbjct  156  VAYDEADSYVVIHHAALFTSTIMSRLLARPNVKLFNA  192



>gb|AFK46185.1| unknown [Medicago truncatula]
Length=350

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++FKF PIKESIVAREMTRRYMTDM  +ADTDV++VGAGSAGLSCAYE+SKNPNV++
Sbjct  54   YDLNAFKFAPIKESIVAREMTRRYMTDMATHADTDVVIVGAGSAGLSCAYELSKNPNVKI  113

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+E D+YVVIKHAALFTSTIM
Sbjct  114  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHHFLDELEIEYDEQDDYVVIKHAALFTSTIM  173

Query  605  SKLLARPNVKLFNA  646
            SKLLARPNVKLFNA
Sbjct  174  SKLLARPNVKLFNA  187



>ref|NP_001236812.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88227.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   251 bits (642),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+SAS  PY   SF+F PI+ESIV+REMTRRYM DM+ +ADTDV++VGAGSAGLSCAYE+
Sbjct  41   SMSASAPPYDFGSFRFDPIRESIVSREMTRRYMIDMVTHADTDVVIVGAGSAGLSCAYEL  100

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SKNP++ +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL VEY+E DNYVVIKHA
Sbjct  101  SKNPSINIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELNVEYDEQDNYVVIKHA  160

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTSTIMSKLLARPNVKLFNA
Sbjct  161  ALFTSTIMSKLLARPNVKLFNA  182



>ref|XP_002522858.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
 gb|EEF39556.1| electron transfer flavoprotein-ubiquinone oxidoreductase, putative 
[Ricinus communis]
Length=359

 Score =   252 bits (644),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 130/137 (95%), Gaps = 1/137 (1%)
 Frame = +2

Query  239  TP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            TP Y+L+SFKF PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+SKNP+
Sbjct  60   TPSYNLNSFKFDPIKESIVSREMTRRYMTDMISYADTDVVIVGAGSAGLSCAYELSKNPD  119

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTS  595
            V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+ +EY+E DNYVVIKHAALFTS
Sbjct  120  VQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEVGIEYDEQDNYVVIKHAALFTS  179

Query  596  TIMSKLLARPNVKLFNA  646
            TIMSKLLARPNVKLFNA
Sbjct  180  TIMSKLLARPNVKLFNA  196



>ref|XP_001767495.1| predicted protein [Physcomitrella patens]
 sp|A9SMC8.1|THI44_PHYPA RecName: Full=Thiamine thiazole synthase 4, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 4; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ67630.1| predicted protein [Physcomitrella patens]
Length=343

 Score =   251 bits (642),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +2

Query  233  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNP  412
            S   Y L+++KF+PIKESIVAREMTRRYMT+MI +ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  42   SDAKYDLNNYKFEPIKESIVAREMTRRYMTEMITHADTDVVVVGAGSAGLSCAYELSKNP  101

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFT  592
            NV+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDE+EV YEE +NYVVIKHAALFT
Sbjct  102  NVKVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDEIEVPYEELENYVVIKHAALFT  161

Query  593  STIMSKLLARPNVKLFNA  646
            STIMSKLLARPNVKLFNA
Sbjct  162  STIMSKLLARPNVKLFNA  179



>gb|EMS66450.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Triticum urartu]
Length=348

 Score =   251 bits (642),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = +2

Query  167  ARCFFCVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            AR   CV   +A +  N S+S+S  PY L++FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  22   ARTPSCVATPRAGAICN-SISSSTPPYDLNAFKFSPIKESIVSREMTRRYMTDMITYADT  80

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV++VGAGSAGLSCAYE+SK+P++ +AIIEQSVSPGGG WLG QLFSAMVVRKPA +FLD
Sbjct  81   DVVIVGAGSAGLSCAYELSKDPSISIAIIEQSVSPGGGRWLGAQLFSAMVVRKPAHLFLD  140

Query  527  ELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EL +EY+E ++YVVIKHAALFTST+MS+LLARPNVKLFNA
Sbjct  141  ELNIEYDEQEDYVVIKHAALFTSTVMSRLLARPNVKLFNA  180



>ref|XP_006401539.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
 gb|ESQ42992.1| hypothetical protein EUTSA_v10013978mg [Eutrema salsugineum]
Length=350

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            +LSV A+ + Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCAY
Sbjct  43   SLSVRAT-SGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  101

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E DNYVVIK
Sbjct  102  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDNYVVIK  161

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNVKLFNA
Sbjct  162  HAALFTSTIMSKLLARPNVKLFNA  185



>gb|KCW70139.1| hypothetical protein EUGRSUZ_F03433 [Eucalyptus grandis]
Length=487

 Score =   255 bits (652),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 136/153 (89%), Gaps = 5/153 (3%)
 Frame = +2

Query  203  SSHHNLSVS-----ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            SS H+  +S     A+  PY L++F+F PIKESIV+REMTRRYM DMI YADTDV+VVGA
Sbjct  170  SSAHSSGISMSAAAANPPPYDLNAFRFDPIKESIVSREMTRRYMMDMITYADTDVVVVGA  229

Query  368  GSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            GSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+
Sbjct  230  GSAGLSCAYELSKNPDVQVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELEIEYD  289

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  290  EQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  322



>emb|CDY47441.1| BnaC09g31160D [Brassica napus]
Length=352

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV AS   Y L++F F PIKESIV+REMTRRYMTDMI  A+TDV+VVGAG
Sbjct  36   GLKPRSVSAVSVRASTAGYDLNAFTFAPIKESIVSREMTRRYMTDMITSAETDVVVVGAG  95

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E
Sbjct  96   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVPYDE  155

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  156  QDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  187



>gb|AHA84206.1| thiamin biosynthetic enzyme [Phaseolus vulgaris]
Length=348

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = +2

Query  221  SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            S+SA+ +P Y L SF+FQPIKESIV+REMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE
Sbjct  42   SMSAAPSPAYDLSSFRFQPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYE  101

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKH  577
            +SKNP + +AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDEL +EY+E DNYVVIKH
Sbjct  102  LSKNPAINIAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHMFLDELGLEYDEQDNYVVIKH  161

Query  578  AALFTSTIMSKLLARPNVKLFNA  646
            AALFTSTIMSKLLARPNVKLFNA
Sbjct  162  AALFTSTIMSKLLARPNVKLFNA  184



>ref|XP_007132954.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
 gb|ESW04948.1| hypothetical protein PHAVU_011G139100g [Phaseolus vulgaris]
Length=348

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = +2

Query  221  SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            S+SA+ +P Y L SF+FQPIKESIV+REMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE
Sbjct  42   SMSAAPSPAYDLSSFRFQPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYE  101

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKH  577
            +SKNP + +AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDEL +EY+E DNYVVIKH
Sbjct  102  LSKNPAINIAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHMFLDELGLEYDEQDNYVVIKH  161

Query  578  AALFTSTIMSKLLARPNVKLFNA  646
            AALFTSTIMSKLLARPNVKLFNA
Sbjct  162  AALFTSTIMSKLLARPNVKLFNA  184



>ref|XP_011030844.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase, chloroplastic-like 
[Populus euphratica]
Length=357

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVG  364
            +Q  K+SS  N+S+S S  PY L++FKF+PIKESIV+REMTRRYM DMI +ADTDV++VG
Sbjct  39   MQPTKSSSSPNVSISMSSPPYDLNAFKFEPIKESIVSREMTRRYMMDMITHADTDVVIVG  98

Query  365  AGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEY  544
            AGSAGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL VEY
Sbjct  99   AGSAGLSCAYELSKNPSVKIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVEY  158

Query  545  EEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +E ++YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  159  DEQEDYVVIKHAALFTSTIMSKLLARPNVKLFNA  192



>emb|CDY52570.1| BnaC03g71780D [Brassica napus]
Length=352

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSFSTVSVRAT-AGYDLNAFTFAPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  94

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E
Sbjct  95   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVPYDE  154

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  155  QDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  186



>dbj|BAA88225.1| thiamin biosynthetic enzyme [Glycine max]
Length=345

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+SAS  PY   SF+F PI+ESIV+REMTRRYM DM+ +ADTDV++VGAGSAGLSCAYE+
Sbjct  41   SMSASAPPYDFGSFRFDPIRESIVSREMTRRYMIDMVTHADTDVVIVGAGSAGLSCAYEL  100

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SKNP++ +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +EY+E DNYVVIKHA
Sbjct  101  SKNPSINIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELNLEYDEQDNYVVIKHA  160

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTSTIMSKLLARPNVKLFNA
Sbjct  161  ALFTSTIMSKLLARPNVKLFNA  182



>ref|XP_001753819.1| predicted protein [Physcomitrella patens]
 sp|A9RHX1.1|THI41_PHYPA RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81571.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +2

Query  233  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNP  412
            S   Y L+++KF PIKESIVAREMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  56   SDANYDLNNYKFAPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  115

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFT  592
            NV+VAI+EQSVSPGGGAWLGGQLFSAM+VRKPA  FLDE+EV YEE +NYVVIKHAALFT
Sbjct  116  NVKVAIVEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDEIEVPYEEMENYVVIKHAALFT  175

Query  593  STIMSKLLARPNVKLFNA  646
            STIMSKLLARPNVKLFNA
Sbjct  176  STIMSKLLARPNVKLFNA  193



>ref|XP_001753698.1| predicted protein [Physcomitrella patens]
 ref|XP_001753700.1| predicted protein [Physcomitrella patens]
 sp|A9RHW6.1|THI43_PHYPA RecName: Full=Thiamine thiazole synthase 3, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 3; Flags: Precursor 
[Physcomitrella patens]
 gb|EDQ81450.1| predicted protein [Physcomitrella patens]
 gb|EDQ81452.1| predicted protein [Physcomitrella patens]
Length=357

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +2

Query  233  SHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNP  412
            S   Y L+++KF PIKESIVAREMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+SKNP
Sbjct  56   SDANYDLNNYKFAPIKESIVAREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYELSKNP  115

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFT  592
            NV+VAI+EQSVSPGGGAWLGGQLFSAM+VRKPA  FLDE+EV YEE +NYVVIKHAALFT
Sbjct  116  NVKVAIVEQSVSPGGGAWLGGQLFSAMIVRKPAHRFLDEIEVPYEEMENYVVIKHAALFT  175

Query  593  STIMSKLLARPNVKLFNA  646
            STIMSKLLARPNVKLFNA
Sbjct  176  STIMSKLLARPNVKLFNA  193



>emb|CDY43024.1| BnaA03g11710D [Brassica napus]
Length=351

 Score =   250 bits (638),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSASTVSVRAT-AGYDLNAFTFAPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  94

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E
Sbjct  95   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVPYDE  154

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  155  QDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  186



>emb|CDY28754.1| BnaA02g09460D [Brassica napus]
Length=349

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 1/145 (1%)
 Frame = +2

Query  212  HNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCA  391
             +LSV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCA
Sbjct  41   RSLSVRAT-AGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCA  99

Query  392  YEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVI  571
            YEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E DNYVVI
Sbjct  100  YEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDNYVVI  159

Query  572  KHAALFTSTIMSKLLARPNVKLFNA  646
            KHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  KHAALFTSTIMSKLLARPNVKLFNA  184



>gb|ACF85034.1| unknown [Zea mays]
Length=307

 Score =   248 bits (634),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  218  LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            +S+S+S+ PY L SF+F PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE
Sbjct  1    MSMSSSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYE  60

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKH  577
            +SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EA++YVVIKH
Sbjct  61   LSKDPAVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKH  120

Query  578  AALFTSTIMSKLLARPNVKLFNA  646
            AALFTST+MS LLARPNVKLFNA
Sbjct  121  AALFTSTVMSLLLARPNVKLFNA  143



>ref|XP_009132425.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=351

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
             +K  S   +SV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAG
Sbjct  36   GLKPRSASTVSVRAT-AGYDLNAFTFAPIKESIVSREMTRRYMTDMITYAETDVVVVGAG  94

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E
Sbjct  95   SAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVPYDE  154

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  155  QDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  186



>ref|NP_001236824.1| thiamin biosynthetic enzyme [Glycine max]
 dbj|BAA88228.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   249 bits (637),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A+  PY   SF+F+PI+ESIV+REMTRRYMTDM+ +ADTDV+VVGAGSAGLSCAYE+SK
Sbjct  47   AAAPPPYDFGSFRFEPIRESIVSREMTRRYMTDMVTHADTDVVVVGAGSAGLSCAYELSK  106

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAAL  586
            NP+V +AI+EQS+SPGGGAWLGGQLFSAMVVRKPA +FLDEL +EY+E DNYVVIKHAAL
Sbjct  107  NPSVNIAIVEQSISPGGGAWLGGQLFSAMVVRKPAHLFLDELGLEYDEQDNYVVIKHAAL  166

Query  587  FTSTIMSKLLARPNVKLFNA  646
            FTSTIMSKLLARPNVKLFNA
Sbjct  167  FTSTIMSKLLARPNVKLFNA  186



>gb|AGT17015.1| thiazole biosynthetic enzyme [Saccharum hybrid cultivar R570]
Length=355

 Score =   249 bits (637),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EA++YVVIKHA
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHA  166

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTSTIMS LLARPNVKLFNA
Sbjct  167  ALFTSTIMSALLARPNVKLFNA  188



>gb|AGT16846.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16900.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   249 bits (636),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EA++YVVIKHA
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHA  166

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTSTIMS LLARPNVKLFNA
Sbjct  167  ALFTSTIMSALLARPNVKLFNA  188



>gb|AGT16507.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   249 bits (636),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EA++YVVIKHA
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHA  166

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTSTIMS LLARPNVKLFNA
Sbjct  167  ALFTSTIMSALLARPNVKLFNA  188



>gb|AGT15954.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16278.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT16833.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
 gb|AGT17116.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV++VGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EA++YVVIKHA
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHA  166

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTSTIMS LLARPNVKLFNA
Sbjct  167  ALFTSTIMSALLARPNVKLFNA  188



>ref|XP_006280726.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
 gb|EOA13624.1| hypothetical protein CARUB_v10026695mg [Capsella rubella]
Length=350

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 132/146 (90%), Gaps = 1/146 (1%)
 Frame = +2

Query  212  HNLSVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSC  388
             ++SVS   T  Y L++F F PIKESIV+REMTRRYMTDMI +A+TDV+VVGAGSAGLSC
Sbjct  40   RSVSVSVRATAGYDLNAFTFDPIKESIVSREMTRRYMTDMITFAETDVVVVGAGSAGLSC  99

Query  389  AYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVV  568
            AYEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E DNYVV
Sbjct  100  AYEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDNYVV  159

Query  569  IKHAALFTSTIMSKLLARPNVKLFNA  646
            +KHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  VKHAALFTSTIMSKLLARPNVKLFNA  185



>ref|XP_004965741.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=351

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++S + S+ PY L SF+F PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAY
Sbjct  41   SISSTPSNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAY  100

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            E+SK+P++ +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL + Y+EA++YVVIK
Sbjct  101  ELSKDPSISIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGIAYDEAEDYVVIK  160

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTST+MS+LLARPNVKLFNA
Sbjct  161  HAALFTSTVMSRLLARPNVKLFNA  184



>dbj|BAA88226.1| thiamin biosynthetic enzyme [Glycine max]
Length=349

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A+  PY   SF+F+PI+ESIV+REMTRRYMTDM+ +ADTDV+VVGAGSAGLSCAYE+SK
Sbjct  47   AAAPPPYDFGSFRFEPIRESIVSREMTRRYMTDMVTHADTDVVVVGAGSAGLSCAYELSK  106

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAAL  586
            NP+V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL +EY+E DNYVVIKHAAL
Sbjct  107  NPSVNIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGLEYDEQDNYVVIKHAAL  166

Query  587  FTSTIMSKLLARPNVKLFNA  646
             TSTIMSKLLARPNVKLFNA
Sbjct  167  LTSTIMSKLLARPNVKLFNA  186



>ref|XP_006360084.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Solanum 
tuberosum]
Length=357

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 135/154 (88%), Gaps = 6/154 (4%)
 Frame = +2

Query  203  SSHHNLSVSAS------HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVG  364
            S+  N++VS S        PY L SF F PIKESIVAREMTRRYMTDMI YADTDV++VG
Sbjct  39   STPQNMAVSMSADASPPPPPYDLGSFSFNPIKESIVAREMTRRYMTDMITYADTDVVIVG  98

Query  365  AGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEY  544
            AGSAGLSCAYE+SKNP+V+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++Y
Sbjct  99   AGSAGLSCAYELSKNPDVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDY  158

Query  545  EEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +E D+YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  159  DEQDHYVVIKHAALFTSTIMSKLLARPNVKLFNA  192



>ref|XP_002316981.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
 gb|ABK94930.1| unknown [Populus trichocarpa]
 gb|EEE97593.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa]
Length=357

 Score =   248 bits (633),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVG  364
            +Q  K+SS  N+S+S S  PY L++FKF+PIKESIV+REMTRRYM DMI +ADTDV++VG
Sbjct  39   MQPTKSSSSPNVSISMSSPPYDLNAFKFEPIKESIVSREMTRRYMMDMITHADTDVVIVG  98

Query  365  AGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEY  544
            AGSAGLSCAYE+SKNP+V++AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL +EY
Sbjct  99   AGSAGLSCAYELSKNPSVKIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIEY  158

Query  545  EEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +E ++YVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  159  DEQEDYVVIKHAALFTSTIMSKLLARPNVKLFNA  192



>ref|XP_004505443.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=352

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L+SFKF PIKESIV+REMTRRYMTDM+ +ADTDV++VGAGSAGLSCAYE+SKNP+++
Sbjct  53   PYDLNSFKFNPIKESIVSREMTRRYMTDMVTHADTDVVIVGAGSAGLSCAYELSKNPSIK  112

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTI  601
            +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+E+ VEY+E D+YVVIKHAALFTSTI
Sbjct  113  IAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNEIGVEYDEKDDYVVIKHAALFTSTI  172

Query  602  MSKLLARPNVKLFNA  646
            M K+LARPNVKLFNA
Sbjct  173  MGKILARPNVKLFNA  187



>ref|XP_010485129.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Camelina 
sativa]
Length=548

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCAY
Sbjct  42   SVSVRASTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  101

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E DNYVV+K
Sbjct  102  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDNYVVVK  161

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNVKLFNA
Sbjct  162  HAALFTSTIMSKLLARPNVKLFNA  185


 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++SV AS   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCAY
Sbjct  240  SVSVRASTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCAY  299

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            EISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E DNYVV+K
Sbjct  300  EISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDNYVVVK  359

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTSTIMSKLLARPNVKLFNA
Sbjct  360  HAALFTSTIMSKLLARPNVKLFNA  383



>ref|XP_009127069.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Brassica 
rapa]
Length=349

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 131/145 (90%), Gaps = 1/145 (1%)
 Frame = +2

Query  212  HNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCA  391
             +LSV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLSCA
Sbjct  41   RSLSVRAT-AGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSCA  99

Query  392  YEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVI  571
            YEISKNPNV+VAII QSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E DNYVVI
Sbjct  100  YEISKNPNVQVAIIAQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDNYVVI  159

Query  572  KHAALFTSTIMSKLLARPNVKLFNA  646
            KHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  KHAALFTSTIMSKLLARPNVKLFNA  184



>ref|XP_007021022.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
 gb|EOY12547.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) 
[Theobroma cacao]
Length=358

 Score =   248 bits (632),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++F+F PIKESIV+REMTRRYM DMI +ADTDV+VVGAGSAGLSCAYE+SKNP+V+
Sbjct  59   PYDLNNFRFDPIKESIVSREMTRRYMMDMITHADTDVVVVGAGSAGLSCAYELSKNPSVQ  118

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTI  601
            VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +EY+E D+YVVIKHAALFTSTI
Sbjct  119  VAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHRFLDELGIEYDEQDDYVVIKHAALFTSTI  178

Query  602  MSKLLARPNVKLFNA  646
            MSKLLARPNVKLFNA
Sbjct  179  MSKLLARPNVKLFNA  193



>gb|AGT16062.1| Thiazole biosynthetic enzyme Thi4 family [Saccharum hybrid cultivar 
R570]
Length=355

 Score =   248 bits (632),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE+
Sbjct  47   SISSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SK+P V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EA++YVVIKHA
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHA  166

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTSTIM  LLARPNVKLFNA
Sbjct  167  ALFTSTIMRALLARPNVKLFNA  188



>ref|NP_001105697.1| thiamine thiazole synthase 2, chloroplastic precursor [Zea mays]
 sp|Q41739.1|THI42_MAIZE RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Zea mays]
 gb|AAA96739.1| thiamine biosynthetic enzyme [Zea mays]
Length=354

 Score =   247 bits (631),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+ + PY L SF+F PIKESIV+REMTRRYMTDMI +ADTDV++VGAGSAGLSCAYE+
Sbjct  46   SISSPNPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  105

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SK+P V VAI+EQSVSPGGGAWLGGQLFSAMVVR+PA +FLDEL V Y+EA++YVV+KHA
Sbjct  106  SKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYDEAEDYVVVKHA  165

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTST+MS+LLARPNVKLFNA
Sbjct  166  ALFTSTVMSRLLARPNVKLFNA  187



>gb|AFK48432.1| unknown [Lotus japonicus]
Length=363

 Score =   247 bits (631),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF PIKESIV+REM RRYMTDM+ +ADTDV++VGAGSAGL+CAYE+SKNPNV+V
Sbjct  63   YDLGSFKFAPIKESIVSREMARRYMTDMVTFADTDVVIVGAGSAGLTCAYELSKNPNVQV  122

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL V+Y+E DNYVVIKHAALFTSTIM
Sbjct  123  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGVDYDEQDNYVVIKHAALFTSTIM  182

Query  605  SKLLARPNVKLFNA  646
            SKLLARPNVKLFNA
Sbjct  183  SKLLARPNVKLFNA  196



>sp|Q38709.1|THI4_ALNGL RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Alnus 
glutinosa]
 emb|CAA66064.1| thaizole biosynthetic enzmye [Alnus glutinosa]
Length=352

 Score =   247 bits (630),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 134/155 (86%), Gaps = 2/155 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVS-ASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            VQ  KA +  ++S+S A   PY L +F F PIKESIV+REMTRRYM DMI YADTDV+VV
Sbjct  34   VQPTKAGAKPSISMSGAPSPPYDLKAFTFDPIKESIVSREMTRRYMMDMITYADTDVVVV  93

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGS+GL C YE+SKNP+V+VAIIEQSVSPGGGAWLGGQLFS MVVRKPA +FLDEL +E
Sbjct  94   GAGSSGLVC-YELSKNPSVQVAIIEQSVSPGGGAWLGGQLFSGMVVRKPAHLFLDELGIE  152

Query  542  YEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  153  YDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  187



>emb|CBI23176.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   246 bits (629),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  260  FKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQ  439
            FKF+PIKESIVAREMTRRYM DMI YADTDV++VGAGSAGLSCAYE+SKNP++RVAIIEQ
Sbjct  42   FKFEPIKESIVAREMTRRYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPSIRVAIIEQ  101

Query  440  SVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSKLLA  619
            SVSPGGGAWLGGQLFSAMVVRKPA  FLDEL +EY+E DNYVVIKHAALFTSTIMSKLLA
Sbjct  102  SVSPGGGAWLGGQLFSAMVVRKPAHHFLDELGIEYDEQDNYVVIKHAALFTSTIMSKLLA  161

Query  620  RPNVKLFNA  646
            RPNVKLFNA
Sbjct  162  RPNVKLFNA  170



>ref|NP_200288.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
 sp|Q38814.1|THI4_ARATH RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL16153.1|AF428385_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL16285.1|AF428355_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL31936.1|AF419604_1 AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAC97124.1| Thi1 protein [Arabidopsis thaliana]
 dbj|BAB08756.1| thiazole biosynthetic enzyme precursor (ARA6) [Arabidopsis thaliana]
 gb|AAL06876.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAL24202.1| AT5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AAN12914.1| At5g54770/MBG8_3 [Arabidopsis thaliana]
 gb|AED96539.1| thiazole biosynthetic enzyme [Arabidopsis thaliana]
Length=349

 Score =   246 bits (629),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  212  HNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCA  391
             + SV A+   Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLS A
Sbjct  40   RSFSVRATTAGYDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAA  99

Query  392  YEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVI  571
            YEISKNPNV+VAIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E D YVV+
Sbjct  100  YEISKNPNVQVAIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVV  159

Query  572  KHAALFTSTIMSKLLARPNVKLFNA  646
            KHAALFTSTIMSKLLARPNVKLFNA
Sbjct  160  KHAALFTSTIMSKLLARPNVKLFNA  184



>ref|XP_002463222.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
 sp|C5X2M4.1|THI42_SORBI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 2; Flags: Precursor 
[Sorghum bicolor]
 gb|EER99743.1| hypothetical protein SORBIDRAFT_02g040060 [Sorghum bicolor]
Length=352

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            + PY L SF+F PIKES+V+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+SK+P+
Sbjct  49   NPPYDLTSFRFSPIKESVVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPS  108

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTS  595
            V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EA++YVVIKHAALFTS
Sbjct  109  VSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHAALFTS  168

Query  596  TIMSKLLARPNVKLFNA  646
            T+MS+LLARPNVKLFNA
Sbjct  169  TVMSRLLARPNVKLFNA  185



>ref|XP_004957903.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Setaria 
italica]
Length=350

 Score =   246 bits (628),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +2

Query  218  LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            +  S S+ PY L SFKF PIKESIV+REMTRRYMTDMI +ADTDV+VVGAGSAGLSCAYE
Sbjct  41   IRASISNPPYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTDVVVVGAGSAGLSCAYE  100

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKH  577
            +SK+P+V VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EA++YVV+ H
Sbjct  101  LSKDPSVSVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVVSH  160

Query  578  AALFTSTIMSKLLARPNVKLFNA  646
            AALFTST+MS+LLARPNVKLFNA
Sbjct  161  AALFTSTVMSRLLARPNVKLFNA  183



>gb|ABK22862.1| unknown [Picea sitchensis]
Length=335

 Score =   246 bits (627),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+SFKF+PI+ESIVAREMTRRYM DMI +ADTDV++VGAGSAGLSCAYE+SKNP+++V
Sbjct  71   YDLESFKFEPIRESIVAREMTRRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPDIKV  130

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+EA++YVVIKHAALFTSTIM
Sbjct  131  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYDEAEDYVVIKHAALFTSTIM  190

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  191  SKVLARPNVKLFNA  204



>gb|ACF87708.1| unknown [Zea mays]
 gb|ACN36053.1| unknown [Zea mays]
 tpg|DAA58589.1| TPA: thiazole biosynthetic enzyme 1-2, Precursor [Zea mays]
Length=355

 Score =   246 bits (627),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 132/143 (92%), Gaps = 1/143 (1%)
 Frame = +2

Query  221  SVSASHTP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            S+S+S TP Y L SF+F PIKESIV+REMTRRYMTDMI +ADTDV++VGAGSAGLSCAYE
Sbjct  46   SISSSPTPPYDLTSFRFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYE  105

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKH  577
            +SK+P V VAI+EQSVSPGGGAWLGGQLFSAMVVR+PA +FLDEL V Y+EA++YVV+KH
Sbjct  106  LSKDPTVSVAIVEQSVSPGGGAWLGGQLFSAMVVRRPAHLFLDELGVGYDEAEDYVVVKH  165

Query  578  AALFTSTIMSKLLARPNVKLFNA  646
            AALFTST+MS+LLARPNVKLFNA
Sbjct  166  AALFTSTVMSRLLARPNVKLFNA  188



>gb|AFO59577.1| thiamine biosynthetic enzyme [Saccharum hybrid cultivar GT28]
Length=355

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S S+S+ PY L SF+F PIKES+V+REMTRRYMTDMI +ADTDV++VGAGSAGLSCAYE+
Sbjct  47   SFSSSNPPYDLTSFRFSPIKESVVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYEL  106

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SK+P V +AI+EQSVSPGGGAWLGGQLFSA+VVRKPA +FLDEL V Y+EA++YVVIKHA
Sbjct  107  SKDPTVSIAIVEQSVSPGGGAWLGGQLFSAVVVRKPAHLFLDELGVAYDEAEDYVVIKHA  166

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTSTIMS LLARPNVKLFNA
Sbjct  167  ALFTSTIMSALLARPNVKLFNA  188



>gb|ABK23376.1| unknown [Picea sitchensis]
Length=368

 Score =   245 bits (626),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+SFKF+PI+ESIVAREMTRRYM DMI +ADTDV++VGAGSAGLSCAYE+SKNP+++V
Sbjct  71   YDLESFKFEPIRESIVAREMTRRYMMDMITHADTDVVIVGAGSAGLSCAYELSKNPDIKV  130

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+EA++YVVIKHAALFTSTIM
Sbjct  131  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYDEAEDYVVIKHAALFTSTIM  190

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  191  SKVLARPNVKLFNA  204



>pdb|1RP0|A Chain A, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
 pdb|1RP0|B Chain B, Crystal Structure Of Thi1 Protein From Arabidopsis Thaliana
Length=284

 Score =   242 bits (618),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLS AYEISKNPNV+V
Sbjct  7    YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQV  66

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E D YVV+KHAALFTSTIM
Sbjct  67   AIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIM  126

Query  605  SKLLARPNVKLFNA  646
            SKLLARPNVKLFNA
Sbjct  127  SKLLARPNVKLFNA  140



>dbj|BAC79982.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
Length=306

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTI  601
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+E ++YVVIKHAALFTST+
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQEDYVVIKHAALFTSTV  168

Query  602  MSKLLARPNVKLFNA  646
            MS+LLARPNVKLFNA
Sbjct  169  MSRLLARPNVKLFNA  183



>gb|KFK27084.1| hypothetical protein AALP_AA8G331900 [Arabis alpina]
Length=345

 Score =   244 bits (622),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++F F PIKESIV+REMTRRYMTDMI YA+TDV+VVGAGSAGLS AYEISKNPNV+V
Sbjct  47   YDLNAFTFDPIKESIVSREMTRRYMTDMITYAETDVVVVGAGSAGLSAAYEISKNPNVQV  106

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E D YVV+KHAALFTSTIM
Sbjct  107  AIIEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEIGVAYDEQDTYVVVKHAALFTSTIM  166

Query  605  SKLLARPNVKLFNA  646
            SKLLARPNVKLFNA
Sbjct  167  SKLLARPNVKLFNA  180



>ref|NP_001105696.1| thiamine thiazole synthase 1, chloroplastic precursor [Zea mays]
 sp|Q41738.1|THI41_MAIZE RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Zea mays]
 gb|AAA96738.1| thiamine biosynthetic enzyme [Zea mays]
 gb|ACF86401.1| unknown [Zea mays]
 gb|AFW83048.1| thiazole biosynthetic enzyme 1-1, Precursor [Zea mays]
Length=354

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            + PY L SF+F PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+SK+P 
Sbjct  54   NPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPA  113

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTS  595
            V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EA++YVVIKHAALFTS
Sbjct  114  VSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHAALFTS  173

Query  596  TIMSKLLARPNVKLFNA  646
            T+MS LLARPNVKLFNA
Sbjct  174  TVMSLLLARPNVKLFNA  190



>ref|XP_009388868.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic {ECO:0000255|HAMAP-Rule:MF_03158}-like 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SF F+PI+ESIV+REMTRRYMTDMI YADTDV+V+GAGSAGLSCAYEISK+P+VRV
Sbjct  60   YDLGSFSFKPIQESIVSREMTRRYMTDMISYADTDVVVIGAGSAGLSCAYEISKDPSVRV  119

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EAD+YVV++HAALFTSTI+
Sbjct  120  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVPYDEADSYVVVRHAALFTSTIL  179

Query  605  SKLLARPNVKLFNA  646
            S+L+ARPNVKLFNA
Sbjct  180  SRLIARPNVKLFNA  193



>ref|XP_002458014.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
 sp|C5XNN6.1|THI41_SORBI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme 1; Flags: Precursor 
[Sorghum bicolor]
 gb|EES03134.1| hypothetical protein SORBIDRAFT_03g025520 [Sorghum bicolor]
Length=354

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            + PY L SFKF PIKESIV+REMTRRYMTDMI +ADTDV++VGAGSAGLSCAYE+SK+P 
Sbjct  50   NPPYDLTSFKFSPIKESIVSREMTRRYMTDMITHADTDVVIVGAGSAGLSCAYELSKDPT  109

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE-ADNYVVIKHAALFT  592
            VRVAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+E AD+YVV+KHAALFT
Sbjct  110  VRVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAADDYVVVKHAALFT  169

Query  593  STIMSKLLARPNVKLFNA  646
            ST+MS +LARPNVKLFNA
Sbjct  170  STVMSAVLARPNVKLFNA  187



>ref|XP_006657781.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Oryza 
brachyantha]
Length=351

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P++ 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSIS  108

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTI  601
            +AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+E ++YVVIKHAALFTST+
Sbjct  109  IAIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQEDYVVIKHAALFTSTV  168

Query  602  MSKLLARPNVKLFNA  646
            MS+LLARPNVKLFNA
Sbjct  169  MSRLLARPNVKLFNA  183



>gb|AFW83047.1| hypothetical protein ZEAMMB73_797739 [Zea mays]
Length=384

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            + PY L SF+F PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+SK+P 
Sbjct  54   NPPYDLTSFRFSPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKDPA  113

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTS  595
            V +AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+EA++YVVIKHAALFTS
Sbjct  114  VSIAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEAEDYVVIKHAALFTS  173

Query  596  TIMSKLLARPNVKLFNA  646
            T+MS LLARPNVKLFNA
Sbjct  174  TVMSLLLARPNVKLFNA  190



>gb|AAV92535.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+E ++YVVIKHAALFTSTIM
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYDETEDYVVIKHAALFTSTIM  165

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  166  SKVLARPNVKLFNA  179



>dbj|BAC45141.1| putative thiamine biosynthesis protein [Oryza sativa Japonica 
Group]
 gb|EAZ40087.1| hypothetical protein OsJ_24530 [Oryza sativa Japonica Group]
Length=352

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTI  601
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+E ++YVVIKHAALFTST+
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQEDYVVIKHAALFTSTV  168

Query  602  MSKLLARPNVKLFNA  646
            MS+LLARPNVKLFNA
Sbjct  169  MSRLLARPNVKLFNA  183



>gb|AAV92531.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92533.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92534.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92536.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92542.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92543.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92544.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92545.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92547.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92548.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92549.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92550.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92551.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92555.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92556.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (618),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+E ++YVVIKHAALFTSTIM
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYDETEDYVVIKHAALFTSTIM  165

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  166  SKVLARPNVKLFNA  179



>gb|AAV92539.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+E ++YVVIKHAALFTSTIM
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYDETEDYVVIKHAALFTSTIM  165

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  166  SKVLARPNVKLFNA  179



>gb|AAV92529.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92530.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92532.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92540.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92541.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92546.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+E ++YVVIKHAALFTSTIM
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYDETEDYVVIKHAALFTSTIM  165

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  166  SKVLARPNVKLFNA  179



>gb|AAV92538.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+E ++YVVIKHAALFTSTIM
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYDETEDYVVIKHAALFTSTIM  165

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  166  SKVLARPNVKLFNA  179



>ref|NP_001059841.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAC78562.1| thiamine biosynthetic enzyme [Oryza sativa Japonica Group]
 dbj|BAF21755.1| Os07g0529600 [Oryza sativa Japonica Group]
 dbj|BAG94352.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  52   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  111

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTI  601
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+E ++YVVIKHAALFTST+
Sbjct  112  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQEDYVVIKHAALFTSTV  171

Query  602  MSKLLARPNVKLFNA  646
            MS+LLARPNVKLFNA
Sbjct  172  MSRLLARPNVKLFNA  186



>gb|AAZ93636.1| pathogen-induced defense-responsive protein 8 [Oryza sativa Indica 
Group]
Length=352

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTI  601
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+E ++YVVIKHAALFTST+
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQEDYVVIKHAALFTSTV  168

Query  602  MSKLLARPNVKLFNA  646
            MS+LLARPNVKLFNA
Sbjct  169  MSRLLARPNVKLFNA  183



>gb|EAZ04139.1| hypothetical protein OsI_26282 [Oryza sativa Indica Group]
Length=353

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  242  PYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVR  421
            PY L++ +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+V 
Sbjct  49   PYDLNAIRFSPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPSVS  108

Query  422  VAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTI  601
            VA+IEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+E ++YVVIKHAALFTST+
Sbjct  109  VAVIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVAYDEQEDYVVIKHAALFTSTV  168

Query  602  MSKLLARPNVKLFNA  646
            MS+LLARPNVKLFNA
Sbjct  169  MSRLLARPNVKLFNA  183



>gb|AAV92537.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   242 bits (617),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+E ++YVVIKHAALFTSTIM
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYDETEDYVVIKHAALFTSTIM  165

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  166  SKVLARPNVKLFNA  179



>gb|AAV92552.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
 gb|AAV92553.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=343

 Score =   241 bits (616),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLHSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+E ++YVVIKHAALFTSTIM
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYDETEDYVVIKHAALFTSTIM  165

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  166  SKVLARPNVKLFNA  179



>ref|XP_010923945.1| PREDICTED: thiamine thiazole synthase, chloroplastic [Elaeis 
guineensis]
Length=360

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +2

Query  218  LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            +S SA+   Y L+S +F PIKESIV+REMTRRYMTDMI +ADTDV+V+GAGSAGLSCAYE
Sbjct  52   ISASAATPKYDLNSIRFDPIKESIVSREMTRRYMTDMITHADTDVVVIGAGSAGLSCAYE  111

Query  398  ISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKH  577
            +SK+ +V+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL V Y+E D+YVVIKH
Sbjct  112  LSKDASVQVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGVPYDEQDSYVVIKH  171

Query  578  AALFTSTIMSKLLARPNVKLFNA  646
            AALFTSTIMS+LLARPNVKLFNA
Sbjct  172  AALFTSTIMSRLLARPNVKLFNA  194



>gb|AAV92554.1| thiazole biosynthetic enzyme [Pseudotsuga menziesii var. menziesii]
Length=351

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L SFKF+PI+ESIVAREMTRRYM DMI +A+TDV++VGAGSAGLSCAYE+SKNP+V+V
Sbjct  46   YDLQSFKFEPIRESIVAREMTRRYMMDMITHAETDVVIVGAGSAGLSCAYELSKNPDVKV  105

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AIIEQSVSPGGGAWLGGQLFSAMVVRKPA +FLDE+ V Y+E ++YVVIKHAALFTSTIM
Sbjct  106  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDEIGVPYDETEDYVVIKHAALFTSTIM  165

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  166  SKVLARPNVKLFNA  179



>ref|XP_010930933.1| PREDICTED: LOW QUALITY PROTEIN: thiamine thiazole synthase 1, 
chloroplastic-like [Elaeis guineensis]
Length=358

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 111/134 (83%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+S +F+PIKESIV+REMTRRYMTDMI YADTDV+V+GAGSAGLSCAYE+SK+P+VRV
Sbjct  58   YDLNSIRFEPIKESIVSREMTRRYMTDMITYADTDVVVIGAGSAGLSCAYELSKDPSVRV  117

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL + Y+E D YVVIKHAALFTSTIM
Sbjct  118  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGIXYDEQDTYVVIKHAALFTSTIM  177

Query  605  SKLLARPNVKLFNA  646
            S+LLA PNVKLFNA
Sbjct  178  SRLLAWPNVKLFNA  191



>ref|XP_002973063.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
 gb|EFJ26284.1| hypothetical protein SELMODRAFT_271002 [Selaginella moellendorffii]
Length=356

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 130/146 (89%), Gaps = 3/146 (2%)
 Frame = +2

Query  218  LSVSASHTP---YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSC  388
            +S S S +P   Y L+ F F PIKES+VAREMTRRYMTDMI YADTDV++VGAGSAGLSC
Sbjct  45   ISCSNSISPSARYDLNKFSFDPIKESLVAREMTRRYMTDMITYADTDVVIVGAGSAGLSC  104

Query  389  AYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVV  568
            AYE+SKNPNV VA++EQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E ++YVV
Sbjct  105  AYELSKNPNVSVAVVEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEVGVPYDELEHYVV  164

Query  569  IKHAALFTSTIMSKLLARPNVKLFNA  646
            +KHAALFTSTIMSK+LARPNVKLFNA
Sbjct  165  VKHAALFTSTIMSKVLARPNVKLFNA  190



>gb|AFK49632.1| unknown [Lotus japonicus]
Length=355

 Score =   241 bits (616),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 138/155 (89%), Gaps = 3/155 (2%)
 Frame = +2

Query  191  AVKASSHHN---LSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVV  361
            ++K+++  N   +S+S +   Y L++FKF P KESIV+REMTRRYMTDMI YADTDV++V
Sbjct  35   SIKSTTQQNTTTISMSLNSPAYDLEAFKFAPTKESIVSREMTRRYMTDMITYADTDVVIV  94

Query  362  GAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            GAGSAGLSCAYE+SK+P++ +AIIEQSVSPGGGAWLGGQLFSAMVVR+PA +FL+E+ V+
Sbjct  95   GAGSAGLSCAYELSKDPSISIAIIEQSVSPGGGAWLGGQLFSAMVVREPAHLFLNEIGVD  154

Query  542  YEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            Y+E ++YVV+KHAALFTSTIMSKLLA+PNVKLFNA
Sbjct  155  YDEQEDYVVVKHAALFTSTIMSKLLAKPNVKLFNA  189



>ref|XP_008809851.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Phoenix 
dactylifera]
Length=359

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 1/137 (1%)
 Frame = +2

Query  239  TP-YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPN  415
            TP Y L+S +F PIKESIV+REMTRRYMTDMI YADTDV+VVGAGSAGLSCAYE+SK+P+
Sbjct  57   TPKYDLNSIRFDPIKESIVSREMTRRYMTDMITYADTDVVVVGAGSAGLSCAYELSKDPS  116

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTS  595
            V VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL + Y+E D+YVVIKHAALFTS
Sbjct  117  VNVAIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIPYDEQDSYVVIKHAALFTS  176

Query  596  TIMSKLLARPNVKLFNA  646
            TIMS+LLARPNVKLFNA
Sbjct  177  TIMSRLLARPNVKLFNA  193



>ref|XP_002994429.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
 gb|EFJ04508.1| hypothetical protein SELMODRAFT_163429 [Selaginella moellendorffii]
Length=356

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+ F F PIKES+VAREMTRRYMTDMI YADTDV++VGAGSAGLSCAYE+SKNPNV V
Sbjct  57   YDLNKFSFDPIKESLVAREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPNVSV  116

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            A++EQSVSPGGGAWLGGQLFSAM+VRKPA +FLDE+ V Y+E ++YVV+KHAALFTSTIM
Sbjct  117  AVVEQSVSPGGGAWLGGQLFSAMIVRKPAHLFLDEVGVPYDELEHYVVVKHAALFTSTIM  176

Query  605  SKLLARPNVKLFNA  646
            SK+LARPNVKLFNA
Sbjct  177  SKVLARPNVKLFNA  190



>ref|XP_008803216.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Phoenix 
dactylifera]
Length=355

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L+S +F PIKESIV+REMTRRYMTDMI +ADTDV+V+GAGSAGLSCAYE+SK+P+V V
Sbjct  56   YDLNSIRFNPIKESIVSREMTRRYMTDMITHADTDVVVIGAGSAGLSCAYELSKDPSVCV  115

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIM  604
            AI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FLDEL + Y+E D+YVVIKHAALFTSTIM
Sbjct  116  AIVEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLDELGIPYDEQDSYVVIKHAALFTSTIM  175

Query  605  SKLLARPNVKLFNA  646
            S+LLARPNVKLFNA
Sbjct  176  SRLLARPNVKLFNA  189



>gb|EMT30436.1| Thiazole biosynthetic enzyme 1-2, chloroplastic [Aegilops tauschii]
Length=348

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +2

Query  167  ARCFFCVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADT  346
            AR   CV   +A +  N S+S+S  PY L++FKF PIKESIV+REMTRRYMTDMI YADT
Sbjct  22   ARTPSCVATPRAGAICN-SISSSTPPYDLNAFKFSPIKESIVSREMTRRYMTDMITYADT  80

Query  347  DVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            DV++VGAGSAGLSCAYE+SK+P++ +AIIEQSVSPGGGA LGGQLFSAMVVRKPA +FLD
Sbjct  81   DVVIVGAGSAGLSCAYELSKDPSISIAIIEQSVSPGGGAGLGGQLFSAMVVRKPAHLFLD  140

Query  527  ELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EL +EY+E ++YVVIKHAALFTST+MS+LLARPNVKLFNA
Sbjct  141  ELNIEYDEQEDYVVIKHAALFTSTVMSRLLARPNVKLFNA  180



>gb|ABK95834.1| unknown [Populus trichocarpa]
Length=278

 Score =   226 bits (576),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +2

Query  302  MTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  481
            MTRRYMTDM+ YADTDV++VGAGSAGLSCAYE+SKNP+VRVAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMTDMVTYADTDVVIVGAGSAGLSCAYELSKNPSVRVAIIEQSVSPGGGAWLGGQL  60

Query  482  FSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            FSAM+VRKPA  FLDELE+EY+EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  61   FSAMIVRKPAHRFLDELEIEYDEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  115



>emb|CDM85402.1| unnamed protein product [Triticum aestivum]
Length=338

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  221  SVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI  400
            S+S+   PY L SFKF P+KES+ +REM RRYMTDMI   +TDVI++G GSAGLSCAYE+
Sbjct  42   SISSCTPPYDLSSFKFSPMKESVASREMIRRYMTDMIADVNTDVIIIGTGSAGLSCAYEL  101

Query  401  SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHA  580
            SK+P+V +AII++SVSPGG  WLG QLFSAMVVRKPA +FLDEL +EY+E ++YVVIKHA
Sbjct  102  SKDPSVNIAIIQRSVSPGGSGWLGSQLFSAMVVRKPAHLFLDELNIEYDEQEDYVVIKHA  161

Query  581  ALFTSTIMSKLLARPNVKLFNA  646
            ALFTST++S+LLARPNVKLFN 
Sbjct  162  ALFTSTVLSRLLARPNVKLFNG  183



>emb|CDY41008.1| BnaA02g27980D [Brassica napus]
Length=280

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  302  MTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  481
            MTRRYMTDMI YA+TDV+VVGAGSAGLSCAYEISKNPNV+VAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMTDMITYAETDVVVVGAGSAGLSCAYEISKNPNVQVAIIEQSVSPGGGAWLGGQL  60

Query  482  FSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            FSAM+VRKPA +FLDE+ V Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  61   FSAMIVRKPAHLFLDEIGVPYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  115



>gb|EPB86412.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 125/151 (83%), Gaps = 4/151 (3%)
 Frame = +2

Query  206  SHHNLSVSASHTPY----SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            S H L  ++ + P       D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GS
Sbjct  13   SGHRLGGASEYKPEMNYEDFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGS  72

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEA  553
            AGLSCA+E+SK+P++++AIIEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+ YEE 
Sbjct  73   AGLSCAWELSKDPSLKIAIIEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEIPYEEK  132

Query  554  DNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +NYVV+KHAALFTSTI+SKLL RPNVKLFNA
Sbjct  133  ENYVVVKHAALFTSTILSKLLMRPNVKLFNA  163



>emb|CDP05793.1| unnamed protein product [Coffea canephora]
Length=280

 Score =   219 bits (557),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  302  MTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQL  481
            MTRRYM DMI YADTDV++VGAGSAGLSCAYE+SKNP+V+VAIIEQSVSPGGGAWLGGQL
Sbjct  1    MTRRYMMDMITYADTDVVIVGAGSAGLSCAYELSKNPSVQVAIIEQSVSPGGGAWLGGQL  60

Query  482  FSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            FSAMVVRKPA +FLDEL V+Y+E DNYVVIKHAALFTSTIMSKLLARPNVKLFNA
Sbjct  61   FSAMVVRKPAHLFLDELGVDYDEQDNYVVIKHAALFTSTIMSKLLARPNVKLFNA  115



>dbj|GAN03507.1| thiamin biosynthetic enzyme [Mucor ambiguus]
Length=313

 Score =   220 bits (560),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/151 (68%), Positives = 124/151 (82%), Gaps = 4/151 (3%)
 Frame = +2

Query  206  SHHNLSVSASHTPY----SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            S H L  +  + P       D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GS
Sbjct  15   SGHRLGGANEYKPEMNYEDFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGS  74

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEA  553
            AGLSCA+E+SK+P++++AIIEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+ YEE 
Sbjct  75   AGLSCAWELSKDPSLKIAIIEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEIPYEEK  134

Query  554  DNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +NYVV+KHAALFTSTI+SKLL RPNVKLFNA
Sbjct  135  ENYVVVKHAALFTSTILSKLLMRPNVKLFNA  165



>gb|KFH67165.1| thiazole biosynthetic enzyme, chloroplastic [Mortierella verticillata 
NRRL 6337]
Length=307

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            Y L++ KF PIKE+ V+REMTRRYMTDM+ +A+TDV+V+GAGSAGLSCA+E+SKNPN++V
Sbjct  31   YDLNNLKFNPIKEADVSREMTRRYMTDMLDHAETDVVVIGAGSAGLSCAWELSKNPNIQV  90

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEAD-NYVVIKHAALFTSTI  601
             +IEQSVSPGGGAWLGGQLFSAM+VRKP Q FL E+ V +++ + NYVV+KHAALFTSTI
Sbjct  91   TVIEQSVSPGGGAWLGGQLFSAMIVRKPGQHFLAEVGVPFDDCNENYVVVKHAALFTSTI  150

Query  602  MSKLLARPNVKLFNA  646
            +SKLL RPNVKLFNA
Sbjct  151  LSKLLMRPNVKLFNA  165



>gb|EIE83081.1| thiazole biosynthetic enzyme, chloroplastic [Rhizopus delemar 
RA 99-880]
Length=305

 Score =   216 bits (551),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
             D +KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++AI
Sbjct  27   FDGYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIAI  86

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+ Y+E D+YVV+KHAALFTSTI+SK
Sbjct  87   IEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEIPYDEKDDYVVVKHAALFTSTILSK  146

Query  611  LLARPNVKLFNA  646
            +L RPNVKLFNA
Sbjct  147  ILMRPNVKLFNA  158



>emb|CEI86767.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=189

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +2

Query  248  SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVA  427
              D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++A
Sbjct  28   DFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIA  87

Query  428  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMS  607
            IIEQ+V+PGGG WLGGQLFSAMVVRKPA  FLDEL + YEE ++YVV+KHAALFTSTI+S
Sbjct  88   IIEQNVAPGGGCWLGGQLFSAMVVRKPADKFLDELGIPYEEKEDYVVVKHAALFTSTILS  147

Query  608  KLLARPNVKLFNA  646
            KLL RPNVKLFNA
Sbjct  148  KLLMRPNVKLFNA  160



>emb|CEI86769.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=273

 Score =   214 bits (544),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  248  SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVA  427
              D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++A
Sbjct  28   DFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIA  87

Query  428  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMS  607
            IIEQSV+PGGG WLGGQLFSAM+VRKPA  FLDEL++ YEE ++YVV+KHAALFTSTI+S
Sbjct  88   IIEQSVAPGGGCWLGGQLFSAMIVRKPADKFLDELDIPYEEKEDYVVVKHAALFTSTILS  147

Query  608  KLLARPNVKLFNA  646
            KLL RPNVKLFNA
Sbjct  148  KLLMRPNVKLFNA  160



>gb|EYU27823.1| hypothetical protein MIMGU_mgv1a009995mg [Erythranthe guttata]
Length=325

 Score =   215 bits (548),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 114/133 (86%), Gaps = 3/133 (2%)
 Frame = +2

Query  257  SFKFQPIKESIVAREMT---RRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVA  427
            SF   P+     A  +    +RYMTDMI YADTDV+VVGAGSAGLSCAYE+SKNP++ +A
Sbjct  25   SFHGSPVSTRAAAHPIKSGPQRYMTDMITYADTDVVVVGAGSAGLSCAYELSKNPDINIA  84

Query  428  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMS  607
            IIEQSVSPGGGAWLGGQLFSAMVVRKPA  FLDELE+EY+E D+YVVIKHAALFTSTIMS
Sbjct  85   IIEQSVSPGGGAWLGGQLFSAMVVRKPAHKFLDELEIEYDEQDHYVVIKHAALFTSTIMS  144

Query  608  KLLARPNVKLFNA  646
            KLLA+PNVKLFNA
Sbjct  145  KLLAKPNVKLFNA  157



>emb|CEG62855.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=307

 Score =   214 bits (545),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
             D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++AI
Sbjct  29   FDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIAI  88

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IEQSV+PGGG WLGGQLFSAM+VRKPA  FLDEL++ YEE ++YVV+KHAALFTSTI+SK
Sbjct  89   IEQSVAPGGGCWLGGQLFSAMIVRKPADKFLDELDIPYEEKEDYVVVKHAALFTSTILSK  148

Query  611  LLARPNVKLFNA  646
            LL RPNVKLFNA
Sbjct  149  LLMRPNVKLFNA  160



>emb|CEP18429.1| hypothetical protein [Parasitella parasitica]
Length=309

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
             D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+ ++++AI
Sbjct  31   FDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDASLKIAI  90

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IEQSVSPGGG WLGGQLFSAMVVRKPA  FLDELE+ Y+E +NYVV+KHAALFTSTI+SK
Sbjct  91   IEQSVSPGGGCWLGGQLFSAMVVRKPADKFLDELEIPYDEKENYVVVKHAALFTSTILSK  150

Query  611  LLARPNVKLFNA  646
            LL RPNVKLFNA
Sbjct  151  LLMRPNVKLFNA  162



>ref|XP_005648929.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
 gb|EIE24385.1| thiazole biosynthetic enzyme [Coccomyxa subellipsoidea C-169]
Length=317

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 123/150 (82%), Gaps = 2/150 (1%)
 Frame = +2

Query  197  KASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSA  376
            +A+  H L+ + S TP+  D+FKF+PI E  V+R MT RY  D+  YA+TDVI+VGAGSA
Sbjct  7    RAADAHRLNQAFSETPF--DNFKFEPITEHQVSRAMTSRYFKDLDEYAETDVIIVGAGSA  64

Query  377  GLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEAD  556
            GLSCAYE+SK PNV+VAIIEQ V+PGGGAWLGGQLFSAMVVRKPA   LDELEV YE+  
Sbjct  65   GLSCAYELSKYPNVKVAIIEQGVAPGGGAWLGGQLFSAMVVRKPAHTILDELEVPYEDEG  124

Query  557  NYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            ++VVIKHA+LFTSTI+SK+L  PN+KLFNA
Sbjct  125  DFVVIKHASLFTSTILSKVLQAPNIKLFNA  154



>emb|CEG76808.1| Putative Thiamine thiazole synthase [Rhizopus microsporus]
Length=261

 Score =   211 bits (538),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +2

Query  248  SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVA  427
              D++KF PI+ES V+REM  RYM DM+ YA++DV++VG GSAGLSCA+E+SK+P++++A
Sbjct  28   DFDNYKFAPIRESQVSREMVTRYMNDMLHYAESDVVIVGCGSAGLSCAWELSKDPSLKIA  87

Query  428  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMS  607
            IIEQ+V+PGGG WLGGQLFSAM+VRKPA  FLDEL++ Y+E ++YVV+KHAALFTSTI+S
Sbjct  88   IIEQNVAPGGGCWLGGQLFSAMIVRKPADKFLDELDIPYDEKEDYVVVKHAALFTSTILS  147

Query  608  KLLARPNVKLFNA  646
            KLL RPNVKLFNA
Sbjct  148  KLLMRPNVKLFNA  160



>ref|XP_006441062.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
 gb|ESR54302.1| hypothetical protein CICLE_v10024231mg [Citrus clementina]
Length=353

 Score =   214 bits (544),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 114/132 (86%), Gaps = 8/132 (6%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
            LD+FKF  IKESIV+RE TRRYMTDMI +ADTDV+VVGAGSAGLSCAYEISKNPNV+VAI
Sbjct  76   LDAFKFDAIKESIVSRETTRRYMTDMITHADTDVVVVGAGSAGLSCAYEISKNPNVQVAI  135

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IEQSVSPGG         S  VVRKPA +FLDEL ++Y+E DNYVVIKHAALFTSTIMSK
Sbjct  136  IEQSVSPGGA--------SGSVVRKPAHLFLDELGIDYDEQDNYVVIKHAALFTSTIMSK  187

Query  611  LLARPNVKLFNA  646
            LLARPNVKLFNA
Sbjct  188  LLARPNVKLFNA  199



>gb|KDO47270.1| hypothetical protein CISIN_1g039605mg [Citrus sinensis]
Length=352

 Score =   213 bits (543),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 114/132 (86%), Gaps = 8/132 (6%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
            LD+FKF  IKESIV+RE TRRYMTDMI +ADTDV+VVGAGSAGLSCAYEISKNPNV+VAI
Sbjct  76   LDAFKFDAIKESIVSRETTRRYMTDMITHADTDVVVVGAGSAGLSCAYEISKNPNVQVAI  135

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IEQSVSPGG         S  VVRKPA +FLDEL ++Y+E DNYVVIKHAALFTSTIMSK
Sbjct  136  IEQSVSPGGA--------SGSVVRKPAHLFLDELGIDYDEQDNYVVIKHAALFTSTIMSK  187

Query  611  LLARPNVKLFNA  646
            LLARPNVKLFNA
Sbjct  188  LLARPNVKLFNA  199



>gb|EPB91714.1| thiazole biosynthetic enzyme, chloroplastic [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=310

 Score =   212 bits (539),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 121/152 (80%), Gaps = 4/152 (3%)
 Frame = +2

Query  203  SSHHNLSVSASHTP----YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            +S H L     + P       + +KF PI+ES V+REM  RYM DM+ YA++DV++VG G
Sbjct  12   ASGHRLGGPNEYKPDMKYEDFNGYKFAPIRESQVSREMVTRYMNDMLYYAESDVVIVGCG  71

Query  371  SAGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            SA LSCA+E+SK+ ++++AIIEQSVSPGGG WLGGQLFSAMVVRKPAQ FLDEL+V Y+E
Sbjct  72   SANLSCAWELSKDSSLKIAIIEQSVSPGGGCWLGGQLFSAMVVRKPAQKFLDELDVPYDE  131

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             D YVV+KHAALFTSTI+SKLL RPNVKLFNA
Sbjct  132  KDTYVVVKHAALFTSTILSKLLMRPNVKLFNA  163



>ref|XP_004496859.1| PREDICTED: thiamine thiazole synthase, chloroplastic-like [Cicer 
arietinum]
Length=360

 Score =   213 bits (542),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 128/151 (85%), Gaps = 2/151 (1%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            +K++SH+N S+S S   ++L SFKF+PI+ESIV+RE++R Y+T+M+ Y  TDV+++G  S
Sbjct  71   IKSTSHNNSSISMSLNTHNLHSFKFKPIEESIVSREISRCYITNMVTY--TDVVILGDSS  128

Query  374  AGLSCAYEISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEA  553
            +GLSCAY +SKNPN+ +AIIEQSVSPGGGAWL GQL SAMVVRKP  +FLDE+EV+Y+E 
Sbjct  129  SGLSCAYGLSKNPNIGIAIIEQSVSPGGGAWLDGQLLSAMVVRKPVDLFLDEIEVDYDER  188

Query  554  DNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            + YVVIKH ALFTSTI+SKLL R N+KLFNA
Sbjct  189  EEYVVIKHVALFTSTILSKLLVRSNMKLFNA  219



>ref|XP_002784437.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER16233.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=325

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = +2

Query  245  YSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRV  424
            YS +  +F PI+ES V+REMT RYM D+  +ADTDV++ GAGSAGLS AYE+SKNPNV+V
Sbjct  27   YSPEFSRFAPIRESEVSREMTTRYMKDLYDFADTDVVITGAGSAGLSAAYELSKNPNVKV  86

Query  425  AIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEAD-NYVVIKHAALFTSTI  601
            A+I+Q V+PGGGAWLGGQLFS+MVVRKPA +FL+E+ VEY++A  NYVV+KHA LFTSTI
Sbjct  87   ALIDQGVAPGGGAWLGGQLFSSMVVRKPAHLFLNEVGVEYDDASPNYVVVKHAGLFTSTI  146

Query  602  MSKLLARPNVKLFNA  646
            MSK+LARPNVKLFNA
Sbjct  147  MSKVLARPNVKLFNA  161



>gb|ACV52582.1| thiazole biosynthetic enzyme [Nicotiana benthamiana]
Length=160

 Score =   201 bits (511),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +2

Query  215  NLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAY  394
            ++S  +S  PY L++F F PIKESIV+REMTRRYMTDMI YADTDV++VGAGSAGLSCAY
Sbjct  45   SMSADSSPPPYDLNAFSFNPIKESIVSREMTRRYMTDMITYADTDVVIVGAGSAGLSCAY  104

Query  395  EISKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
            EISKNPNV+VAI+EQSVSPGGGAWLGGQLFSAMVVRKPA +FL+EL ++Y+E DNY
Sbjct  105  EISKNPNVQVAILEQSVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEQDNY  160



>ref|XP_009844132.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 ref|XP_009844133.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
 gb|ETV66357.1| thiazole biosynthesis enzyme [Aphanomyces astaci]
 gb|ETV66358.1| thiazole biosynthesis enzyme, variant 1 [Aphanomyces astaci]
Length=333

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A  TP+  D + F P+KE+ V+REMT RYM DM  +AD+DVI+ GAGSAGL  AYE+SK
Sbjct  41   AARTTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSK  98

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAAL  586
            +PN+RVAIIEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+ Y+   ++VVIKHAAL
Sbjct  99   HPNIRVAIIEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEIPYDTKGDHVVIKHAAL  158

Query  587  FTSTIMSKLLARPNVKLFNA  646
            FTSTIMSK+L   N+KLFNA
Sbjct  159  FTSTIMSKVLKADNIKLFNA  178



>gb|KDO30626.1| hypothetical protein SPRG_04526 [Saprolegnia parasitica CBS 223.65]
Length=334

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A  TP+  D + F P+KE+ V+REMT RYM DM  YAD+DVI+ GAGSAGL  AYE+SK
Sbjct  42   NARSTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDYADSDVIIAGAGSAGLCAAYELSK  99

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAAL  586
             PNVRVAIIEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+ Y+  +++VVIKHAAL
Sbjct  100  YPNVRVAIIEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEIPYDVKEDHVVIKHAAL  159

Query  587  FTSTIMSKLLARPNVKLFNA  646
            FTST+M+K+L   N+KLFNA
Sbjct  160  FTSTVMAKVLKADNIKLFNA  179



>ref|XP_008616182.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
 gb|EQC30329.1| thiamine biosynthetic enzyme [Saprolegnia diclina VS20]
Length=334

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = +2

Query  227  SASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK  406
            +A  TP+  D + F P+KE+ V+REMT RYM DM  +AD+DVI+ GAGSAGL  AYE+SK
Sbjct  42   NARSTPF--DGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSK  99

Query  407  NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAAL  586
             PN+RVAIIEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+ Y+  +++VVIKHAAL
Sbjct  100  YPNIRVAIIEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEIPYDVKEDHVVIKHAAL  159

Query  587  FTSTIMSKLLARPNVKLFNA  646
            FTST+MSK+L   N+KLFNA
Sbjct  160  FTSTVMSKVLKADNIKLFNA  179



>ref|XP_008877253.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
 ref|XP_008877254.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94050.1| thiazole biosynthetic enzyme, chloroplastic [Aphanomyces invadans]
 gb|ETV94051.1| thiazole biosynthetic enzyme, chloroplastic, variant [Aphanomyces 
invadans]
Length=333

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 111/132 (84%), Gaps = 0/132 (0%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNVRVAI  430
             D + F P+KE+ V+REMT RYM DM  +AD+DVI+ GAGSAGL  AYE+SK+PN+RVAI
Sbjct  47   FDGYTFAPVKEAEVSREMTTRYMKDMYDFADSDVIIAGAGSAGLCAAYELSKHPNIRVAI  106

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IEQSV+PGGGAWLGGQLFS+M+VRKPA  FLDELE+ Y+   ++VVIKHAALFTST+MSK
Sbjct  107  IEQSVAPGGGAWLGGQLFSSMIVRKPAHHFLDELEIPYDTKGDHVVIKHAALFTSTVMSK  166

Query  611  LLARPNVKLFNA  646
            +L   N+KLFNA
Sbjct  167  VLKASNIKLFNA  178



>ref|XP_005847930.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
 gb|EFN55828.1| hypothetical protein CHLNCDRAFT_22703 [Chlorella variabilis]
Length=300

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = +2

Query  239  TPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNV  418
            TP+  D FKF+ I+ES ++R MT+RY  D+  +A+ DV++VGAGSAGLSCAYE+SK P++
Sbjct  3    TPF--DGFKFESIRESQISRAMTQRYFQDLHDHAEVDVVIVGAGSAGLSCAYELSKYPDL  60

Query  419  RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTST  598
            RVAIIEQ V+PGGGAWLGGQLFSAM +RKPA   +DELEV Y++  ++VV+KHAAL TST
Sbjct  61   RVAIIEQGVAPGGGAWLGGQLFSAMCIRKPAHKLMDELEVPYDDEGSFVVVKHAALMTST  120

Query  599  IMSKLLARPNVKLFNA  646
            ++SK+LA PN+KLFNA
Sbjct  121  LLSKVLAAPNIKLFNA  136



>emb|CAA57779.1| nmt2 [Schizosaccharomyces pombe]
Length=301

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +2

Query  221  SVSASHTPYSLD-SFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            ++S ++  YSLD SF F PI+ES V+R MTRRY +D+  YA++D+++VGAGSAGL+ AY 
Sbjct  35   ALSKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYY  94

Query  398  I-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            I ++ P++++AIIE SV+PGGGAWLGGQLFSAMVVRKPA +FL+E+ V YE+  +YVV+K
Sbjct  95   IGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYEDEGDYVVVK  154

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTST+M++ LA PNVKLFNA
Sbjct  155  HAALFTSTVMARTLALPNVKLFNA  178



>gb|ABR01228.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01230.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
 gb|ABR01236.1| thiazole biosynthetic enzyme [Chlorella vulgaris]
Length=340

 Score =   195 bits (495),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 112/136 (82%), Gaps = 2/136 (1%)
 Frame = +2

Query  239  TPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKNPNV  418
            TP+  D FKF+ I+ES ++R MT RY  D+  +A+ DV++VGAGSAGLSCAYE+SK P++
Sbjct  46   TPF--DGFKFESIRESQISRAMTSRYFQDLHDHAEVDVVIVGAGSAGLSCAYELSKYPDI  103

Query  419  RVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTST  598
            RVAIIEQ V+PGGGAWLGGQLFSAM +RKPA   LDELEV Y++   +VV+KHAAL T+T
Sbjct  104  RVAIIEQGVAPGGGAWLGGQLFSAMCIRKPAHKLLDELEVAYDDEGTFVVVKHAALMTAT  163

Query  599  IMSKLLARPNVKLFNA  646
            ++SK+LA PN+KLFNA
Sbjct  164  LLSKVLAAPNIKLFNA  179



>ref|NP_596642.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 sp|P40998.2|THI4_SCHPO RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Schizosaccharomyces pombe 972h-]
 emb|CAA21093.1| thiazole biosynthetic enzyme [Schizosaccharomyces pombe]
Length=328

 Score =   194 bits (493),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +2

Query  221  SVSASHTPYSLD-SFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYE  397
            ++S ++  YSLD SF F PI+ES V+R MTRRY +D+  YA++D+++VGAGSAGL+ AY 
Sbjct  35   ALSKAYPTYSLDESFSFAPIRESTVSRAMTRRYFSDLDKYAESDIVIVGAGSAGLTAAYY  94

Query  398  I-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIK  574
            I ++ P++++AIIE SV+PGGGAWLGGQLFSAMVVRKPA +FL+E+ V YE+  +YVV+K
Sbjct  95   IGTRRPDLKIAIIEASVAPGGGAWLGGQLFSAMVVRKPADLFLNEIGVPYEDEGDYVVVK  154

Query  575  HAALFTSTIMSKLLARPNVKLFNA  646
            HAALFTST+M++ LA PNVKLFNA
Sbjct  155  HAALFTSTVMARTLALPNVKLFNA  178



>ref|XP_005834399.1| putative THI4, thiamine [Guillardia theta CCMP2712]
 gb|EKX47419.1| putative THI4, thiamine [Guillardia theta CCMP2712]
Length=325

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 119/152 (78%), Gaps = 8/152 (5%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            V A +H   S     TP+  D +KF+PI+E+ V R MT RY  D+  YA++D+++VGAGS
Sbjct  27   VPAQAHQQPS-----TPF--DGYKFEPIREATVNRAMTSRYFRDLEAYAESDIVIVGAGS  79

Query  374  AGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            AGLSCAYE+SK  P+V+VAIIEQ+V+PGGGAWLGGQLFSAMV+RKPA + LDELEV YE+
Sbjct  80   AGLSCAYELSKIAPDVKVAIIEQNVAPGGGAWLGGQLFSAMVIRKPAHLLLDELEVPYED  139

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
              +YVV KHAAL TST++SK+L   NVKLFNA
Sbjct  140  EGSYVVCKHAALMTSTLLSKVLKNGNVKLFNA  171



>emb|CAH25337.1| thiazole biosynthetic enzyme [Guillardia theta]
Length=328

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 119/152 (78%), Gaps = 8/152 (5%)
 Frame = +2

Query  194  VKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGS  373
            V A +H   S     TP+  D +KF+PI+E+ V R MT RY  D+  YA++D+++VGAGS
Sbjct  30   VPAQAHQQPS-----TPF--DGYKFEPIREATVNRAMTSRYFRDLEAYAESDIVIVGAGS  82

Query  374  AGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE  550
            AGLSCAYE+SK  P+V+VAIIEQ+V+PGGGAWLGGQLFSAMV+RKPA + LDELEV YE+
Sbjct  83   AGLSCAYELSKIAPDVKVAIIEQNVAPGGGAWLGGQLFSAMVIRKPAHLLLDELEVPYED  142

Query  551  ADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
              +YVV KHAAL TST++SK+L   NVKLFNA
Sbjct  143  EGSYVVCKHAALMTSTLLSKVLKNGNVKLFNA  174



>gb|EMG50374.1| hypothetical protein G210_4595 [Candida maltosa Xu316]
Length=329

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            ++FKF PI+ES VAREM RRY  D+  YA++DV+V+G GSAG S AY ++KN P++++AI
Sbjct  42   ENFKFAPIRESQVAREMGRRYFQDLDKYAESDVVVIGGGSAGFSAAYTLAKNRPDLKIAI  101

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD+L +EYE+  NYVV+KHAALF ST+MSK
Sbjct  102  IEASVSPGGGCWLGGQLFSAMVLRKPADLFLDDLGLEYEDQGNYVVVKHAALFMSTLMSK  161

Query  611  LLARPNVKLFNA  646
             LA PNVKLFNA
Sbjct  162  TLALPNVKLFNA  173



>ref|XP_009853231.1| hypothetical protein NEUTE1DRAFT_95662 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO55392.1| hypothetical protein NEUTE1DRAFT_95662 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ69381.1| CyPBP37 protein [Neurospora tetrasperma FGSC 2509]
Length=344

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+F F PI+ES V+R MTRRY  D+  +A+TD+++VGAGS GLSCAY +S   P++R+ I
Sbjct  50   DAFTFSPIRESTVSRAMTRRYFADLDAHAETDIVIVGAGSCGLSCAYVLSTLRPDLRITI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            +E  V+PGGGAWLGGQLFSAMV+RKPA VFLDE+ V YE+  +YVV+KHAALFTST++SK
Sbjct  110  VEAGVAPGGGAWLGGQLFSAMVMRKPADVFLDEVGVPYEDEGDYVVVKHAALFTSTVLSK  169

Query  611  LLARPNVKLFNA  646
            +L RPNVKLFNA
Sbjct  170  VLQRPNVKLFNA  181



>ref|XP_007376158.1| hypothetical protein SPAPADRAFT_51398 [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW31380.1| hypothetical protein SPAPADRAFT_51398 [Spathaspora passalidarum 
NRRL Y-27907]
Length=353

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  Y ++DV++VGAGSAGLS AY ++KN P++++AI
Sbjct  44   DKFKFAPIRESTVSRAMTRRYFADLDKYTESDVVIVGAGSAGLSAAYVLAKNRPDLKIAI  103

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDEL++ Y++  +YVV+KHAALF ST+MSK
Sbjct  104  IEASVSPGGGCWLGGQLFSAMVLRKPANIFLDELDIAYDDEGDYVVVKHAALFMSTLMSK  163

Query  611  LLARPNVKLFNA  646
            +L  PNVKLFNA
Sbjct  164  VLQFPNVKLFNA  175



>gb|KIW79545.1| thiamine thiazole synthase [Fonsecaea pedrosoi CBS 271.37]
Length=329

 Score =   192 bits (489),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            A+KA+  HN  +      +  D+FKF PI+ES V+R MTRRY  D+  YA++DV++VGAG
Sbjct  31   ALKAAGEHNNLLEQFGDKW--DAFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAG  88

Query  371  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            S GLS AY ++K  P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V YE
Sbjct  89   SCGLSTAYTLAKARPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDIGVPYE  148

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +  NYVV+KHAALF ST+MSK+LA PNVKLFNA
Sbjct  149  DEGNYVVVKHAALFMSTLMSKVLAMPNVKLFNA  181



>gb|KDB14289.1| thiazole biosynthetic enzyme variant 1 [Ustilaginoidea virens]
Length=321

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            DSFKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K+ P++++ I
Sbjct  43   DSFKFAPIRESQVSRAMTRRYFRDLDTYAESDIVIVGAGSCGLSAAYVLGKHRPDLKICI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  103  IEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDEGNYVVVKHAALFTSTIMSK  162

Query  611  LLARPNVKLFNA  646
            +LA PNVK+FNA
Sbjct  163  VLALPNVKMFNA  174



>ref|XP_003044703.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 sp|C7Z8P6.1|THI4_NECH7 RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Nectria haematococca mpVI 77-13-4]
 gb|EEU38990.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=322

 Score =   191 bits (486),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = +2

Query  206  SHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLS  385
            S +N + +        D FKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS
Sbjct  28   SKNNTTATIEEMEGKWDDFKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLS  87

Query  386  CAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
             AY + K  P++R+AIIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE+  NY
Sbjct  88   AAYILGKKRPDLRIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREVGVPYEDEGNY  147

Query  563  VVIKHAALFTSTIMSKLLARPNVKLFNA  646
            VV+KHAALFTSTIMSK+L  PN+KLFNA
Sbjct  148  VVVKHAALFTSTIMSKVLQLPNIKLFNA  175



>ref|XP_001386426.1| hypothetical protein PICST_50942 [Scheffersomyces stipitis CBS 
6054]
 gb|ABN68397.1| predicted protein [Scheffersomyces stipitis CBS 6054]
Length=351

 Score =   192 bits (488),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            ++FKF PI+ES V+R MT+RY  D+  Y ++DV++VGAGSAGLS AY ++KN PN+++AI
Sbjct  43   ENFKFAPIRESTVSRAMTKRYFADLDKYTESDVVIVGAGSAGLSAAYVLAKNRPNLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDELE++Y++  +YVV+KHAALF ST++SK
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDELEIQYDDEGDYVVVKHAALFMSTLLSK  162

Query  611  LLARPNVKLFNA  646
            +L  PNVKLFNA
Sbjct  163  VLQFPNVKLFNA  174



>gb|KIW92677.1| thiamine thiazole synthase [Cladophialophora bantiana CBS 173.52]
Length=331

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            A+ A++ H+ +          D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAG
Sbjct  31   ALTAANEHDNNSLLEQFGGKWDGFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAG  90

Query  371  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            S GLS AY ++K  P++++A+IE SVSPGGG WLGGQLFSAMV+RKPA+ FL++++V YE
Sbjct  91   SCGLSTAYTLAKARPDLKIAVIEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDIDVPYE  150

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +  NYVV+KHAALF ST+MSK+LA PNVKLFNA
Sbjct  151  DEGNYVVVKHAALFMSTLMSKVLAMPNVKLFNA  183



>ref|XP_007807526.1| thiazole biosynthetic enzyme variant 1 [Metarhizium acridum CQMa 
102]
 gb|EFY92948.1| thiazole biosynthetic enzyme variant 1 [Metarhizium acridum CQMa 
102]
Length=350

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 119/153 (78%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            AVKA S++  ++      +  D+FKF PI+ES V+R MTRRY  D+  YA++D++++GAG
Sbjct  53   AVKAGSNNTQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFKDLDAYAESDIVIIGAG  110

Query  371  SAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            S GLS AY + K  P++++ IIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE
Sbjct  111  SCGLSAAYVLGKQRPDLKICIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYE  170

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +  NYVV+KHAALFTSTIMSK+L+ PNVK+FNA
Sbjct  171  DEGNYVVVKHAALFTSTIMSKVLSLPNVKMFNA  203



>gb|KIY92671.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=351

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  239  TPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPN  415
            TP+  D ++F PI+E+ V+R MT RY  D+  YA+ DVI+ GAGSAGL+CAYE+SK  P+
Sbjct  54   TPF--DDYRFAPIREATVSRAMTSRYFKDLDSYAEADVIIAGAGSAGLACAYELSKLAPD  111

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTS  595
             R+AIIEQ+VSPGGGAWLGGQLFSAMV+RKP Q  LDEL V YE+  +YVV++HAAL T+
Sbjct  112  ARIAIIEQNVSPGGGAWLGGQLFSAMVIRKPGQAILDELAVPYEDEGDYVVVRHAALMTA  171

Query  596  TIMSKLLARPNVKLFNA  646
            T++SK+L  PNVKLFNA
Sbjct  172  TLLSKVLQAPNVKLFNA  188



>gb|EDK40113.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=332

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D F F PI+ES V+R MT+RY  D+  YA++DV++VGAGSAGLS AY ++KN P +++AI
Sbjct  44   DKFHFAPIRESAVSRAMTKRYFADLDKYAESDVVIVGAGSAGLSAAYVLAKNRPELKIAI  103

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDEL + YE+  NYVV+KHAALF ST+MSK
Sbjct  104  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDELNIAYEDEGNYVVVKHAALFMSTLMSK  163

Query  611  LLARPNVKLFNA  646
            +L  PNVKLFNA
Sbjct  164  VLEFPNVKLFNA  175



>ref|XP_001483482.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC 
6260]
Length=332

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D F F PI+ES V+R MT+RY  D+  YA++DV++VGAGSAGLS AY ++KN P +++AI
Sbjct  44   DKFHFAPIRESAVSRAMTKRYFADLDKYAESDVVIVGAGSAGLSAAYVLAKNRPELKIAI  103

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLDEL + YE+  NYVV+KHAALF ST+MSK
Sbjct  104  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDELNIAYEDEGNYVVVKHAALFMSTLMSK  163

Query  611  LLARPNVKLFNA  646
            +L  PNVKLFNA
Sbjct  164  VLEFPNVKLFNA  175



>gb|KID90425.1| thiazole biosynthetic enzyme variant 1 [Metarhizium guizhouense 
ARSEF 977]
Length=323

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 119/153 (78%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            AVKA S++  ++      +  D+FKF PI+ES V+R MTRRY  D+  YA++D++++GAG
Sbjct  26   AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFKDLDTYAESDIVIIGAG  83

Query  371  SAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            S GLS AY + K  P++++ IIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE
Sbjct  84   SCGLSAAYVLGKQRPDLKICIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYE  143

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +  NYVV+KHAALFTSTIMSK+L+ PN+K+FNA
Sbjct  144  DEGNYVVVKHAALFTSTIMSKVLSLPNIKMFNA  176



>gb|KID99833.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
majus ARSEF 297]
Length=323

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 119/153 (78%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            AVKA S++  ++      +  D+FKF PI+ES V+R MTRRY  D+  YA++D++++GAG
Sbjct  26   AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFQDLDTYAESDIVIIGAG  83

Query  371  SAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            S GLS AY + K  P++++ IIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE
Sbjct  84   SCGLSAAYVLGKQRPDLKICIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYE  143

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +  NYVV+KHAALFTSTIMSK+L+ PN+K+FNA
Sbjct  144  DEGNYVVVKHAALFTSTIMSKVLSLPNIKMFNA  176



>ref|XP_007821738.1| thiazole biosynthetic enzyme variant 1 [Metarhizium robertsii 
ARSEF 23]
 gb|EFY99491.1| thiazole biosynthetic enzyme variant 1 [Metarhizium robertsii 
ARSEF 23]
 gb|EXV04465.1| Thi4 family protein [Metarhizium robertsii]
 gb|KFG84393.1| thiazole biosynthetic enzyme variant 1 [Metarhizium anisopliae]
 gb|KID68776.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
anisopliae ARSEF 549]
 gb|KID80311.1| thiazole biosynthetic enzyme variant 1, partial [Metarhizium 
brunneum ARSEF 3297]
Length=323

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 119/153 (78%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            AVKA S++  ++      +  D+FKF PI+ES V+R MTRRY  D+  YA++D++++GAG
Sbjct  26   AVKAGSNNAQTIEEMMGQW--DNFKFAPIRESQVSRAMTRRYFKDLDTYAESDIVIIGAG  83

Query  371  SAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            S GLS AY + K  P++++ IIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE
Sbjct  84   SCGLSAAYVLGKQRPDLKICIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYE  143

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +  NYVV+KHAALFTSTIMSK+L+ PN+K+FNA
Sbjct  144  DEGNYVVVKHAALFTSTIMSKVLSLPNIKMFNA  176



>ref|XP_002548228.1| hypothetical protein CTRG_02525 [Candida tropicalis MYA-3404]
 gb|EER33707.1| hypothetical protein CTRG_02525 [Candida tropicalis MYA-3404]
Length=329

 Score =   191 bits (485),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/154 (60%), Positives = 116/154 (75%), Gaps = 4/154 (3%)
 Frame = +2

Query  188  QAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGA  367
            Q VK +S    +V   H+    + F F PI+ES VAR M +RY  D+  YA++D++VVG 
Sbjct  23   QTVKLTSE---AVDGKHSFADWEKFNFAPIRESQVARAMGKRYFADLDKYAESDIVVVGG  79

Query  368  GSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEY  544
            GSAG S AY ++KN P++++AIIE SVSPGGG WLGGQLFSAMVVRKP  +FLD+L +EY
Sbjct  80   GSAGFSAAYVMAKNRPDLKIAIIEASVSPGGGCWLGGQLFSAMVVRKPGDLFLDDLGLEY  139

Query  545  EEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            E+  NYVV+KHAALF ST+MSK LA PNVKLFNA
Sbjct  140  EDEGNYVVVKHAALFMSTLMSKTLAFPNVKLFNA  173



>gb|KIY99977.1| thiamine biosynthetic enzyme [Monoraphidium neglectum]
Length=359

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +2

Query  251  LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVA  427
             D ++F PI+E+ V+R MT RY  D+  YA+ DV++ GAGSAGL+CAYE+SK  P+ ++A
Sbjct  65   FDDYRFAPIREATVSRAMTSRYFKDLDTYAEADVVIAGAGSAGLACAYELSKLAPDAKIA  124

Query  428  IIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMS  607
            IIEQ+VSPGGGAWLGGQLFSAMV+RKP Q  LDEL V YE+  +YVV+KHAAL TST++S
Sbjct  125  IIEQNVSPGGGAWLGGQLFSAMVIRKPGQAILDELAVPYEDEGDYVVVKHAALMTSTLLS  184

Query  608  KLLARPNVKLFNA  646
            K+L  PNVKLFNA
Sbjct  185  KVLQAPNVKLFNA  197



>ref|XP_007913237.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
 gb|EOO01967.1| putative thiazole biosynthetic enzyme protein [Togninia minima 
UCRPA7]
Length=326

 Score =   190 bits (483),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+F F PI+ES V+R MTRRY +D+  YA++D++++GAGS GLS AY + K  P++++AI
Sbjct  45   DTFTFNPIRESQVSRAMTRRYFSDLDTYAESDIVIIGAGSCGLSAAYTLGKARPDLKIAI  104

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE  VSPGGGAWLGGQLFSAMV+RKPA+VFLD++ V YE+  N+VV+KHAALFTST++SK
Sbjct  105  IEAGVSPGGGAWLGGQLFSAMVMRKPAEVFLDDIGVPYEDEGNFVVVKHAALFTSTVLSK  164

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  165  VLQFPNIKLFNA  176



>gb|KHN95056.1| thiazole biosynthetic enzyme variant 1 [Metarhizium album ARSEF 
1941]
Length=321

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            DSFKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS AY + K  P++++ I
Sbjct  43   DSFKFAPIRESQVSRAMTRRYFRDLDTYAESDIVIIGAGSCGLSAAYVLGKQRPDLKICI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  103  IEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDEGNYVVVKHAALFTSTIMSK  162

Query  611  LLARPNVKLFNA  646
            +L+ PNVK+FNA
Sbjct  163  VLSLPNVKMFNA  174



>gb|KIX99472.1| thiamine thiazole synthase [Fonsecaea multimorphosa CBS 102226]
Length=329

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  50   DGFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSCGLSTAYTLAKARPDLKIAI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V YE+  NYVV+KHAALF ST+MSK
Sbjct  110  IEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDIGVPYEDQGNYVVVKHAALFMSTLMSK  169

Query  611  LLARPNVKLFNA  646
            +LA PNVKLFNA
Sbjct  170  VLAMPNVKLFNA  181



>ref|XP_007835960.1| Thiamine thiazole synthase [Pestalotiopsis fici W106-1]
 gb|ETS79335.1| Thiamine thiazole synthase [Pestalotiopsis fici W106-1]
Length=326

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 117/148 (79%), Gaps = 2/148 (1%)
 Frame = +2

Query  209  HHNLSVSASHTPYS-LDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLS  385
            H N+ V+      S  + F FQPI+ES +AREM RRY  D+  YA++D++++GAGS GLS
Sbjct  29   HSNMEVATGAAVGSKWEDFTFQPIRESQIAREMARRYFADLDKYAESDIVIIGAGSCGLS  88

Query  386  CAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNY  562
             AY ++K  P++++AIIE SVSPGGGAWLGGQLFSAM++RKPA  FL+E+ V ++  +NY
Sbjct  89   TAYTLAKARPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRKPADAFLEEIGVPFDVEENY  148

Query  563  VVIKHAALFTSTIMSKLLARPNVKLFNA  646
            VV+KHAALFTST+MSK+LA PNVKLFNA
Sbjct  149  VVVKHAALFTSTLMSKVLAFPNVKLFNA  176



>ref|XP_007745751.1| thiazole biosynthetic enzyme, mitochondrial [Cladophialophora 
psammophila CBS 110553]
 gb|EXJ69899.1| thiazole biosynthetic enzyme, mitochondrial [Cladophialophora 
psammophila CBS 110553]
Length=331

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = +2

Query  185  VQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVG  364
            V    A+ H+N S+    +    D FKF PI+ES V+R MTRRY  D+  YA++DV++VG
Sbjct  30   VALTAANEHYNNSLLEQFSG-KWDGFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVG  88

Query  365  AGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVE  541
            AGS GLS AY ++K  P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V 
Sbjct  89   AGSCGLSTAYTLAKARPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDIGVP  148

Query  542  YEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            YE+  NYVV++HAALF ST+MSK+LA PNVKLFNA
Sbjct  149  YEDEGNYVVVRHAALFMSTLMSKVLAMPNVKLFNA  183



>ref|XP_007591792.1| thiazole biosynthetic enzyme [Colletotrichum fioriniae PJ7]
 gb|EXF84591.1| thiazole biosynthetic enzyme [Colletotrichum fioriniae PJ7]
Length=326

 Score =   189 bits (481),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            DSFKF PI+ES V+R MTRRY +D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  47   DSFKFAPIRESQVSRAMTRRYFSDLDTYAESDVVIVGAGSCGLSTAYVLAKTRPDLKIAI  106

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            +E  V+PGGGAWLGGQLFSAMV+RKPAQVFLDE+ V YE+  ++VV+KHAALFTST+MSK
Sbjct  107  VEAGVAPGGGAWLGGQLFSAMVMRKPAQVFLDEVGVPYEDEGDFVVVKHAALFTSTVMSK  166

Query  611  LLARPNVKLFNA  646
            +L   NVKLFNA
Sbjct  167  VLQFSNVKLFNA  178



>gb|KIW29175.1| thiamine thiazole synthase [Cladophialophora immunda]
 gb|KIW29176.1| thiamine thiazole synthase, variant 1 [Cladophialophora immunda]
 gb|KIW29177.1| thiamine thiazole synthase, variant 2 [Cladophialophora immunda]
 gb|KIW29178.1| thiamine thiazole synthase, variant 3 [Cladophialophora immunda]
Length=330

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 118/153 (77%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            A+ AS  HN  +      +  + FKF PI+ES V+R MTRRY  D+  YA++DV++VGAG
Sbjct  32   ALTASGEHNSLLEQFGDKW--EGFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAG  89

Query  371  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            S GLS AY ++K  P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V YE
Sbjct  90   SCGLSTAYTLAKARPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAEAFLNDIGVPYE  149

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +  NYVV+KHAALF ST+MSK+LA PNVKLFNA
Sbjct  150  DEGNYVVVKHAALFMSTLMSKVLAMPNVKLFNA  182



>ref|XP_009154920.1| thiazole biosynthetic enzyme, mitochondrial [Exophiala dermatitidis 
NIH/UT8656]
 gb|EHY54459.1| thiazole biosynthetic enzyme, mitochondrial [Exophiala dermatitidis 
NIH/UT8656]
Length=331

 Score =   189 bits (481),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 118/151 (78%), Gaps = 7/151 (5%)
 Frame = +2

Query  215  NLSVSASHTPY------SLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSA  376
            N + +A+HT          D+FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS 
Sbjct  33   NANGNATHTKLLDEFGGKWDAFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSC  92

Query  377  GLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEA  553
            GLS AY ++K  P++++AIIE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V YE+ 
Sbjct  93   GLSTAYTLAKARPDLKIAIIEASVSPGGGCWLGGQLFSAMVLRKPAEEFLNDIGVPYEDE  152

Query  554  DNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
             NYVV+KHAALF ST+MSK+LA PNVKLFNA
Sbjct  153  GNYVVVKHAALFMSTLMSKVLAMPNVKLFNA  183



>pdb|3JSK|A Chain A, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|B Chain B, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|C Chain C, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|D Chain D, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|E Chain E, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|F Chain F, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|G Chain G, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|H Chain H, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|I Chain I, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|J Chain J, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|K Chain K, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|L Chain L, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|M Chain M, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|N Chain N, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|O Chain O, Thiazole Synthase From Neurospora Crassa
 pdb|3JSK|P Chain P, Thiazole Synthase From Neurospora Crassa
Length=344

 Score =   189 bits (481),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+F F PI+ES V+R MTRRY  D+  +A+TD+++VGAGS GLS AY +S   P++R+ I
Sbjct  50   DAFTFSPIRESTVSRAMTRRYFADLDAHAETDIVIVGAGSCGLSAAYVLSTLRPDLRITI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            +E  V+PGGGAWLGGQLFSAMV+RKPA VFLDE+ V YE+  +YVV+KHAALFTST++SK
Sbjct  110  VEAGVAPGGGAWLGGQLFSAMVMRKPADVFLDEVGVPYEDEGDYVVVKHAALFTSTVLSK  169

Query  611  LLARPNVKLFNA  646
            +L RPNVKLFNA
Sbjct  170  VLQRPNVKLFNA  181



>emb|CCK70574.1| hypothetical protein KNAG_0E03150 [Kazachstania naganishii CBS 
8797]
Length=324

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 119/147 (81%), Gaps = 3/147 (2%)
 Frame = +2

Query  209  HHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSC  388
            HH+LS       +S   F+F PI+ES V+R MTRRY  DM  +A +DV+++GAGS+GLS 
Sbjct  21   HHSLSDVVKTEDWS--DFEFTPIRESTVSRAMTRRYFQDMDKFAVSDVVIIGAGSSGLSA  78

Query  389  AYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYV  565
            AY I+KN P++++AIIE +V+PGGGAWLGGQLFSAM++RKPA +FL++L ++YE+  +YV
Sbjct  79   AYVIAKNRPDLKIAIIESNVAPGGGAWLGGQLFSAMIMRKPAHLFLNDLGIQYEDEGDYV  138

Query  566  VIKHAALFTSTIMSKLLARPNVKLFNA  646
            V+KHAALFTST++SK+L  PNVKLFNA
Sbjct  139  VVKHAALFTSTVLSKVLEFPNVKLFNA  165



>ref|XP_011395239.1| thiazole biosynthetic enzyme, variant 2 [Neurospora crassa OR74A]
 ref|XP_011395240.1| thiazole biosynthetic enzyme [Neurospora crassa OR74A]
 ref|XP_011395241.1| thiazole biosynthetic enzyme, variant 1 [Neurospora crassa OR74A]
 ref|XP_011395242.1| thiazole biosynthetic enzyme, variant 3 [Neurospora crassa OR74A]
 sp|Q1K6I4.1|THI4_NEUCR RecName: Full=Thiamine thiazole synthase; AltName: Full=37 kDa 
NcCyP41-binding protein; Short=CyPBP37; AltName: Full=Thiazole 
biosynthetic enzyme [Neurospora crassa OR74A]
 emb|CAC03570.1| CyPBP37 protein [Neurospora crassa]
 gb|ESA41902.1| thiazole biosynthetic enzyme [Neurospora crassa OR74A]
 gb|ESA41903.1| thiazole biosynthetic enzyme, variant 1 [Neurospora crassa OR74A]
 gb|ESA41904.1| thiazole biosynthetic enzyme, variant 2 [Neurospora crassa OR74A]
 gb|ESA41905.1| thiazole biosynthetic enzyme, variant 3 [Neurospora crassa OR74A]
Length=344

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+F F PI+ES V+R MTRRY  D+  +A+TD+++VGAGS GLS AY +S   P++R+ I
Sbjct  50   DAFTFSPIRESTVSRAMTRRYFADLDAHAETDIVIVGAGSCGLSAAYVLSTLRPDLRITI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            +E  V+PGGGAWLGGQLFSAMV+RKPA VFLDE+ V YE+  +YVV+KHAALFTST++SK
Sbjct  110  VEAGVAPGGGAWLGGQLFSAMVMRKPADVFLDEVGVPYEDEGDYVVVKHAALFTSTVLSK  169

Query  611  LLARPNVKLFNA  646
            +L RPNVKLFNA
Sbjct  170  VLQRPNVKLFNA  181



>gb|KIL95952.1| hypothetical protein FAVG1_00690 [Fusarium avenaceum]
Length=322

 Score =   189 bits (479),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS AY + K  P++++AI
Sbjct  44   DDFKFAPIRESQVSRAMTRRYFKDLDTYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAI  103

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAM++RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  104  IEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSK  163

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  164  VLQMPNIKLFNA  175



>gb|KHE80990.1| hypothetical protein GE21DRAFT_10110, partial [Neurospora crassa]
Length=343

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+F F PI+ES V+R MTRRY  D+  +A+TD+++VGAGS GLS AY +S   P++R+ I
Sbjct  49   DAFTFSPIRESTVSRAMTRRYFADLDAHAETDIVIVGAGSCGLSAAYVLSTLRPDLRITI  108

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            +E  V+PGGGAWLGGQLFSAMV+RKPA VFLDE+ V YE+  +YVV+KHAALFTST++SK
Sbjct  109  VEAGVAPGGGAWLGGQLFSAMVMRKPADVFLDEVGVPYEDEGDYVVVKHAALFTSTVLSK  168

Query  611  LLARPNVKLFNA  646
            +L RPNVKLFNA
Sbjct  169  VLQRPNVKLFNA  180



>gb|ABN45968.1| thiazole biosynthetic enzyme variant 1 [Epichloe typhina]
 gb|ABN45969.1| thiazole biosynthetic enzyme variant 2 [Epichloe typhina]
 gb|ABN45970.1| thiazole biosynthetic enzyme variant 3 [Epichloe typhina]
 gb|ABN45971.1| thiazole biosynthetic enzyme variant 4 [Epichloe typhina]
 gb|ABN45972.1| thiazole biosynthetic enzyme variant 5 [Epichloe typhina]
Length=320

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            DSFKF PI+ES V+R MTRRY  D+  YA++D+++VGAGS GLS AY + K+ P++++ I
Sbjct  42   DSFKFAPIRESQVSRAMTRRYFRDLDTYAESDIVIVGAGSCGLSAAYVLGKHRPDLKICI  101

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE+  NYVV+KHAALFTSTI+SK
Sbjct  102  IEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDEGNYVVVKHAALFTSTILSK  161

Query  611  LLARPNVKLFNA  646
            +L+ PN+K+FNA
Sbjct  162  VLSLPNIKMFNA  173



>ref|XP_002951140.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
 gb|EFJ47669.1| hypothetical protein VOLCADRAFT_74900 [Volvox carteri f. nagariensis]
Length=359

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 118/153 (77%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            A  AS      +  + TPY  D++ F  I+E+ V R MTRRY  DM  +A++DV++VGAG
Sbjct  43   AADASMLARAGLPPTTTPY--DNYVFASIREAEVNRAMTRRYFKDMDEFAESDVVIVGAG  100

Query  371  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            SAGL+CAYE+ K  P+++VA++EQSV+PGGGAWLGGQLFSAMVVRKPA + LDELEV YE
Sbjct  101  SAGLACAYELGKVAPHLKVALLEQSVAPGGGAWLGGQLFSAMVVRKPAHLMLDELEVPYE  160

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +  +YVV++HAAL TST+MS +L  PNVKLFNA
Sbjct  161  DEGHYVVVRHAALLTSTLMSHVLKNPNVKLFNA  193



>ref|XP_002951138.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
 gb|EFJ47667.1| hypothetical protein VOLCADRAFT_74899 [Volvox carteri f. nagariensis]
Length=355

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 118/153 (77%), Gaps = 3/153 (2%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAG  370
            A  AS      +  + TPY  D++ F  I+E+ V R MTRRY  DM  +A++DV++VGAG
Sbjct  42   AADASMLARAGLPPTTTPY--DNYVFASIREAEVNRAMTRRYFKDMDEFAESDVVIVGAG  99

Query  371  SAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYE  547
            SAGL+CAYE+ K  P+++VA++EQSV+PGGGAWLGGQLFSAMVVRKPA + LDELEV YE
Sbjct  100  SAGLACAYELGKVAPHLKVALLEQSVAPGGGAWLGGQLFSAMVVRKPAHLMLDELEVPYE  159

Query  548  EADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +  +YVV++HAAL TST+MS +L  PNVKLFNA
Sbjct  160  DEGHYVVVRHAALLTSTLMSHVLKNPNVKLFNA  192



>gb|KHC63824.1| thiazole biosynthesis enzyme [Candida albicans P75010]
Length=354

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            + FKF PI+ESIV+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESIVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++YE+  +YVV+KHAALF ST+MSK
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYEDEGDYVVVKHAALFMSTLMSK  162

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  163  VLQFPNIKLFNA  174



>ref|XP_007728533.1| thiazole biosynthetic enzyme, mitochondrial [Capronia epimyces 
CBS 606.96]
 gb|EXJ91643.1| thiazole biosynthetic enzyme, mitochondrial [Capronia epimyces 
CBS 606.96]
Length=335

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  56   DAFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSCGLSTAYTLAKARPDLKIAI  115

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V YE+  NYVV+KHAALF ST+MSK
Sbjct  116  IEASVSPGGGCWLGGQLFSAMVLRKPAEEFLNDIGVPYEDEGNYVVVKHAALFMSTLMSK  175

Query  611  LLARPNVKLFNA  646
            +LA PNVKLFNA
Sbjct  176  VLAMPNVKLFNA  187



>gb|KIW21130.1| thiamine thiazole synthase [Exophiala spinifera]
Length=337

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D F+F PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  57   DGFRFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSCGLSTAYTLAKARPDLKIAI  116

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA  FLD++ V +E+  NYVV+KHAALF ST+MSK
Sbjct  117  IEASVSPGGGCWLGGQLFSAMVLRKPADAFLDDIGVPFEDEGNYVVVKHAALFMSTLMSK  176

Query  611  LLARPNVKLFNA  646
            +LA PNVKLFNA
Sbjct  177  VLAMPNVKLFNA  188



>ref|XP_002172093.1| thiazole biosynthetic enzyme [Schizosaccharomyces japonicus yFS275]
 gb|EEB05800.1| thiazole biosynthetic enzyme [Schizosaccharomyces japonicus yFS275]
Length=326

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI-SKNPNVRVAI  430
            + FKF PI+ESIVAR M +RY  D+  YA++D+++VGAGSAGL+CAY I ++ P++++AI
Sbjct  41   EDFKFAPIRESIVARAMIKRYWKDLETYAESDIVIVGAGSAGLTCAYYIGTRRPDLKIAI  100

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE  V+PGGGAWLGGQL SAMVVRKPA  FL+E+ V YE+  NYVV+KHAALFTSTIM++
Sbjct  101  IEAGVAPGGGAWLGGQLMSAMVVRKPADAFLNEIGVPYEDEGNYVVVKHAALFTSTIMAR  160

Query  611  LLARPNVKLFNA  646
             L+ PN+KLFNA
Sbjct  161  ALSLPNIKLFNA  172



>ref|XP_007721137.1| thiazole biosynthetic enzyme, mitochondrial [Capronia coronata 
CBS 617.96]
 gb|EXJ93643.1| thiazole biosynthetic enzyme, mitochondrial [Capronia coronata 
CBS 617.96]
Length=331

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            D+FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  52   DAFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSCGLSTAYTLAKARPDLKIAI  111

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA  FLD++ V YE+  N+VV+KHAALF ST+MSK
Sbjct  112  IEASVSPGGGCWLGGQLFSAMVLRKPADEFLDDIGVPYEDEGNFVVVKHAALFMSTLMSK  171

Query  611  LLARPNVKLFNA  646
            +LA PNVKLFNA
Sbjct  172  VLAMPNVKLFNA  183



>gb|EHK27008.1| hypothetical protein TRIVIDRAFT_215037 [Trichoderma virens Gv29-8]
Length=322

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            A +   L+ + S      DSF F PI+ES V+R MTRRY  D+  YA++D++++GAGS G
Sbjct  26   AQNQGPLAKTVSEMQGQWDSFTFAPIRESQVSRAMTRRYFEDLDRYAESDIVIIGAGSCG  85

Query  380  LSCAYEI-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEAD  556
            LS AY + ++ P++++AIIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE+  
Sbjct  86   LSTAYVLGTQRPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDEG  145

Query  557  NYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            NYVV+KHAALFTSTIM+K+L  PNVKLFNA
Sbjct  146  NYVVVKHAALFTSTIMAKVLQLPNVKLFNA  175



>gb|AGO09853.1| AaceriAAL137Wp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=321

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            +S+ H LS       +S   F+F PI+E+ V+R MT RY  D+  YA +DV++VGAGS+G
Sbjct  16   SSTRHALSDVVREKDWS--DFEFTPIREATVSRAMTTRYFDDLYKYAVSDVVIVGAGSSG  73

Query  380  LSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEAD  556
            LS AY I+KN P++R+AI+E +V+PGGGAWLGGQLFSAM++RKP  +FLDELE+ YE+  
Sbjct  74   LSAAYVIAKNRPDLRIAIVEANVAPGGGAWLGGQLFSAMIMRKPTHLFLDELEIPYEDEG  133

Query  557  NYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +YVV+KHAALFTST++SK+L  PNVKLFNA
Sbjct  134  DYVVVKHAALFTSTVLSKVLQFPNVKLFNA  163



>ref|XP_004198891.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
 emb|CCE82554.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
Length=322

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 122/160 (76%), Gaps = 4/160 (3%)
 Frame = +2

Query  179  FCVQAVKASSHHNLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMIIYADTD  349
            F ++  K +   NL+ + S+   S    D FKF PI+ES V+R MT+RY  D+  YA++D
Sbjct  15   FSLKGSKEAKVVNLTSNKSNAEVSFADWDKFKFAPIRESTVSRAMTKRYFADLDKYAESD  74

Query  350  VIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            V+++GAGSAGLS AY ++KN P +++AIIE SVSPGGG WLGGQLFSAMV+RKPA +F+ 
Sbjct  75   VVIIGAGSAGLSAAYVLAKNRPELKIAIIEASVSPGGGCWLGGQLFSAMVLRKPADLFIQ  134

Query  527  ELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EL ++YE+  +Y+V+KHAA F ST++SK+L+ PNVKLFNA
Sbjct  135  ELGIDYEDEGDYIVVKHAAYFMSTLLSKVLSFPNVKLFNA  174



>gb|KIV92747.1| thiamine thiazole synthase [Exophiala mesophila]
 gb|KIV92748.1| thiamine thiazole synthase, variant 1 [Exophiala mesophila]
 gb|KIV92749.1| thiamine thiazole synthase, variant 2 [Exophiala mesophila]
Length=330

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSFKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY + K  P++++AI
Sbjct  51   DSFKFAPIRESQVSRAMTRRYFADLDKYAESDVVIVGAGSCGLSAAYTLGKARPDLKIAI  110

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V +E+  NYVV+KHAALF ST+MSK
Sbjct  111  IEASVSPGGGCWLGGQLFSAMVLRKPAEEFLNDIGVPFEDEGNYVVVKHAALFMSTLMSK  170

Query  611  LLARPNVKLFNA  646
            +LA PNVKLFNA
Sbjct  171  VLALPNVKLFNA  182



>sp|P23618.2|THI4_FUSOX RecName: Full=Thiamine thiazole synthase; AltName: Full=Stress-inducible 
protein sti35; AltName: Full=Thiazole biosynthetic 
enzyme [Fusarium oxysporum]
 sp|J9N5G7.1|THI4_FUSO4 RecName: Full=Thiamine thiazole synthase; AltName: Full=Stress-inducible 
protein sti35; AltName: Full=Thiazole biosynthetic 
enzyme [Fusarium oxysporum f. sp. lycopersici 4287]
 gb|AAA33341.1| STI35 protein [Fusarium oxysporum]
 dbj|BAA85305.1| sti35 [Fusarium oxysporum]
 gb|EGU86946.1| hypothetical protein FOXB_02553 [Fusarium oxysporum Fo5176]
 gb|ENH66155.1| Thiazole biosynthetic enzyme, mitochondrial [Fusarium oxysporum 
f. sp. cubense race 1]
 emb|CCT68966.1| probable CyPBP37 protein (protein binding to CyP41) [Fusarium 
fujikuroi IMI 58289]
 gb|EWY91527.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a]
 gb|EWY91528.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a]
 gb|EWY91529.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a]
 gb|EWY91530.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a]
 gb|EWY91531.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a]
 gb|EWY91532.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a]
 gb|EWY91533.1| thiamine biosynthetic enzyme [Fusarium oxysporum FOSC 3-a]
 gb|EWZ38191.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47]
 gb|EWZ38192.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47]
 gb|EWZ38193.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47]
 gb|EWZ38194.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47]
 gb|EWZ38195.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47]
 gb|EWZ38196.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47]
 gb|EWZ38197.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47]
 gb|EWZ38198.1| thiamine biosynthetic enzyme [Fusarium oxysporum Fo47]
 gb|EWZ82761.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ82762.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ82763.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ82764.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ82765.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ82766.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ82767.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EWZ82768.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA45783.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA45784.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA45785.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA45786.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXA45787.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. pisi 
HDV247]
 gb|EXK40266.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK40267.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK40268.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK40269.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK40270.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK40271.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK92294.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK92295.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK92296.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK92297.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXK92298.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL57658.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL57659.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL57660.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL57661.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL57662.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL57663.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL57664.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL76154.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL76155.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL76156.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL76157.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXL97128.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXL97129.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXL97130.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXL97131.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXL97132.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXL97133.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXL97134.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXL97135.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM23548.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM23549.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM23550.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM23551.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 
25433]
 gb|EXM23552.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=320

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS AY + K  P++++AI
Sbjct  42   DDFKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAI  101

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAM++RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  102  IEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSK  161

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  162  VLQMPNIKLFNA  173



>ref|XP_011318395.1| hypothetical protein FGSG_02469 [Fusarium graminearum PH-1]
 gb|ESU07910.1| hypothetical protein FGSG_02469 [Fusarium graminearum PH-1]
 gb|EYB31639.1| hypothetical protein FG05_02469 [Fusarium graminearum]
 emb|CEF74766.1| unnamed protein product [Fusarium graminearum]
Length=322

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS AY + K  P++++AI
Sbjct  44   DDFKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAI  103

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAM++RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  104  IEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSK  163

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  164  VLQMPNIKLFNA  175



>emb|CCE33143.1| probable CyPBP37 protein (protein binding to CyP41) [Claviceps 
purpurea 20.1]
Length=326

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D+F F PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS AY + K+ P++++ I
Sbjct  48   DNFSFAPIRESQVSRAMTRRYFQDLDTYAESDIVIIGAGSCGLSAAYVLGKHRPDLKICI  107

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  108  IEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDEGNYVVVKHAALFTSTIMSK  167

Query  611  LLARPNVKLFNA  646
            +LA PN+K+FNA
Sbjct  168  VLAMPNIKMFNA  179



>ref|XP_009253330.1| hypothetical protein FPSE_01936 [Fusarium pseudograminearum CS3096]
 gb|EKJ77843.1| hypothetical protein FPSE_01936 [Fusarium pseudograminearum CS3096]
Length=322

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS AY + K  P++++AI
Sbjct  44   DDFKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAI  103

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAM++RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  104  IEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSK  163

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  164  VLQMPNIKLFNA  175



>gb|EWG49587.1| thiamine biosynthetic enzyme [Fusarium verticillioides 7600]
 gb|EWG49588.1| thiamine biosynthetic enzyme [Fusarium verticillioides 7600]
Length=320

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS AY + K  P++++AI
Sbjct  42   DDFKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAI  101

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAM++RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  102  IEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSK  161

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  162  VLQMPNIKLFNA  173



>ref|XP_004199741.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
 emb|CCE81622.1| Piso0_002284 [Millerozyma farinosa CBS 7064]
Length=322

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 121/160 (76%), Gaps = 4/160 (3%)
 Frame = +2

Query  179  FCVQAVKASSHHNLSVSASHTPYSL---DSFKFQPIKESIVAREMTRRYMTDMIIYADTD  349
            F ++    +   NL+ + S+   S    D FKF PI+ES V+R MT+RY  D+  YA++D
Sbjct  15   FSLKGSNGAKAVNLTSNKSNAEVSFADWDKFKFAPIRESTVSRAMTKRYFADLDKYAESD  74

Query  350  VIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            V+++GAGSAGLS AY ++KN P +++AIIE SVSPGGG WLGGQLFSAMV+RKPA +F+ 
Sbjct  75   VVIIGAGSAGLSAAYVLAKNRPELKIAIIEASVSPGGGCWLGGQLFSAMVLRKPADLFIQ  134

Query  527  ELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            EL ++YE+  +Y+V+KHAA F ST++SK+L+ PNVKLFNA
Sbjct  135  ELGIDYEDEGDYIVVKHAAYFMSTLLSKVLSFPNVKLFNA  174



>gb|EMT70803.1| Thiazole biosynthetic enzyme, mitochondrial [Fusarium oxysporum 
f. sp. cubense race 4]
Length=337

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS AY + K  P++++AI
Sbjct  59   DDFKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAI  118

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAM++RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  119  IEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSK  178

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  179  VLQMPNIKLFNA  190



>gb|KIV86535.1| thiamine thiazole synthase, variant 2 [Exophiala sideris]
 gb|KIV86536.1| thiamine thiazole synthase, variant 3 [Exophiala sideris]
Length=329

 Score =   187 bits (476),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSFKF PI+ES V+R MT+RY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  50   DSFKFAPIRESQVSRAMTKRYFADLDRYAESDVVIVGAGSCGLSTAYTLAKARPDLKIAI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V +E+  NYVV+KHAALF ST+MSK
Sbjct  110  IEASVSPGGGCWLGGQLFSAMVLRKPAEEFLNDIGVPFEDEGNYVVVKHAALFMSTLMSK  169

Query  611  LLARPNVKLFNA  646
            +LA PNVKLFNA
Sbjct  170  VLAMPNVKLFNA  181



>gb|KEZ45124.1| Thiamine thiazole synthase [Scedosporium apiospermum]
Length=323

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = +2

Query  179  FCVQAVKASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIV  358
            F  + V +S    L+   +    + D+F F PI+ES V+R MTRRY  D+  YA++D+++
Sbjct  20   FAKKQVASSPDATLTKPVTDMMGNWDTFTFAPIRESQVSRAMTRRYFADLDAYAESDIVI  79

Query  359  VGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELE  535
            +GAGS GLS AY +    P++R+AIIE  V+PGGGAWLGGQLFSAM++RKPA VFL EL 
Sbjct  80   IGAGSCGLSAAYTLGTLRPDLRIAIIEAGVAPGGGAWLGGQLFSAMIMRKPADVFLAELG  139

Query  536  VEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            V +E+  +YVV+KHAALFTST++SK+LA PNVKLFNA
Sbjct  140  VPFEDEGDYVVVKHAALFTSTVLSKVLALPNVKLFNA  176



>gb|ABG46357.1| mitochondrial thiazole biosynthetic enzyme [Trichoderma harzianum]
Length=322

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 115/150 (77%), Gaps = 1/150 (1%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            A +   L+ + S      DSF F PI+ES V+R MTRRY  D+  YA++D++++GAGS G
Sbjct  26   AQNQGPLAKTVSEMHGQWDSFTFAPIRESQVSRAMTRRYFEDLDNYAESDIVIIGAGSCG  85

Query  380  LSCAYEI-SKNPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEAD  556
            LS AY + ++ P++++AIIE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE+  
Sbjct  86   LSTAYVLGTQRPDLKIAIIEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDEG  145

Query  557  NYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            NYVV+KHAALFTSTIM+K+L  PNVKLFNA
Sbjct  146  NYVVVKHAALFTSTIMAKVLQLPNVKLFNA  175



>ref|XP_001819323.1| thiazole biosynthetic enzyme [Aspergillus oryzae RIB40]
 sp|Q9UUZ9.2|THI4_ASPOR RecName: Full=Thiamine thiazole synthase; AltName: Full=Pyrithiamine 
resistance protein; AltName: Full=Thiazole biosynthetic 
enzyme [Aspergillus oryzae RIB40]
 dbj|BAE57321.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=327

 Score =   187 bits (475),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 114/140 (81%), Gaps = 3/140 (2%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NP  412
            H     D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P
Sbjct  40   HFGGKWDEFKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARP  99

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE--ADNYVVIKHAAL  586
            ++++AI+E SVSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V YEE    NYVV+KHA+L
Sbjct  100  DLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDANPNYVVVKHASL  159

Query  587  FTSTIMSKLLARPNVKLFNA  646
            FTST+MSK+L+ PNVKLFNA
Sbjct  160  FTSTLMSKVLSFPNVKLFNA  179



>gb|AAL86771.2| THI4 enzyme [Candida albicans]
Length=354

 Score =   188 bits (477),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++YE+  +YVV+KHAALF ST+MSK
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYEDEGDYVVVKHAALFMSTLMSK  162

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  163  VLQFPNIKLFNA  174



>gb|AAF25444.1|AF217503_1 putative thiazole synthase [Aspergillus oryzae]
 gb|ADM43597.1| ThiA protein [Cloning vector pSK485]
 gb|EIT72848.1| protein involved in thiamine biosynthesis and DNA damage tolerance 
[Aspergillus oryzae 3.042]
 gb|KDE83469.1| hypothetical protein AO1008_10087 [Aspergillus oryzae 100-8]
Length=327

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 114/140 (81%), Gaps = 3/140 (2%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NP  412
            H     D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P
Sbjct  40   HFGGKWDEFKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARP  99

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE--ADNYVVIKHAAL  586
            ++++AI+E SVSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V YEE    NYVV+KHA+L
Sbjct  100  DLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDANPNYVVVKHASL  159

Query  587  FTSTIMSKLLARPNVKLFNA  646
            FTST+MSK+L+ PNVKLFNA
Sbjct  160  FTSTLMSKVLSFPNVKLFNA  179



>gb|KIV86533.1| thiamine thiazole synthase [Exophiala sideris]
 gb|KIV86534.1| thiamine thiazole synthase, variant 1 [Exophiala sideris]
Length=342

 Score =   187 bits (476),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSFKF PI+ES V+R MT+RY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  63   DSFKFAPIRESQVSRAMTKRYFADLDRYAESDVVIVGAGSCGLSTAYTLAKARPDLKIAI  122

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V +E+  NYVV+KHAALF ST+MSK
Sbjct  123  IEASVSPGGGCWLGGQLFSAMVLRKPAEEFLNDIGVPFEDEGNYVVVKHAALFMSTLMSK  182

Query  611  LLARPNVKLFNA  646
            +LA PNVKLFNA
Sbjct  183  VLAMPNVKLFNA  194



>ref|XP_002375225.1| thiazole biosynthesis enzyme Sti35 [Aspergillus flavus NRRL3357]
 gb|EED56443.1| thiazole biosynthesis enzyme Sti35 [Aspergillus flavus NRRL3357]
Length=327

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 114/140 (81%), Gaps = 3/140 (2%)
 Frame = +2

Query  236  HTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NP  412
            H     D FKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P
Sbjct  40   HFGGKWDEFKFAPIRESQVSRAMTRRYFEDLDKYAESDVVIVGAGSCGLSTAYVLAKARP  99

Query  413  NVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEE--ADNYVVIKHAAL  586
            ++++AI+E SVSPGGGAWLGGQLFSAMV+R+PA+VFL+EL V YEE    NYVV+KHA+L
Sbjct  100  DLKIAIVEASVSPGGGAWLGGQLFSAMVMRRPAEVFLNELGVPYEEDANPNYVVVKHASL  159

Query  587  FTSTIMSKLLARPNVKLFNA  646
            FTST+MSK+L+ PNVKLFNA
Sbjct  160  FTSTLMSKVLSFPNVKLFNA  179



>ref|XP_006968797.1| thiazole biosynthetic enzyme [Trichoderma reesei QM6a]
 gb|EGR45359.1| thiazole biosynthetic enzyme [Trichoderma reesei QM6a]
 gb|ETR98040.1| thiazole biosynthetic enzyme [Trichoderma reesei RUT C-30]
Length=324

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI-SKNPNVRVAI  430
            DSF F PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS AY + ++ P++++AI
Sbjct  46   DSFTFSPIRESQVSRAMTRRYFEDLDRYAESDIVIIGAGSCGLSTAYVLGTQRPDLKIAI  105

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE+  NYVV+KHAALFTSTIM+K
Sbjct  106  IEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDEGNYVVVKHAALFTSTIMAK  165

Query  611  LLARPNVKLFNA  646
            +L  PNVKLFNA
Sbjct  166  VLQLPNVKLFNA  177



>ref|XP_002419419.1| thiamine biosynthesis enzyme, putative; thiazole biosynthetic 
enzyme, putative [Candida dubliniensis CD36]
 emb|CAX43013.1| thiamine biosynthesis enzyme, putative [Candida dubliniensis 
CD36]
Length=354

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   DEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FL+++ ++YE+  +YVV+KHAALF ST+MSK
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLNDMGLDYEDEGDYVVVKHAALFMSTLMSK  162

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  163  VLQFPNIKLFNA  174



>gb|KDN61355.1| putative Thi4 family protein [Colletotrichum sublineola]
Length=342

 Score =   187 bits (475),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 122/160 (76%), Gaps = 8/160 (5%)
 Frame = +2

Query  191  AVKASSHHNLSVSASHTPYSL-------DSFKFQPIKESIVAREMTRRYMTDMIIYADTD  349
            A K +   +  V+A+ TP  +       DSF F PI+ES V+R MTRRY  D+  YA++D
Sbjct  19   AGKTTKPADGHVAAAGTPAKVEDFFGKWDSFTFSPIRESQVSRAMTRRYFADLDAYAESD  78

Query  350  VIVVGAGSAGLSCAYEISK-NPNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLD  526
            +++VGAGS GLS AY ++K  P++R+AI+E  V+PGGGAWLGGQLFSAMV+RKPA+VFLD
Sbjct  79   IVIVGAGSCGLSAAYVLAKARPDLRIAIVEAGVAPGGGAWLGGQLFSAMVMRKPAEVFLD  138

Query  527  ELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            E+ V YE+  ++VV++HAALFTST++S++L  PNVKLFNA
Sbjct  139  EVGVPYEDEGDFVVVRHAALFTSTVLSRVLQFPNVKLFNA  178



>ref|XP_723197.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 ref|XP_723050.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 sp|Q5ANB7.1|THI4_CANAL RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Candida albicans SC5314]
 gb|EAL04334.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 gb|EAL04489.1| likely thiamine biosynthesis enzyme [Candida albicans SC5314]
 gb|KGQ92431.1| thiazole biosynthesis enzyme [Candida albicans P37005]
 gb|KGQ98336.1| thiazole biosynthesis enzyme [Candida albicans GC75]
 gb|KGR12895.1| thiazole biosynthesis enzyme [Candida albicans P78048]
 gb|KGR17623.1| thiazole biosynthesis enzyme [Candida albicans P37037]
 gb|KGT69944.1| thiazole biosynthesis enzyme [Candida albicans 12C]
 gb|KGU10362.1| thiazole biosynthesis enzyme [Candida albicans P87]
 gb|KGU10939.1| thiazole biosynthesis enzyme [Candida albicans 19F]
 gb|KGU11477.1| thiazole biosynthesis enzyme [Candida albicans L26]
 gb|KGU27365.1| thiazole biosynthesis enzyme [Candida albicans P34048]
 gb|KGU30750.1| thiazole biosynthesis enzyme [Candida albicans P57055]
 gb|KGU31334.1| thiazole biosynthesis enzyme [Candida albicans P75063]
 gb|KHC42654.1| thiazole biosynthesis enzyme [Candida albicans Ca6]
 gb|KHC52341.1| thiazole biosynthesis enzyme [Candida albicans P60002]
 gb|KHC55715.1| thiazole biosynthesis enzyme [Candida albicans P37039]
 gb|KHC70243.1| thiazole biosynthesis enzyme [Candida albicans P75016]
 gb|KHC78685.1| thiazole biosynthesis enzyme [Candida albicans P78042]
 gb|KHC79055.1| thiazole biosynthesis enzyme [Candida albicans SC5314]
 gb|KHC87279.1| thiazole biosynthesis enzyme [Candida albicans SC5314]
Length=354

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++YE+  +YVV+KHAALF ST+MSK
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYEDEGDYVVVKHAALFMSTLMSK  162

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  163  VLQFPNIKLFNA  174



>ref|XP_006666857.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01]
 gb|EGX96980.1| thiazole biosynthetic enzyme [Cordyceps militaris CM01]
Length=330

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 122/167 (73%), Gaps = 10/167 (6%)
 Frame = +2

Query  176  FFCVQAVKASSHHN-LSVSASHTPY--------SLDSFKFQPIKESIVAREMTRRYMTDM  328
            +  V   KA+S HN ++V A+ +            DSFKF PI+ES V+R MTRRY  D+
Sbjct  12   YAAVPVTKAASGHNAVAVPAADSTRLAIDDMLGQWDSFKFAPIRESQVSRAMTRRYFEDL  71

Query  329  IIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRK  505
              YA++D++++GAGS GLS AY + K  P++++AIIE SVSPGGGAWLGGQLFSAM++RK
Sbjct  72   DTYAESDIVIIGAGSCGLSAAYVLGKKRPDLKIAIIEASVSPGGGAWLGGQLFSAMIMRK  131

Query  506  PAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            PA  FL E+ V YE+   YVV++HAALFTSTIMS++L  PN+KLFNA
Sbjct  132  PADAFLREVGVPYEDEGAYVVVRHAALFTSTIMSQVLRMPNIKLFNA  178



>sp|C4YNP4.1|THI4_CANAW RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Candida albicans WO-1]
 gb|EEQ44553.1| hypothetical protein CAWG_02825 [Candida albicans WO-1]
Length=354

 Score =   187 bits (476),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++YE+  +YVV+KHAALF ST+MSK
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYEDEGDYVVVKHAALFMSTLMSK  162

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  163  VLQFPNIKLFNA  174



>gb|KGR10168.1| thiazole biosynthesis enzyme [Candida albicans P57072]
 gb|KHC36840.1| thiazole biosynthesis enzyme [Candida albicans P76055]
Length=354

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++YE+  +YVV+KHAALF ST+MSK
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYEDEGDYVVVKHAALFMSTLMSK  162

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  163  VLQFPNIKLFNA  174



>gb|KGQ88127.1| thiazole biosynthesis enzyme [Candida albicans P94015]
Length=354

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++YE+  +YVV+KHAALF ST+MSK
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYEDEGDYVVVKHAALFMSTLMSK  162

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  163  VLQFPNIKLFNA  174



>ref|XP_499918.1| YALI0A09768p [Yarrowia lipolytica]
 sp|Q3V7I4.1|THI4_YARLI RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Yarrowia lipolytica CLIB122]
 emb|CAG83845.1| YALI0A09768p [Yarrowia lipolytica CLIB122]
Length=317

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 118/147 (80%), Gaps = 4/147 (3%)
 Frame = +2

Query  209  HHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSC  388
            +  L+ S  HT    +SFKF PI+ES V+R MTRRY  D+  YA++DV+++GAGS GLS 
Sbjct  26   NQKLTKSDEHT---WESFKFAPIRESTVSRAMTRRYFEDLDKYAESDVVIIGAGSCGLSA  82

Query  389  AYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYV  565
            AY ++K+ P++++AI+E  V+PGGGAWLGGQLFSAMV+RKPA+ FL+E+ V YE+  +YV
Sbjct  83   AYVLAKSRPDLKIAIVEAGVAPGGGAWLGGQLFSAMVMRKPAEQFLEEIGVPYEDEGDYV  142

Query  566  VIKHAALFTSTIMSKLLARPNVKLFNA  646
            V+KHAALFTST+MS++L  PNVKLFNA
Sbjct  143  VVKHAALFTSTLMSQVLKFPNVKLFNA  169



>gb|KHC37210.1| thiazole biosynthesis enzyme [Candida albicans P76067]
Length=354

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 111/132 (84%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            + FKF PI+ES V+R MTRRY  D+  +A++D++++GAGSAGLS AY + KN P++++AI
Sbjct  43   NEFKFAPIRESTVSRAMTRRYFADLDKFAESDIVIIGAGSAGLSAAYTLGKNRPDLKIAI  102

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA +FLD++ ++YE+  +YVV+KHAALF ST+MSK
Sbjct  103  IEASVSPGGGCWLGGQLFSAMVLRKPAHLFLDDMGLDYEDEGDYVVVKHAALFMSTLMSK  162

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  163  VLQFPNIKLFNA  174



>ref|XP_001698672.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
 sp|A8J9T5.1|THI4_CHLRE RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: 
Full=Thiazole biosynthetic enzyme; Flags: Precursor [Chlamydomonas 
reinhardtii]
 gb|EDO99354.1| full-length thiazole biosynthetic enzyme [Chlamydomonas reinhardtii]
Length=357

 Score =   187 bits (476),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 112/137 (82%), Gaps = 3/137 (2%)
 Frame = +2

Query  239  TPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPN  415
            TPY  D +KF PI+E+ V R MTRRY  DM  +A++DV++VGAGSAGL+CA+E+ +  P+
Sbjct  59   TPY--DDYKFAPIREAEVNRAMTRRYFKDMDEFAESDVVIVGAGSAGLACAFELGRIAPH  116

Query  416  VRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTS  595
            ++VA++EQSV+PGGGAWLGGQLFSAMVVRKPA   LD L+V YE+  +YVV++HAAL TS
Sbjct  117  LKVALMEQSVAPGGGAWLGGQLFSAMVVRKPAHEMLDALQVPYEDEGHYVVVRHAALLTS  176

Query  596  TIMSKLLARPNVKLFNA  646
            T+MS +L  PNVKLFNA
Sbjct  177  TLMSHVLKNPNVKLFNA  193



>gb|KEF63437.1| thiazole biosynthetic enzyme, mitochondrial [Exophiala aquamarina 
CBS 119918]
Length=328

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI-SKNPNVRVAI  430
            DSFKF PI+ES V+R MT+RY  D+  YA++DV++VGAGS GLS AY + S  P++++AI
Sbjct  49   DSFKFAPIRESQVSRAMTKRYFGDLDNYAESDVVIVGAGSCGLSAAYTLGSARPDLKIAI  108

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA+ FL+++ V YE+  NYVV+KHAALF ST+MSK
Sbjct  109  IEASVSPGGGCWLGGQLFSAMVLRKPAEEFLNDIGVPYEDEGNYVVVKHAALFMSTLMSK  168

Query  611  LLARPNVKLFNA  646
            +LA PNVKLFNA
Sbjct  169  VLALPNVKLFNA  180



>ref|NP_982405.1| AAL137Wp [Ashbya gossypii ATCC 10895]
 sp|Q75F65.1|THI4_ASHGO RecName: Full=Thiamine thiazole synthase; AltName: Full=Thiazole 
biosynthetic enzyme [Ashbya gossypii ATCC 10895]
 gb|AAS50229.1| AAL137Wp [Ashbya gossypii ATCC 10895]
 gb|AEY94514.1| FAAL137Wp [Ashbya gossypii FDAG1]
Length=331

 Score =   186 bits (473),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 118/150 (79%), Gaps = 3/150 (2%)
 Frame = +2

Query  200  ASSHHNLSVSASHTPYSLDSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAG  379
            +++ H LS       +S   F+F PI+E+ V+R MT RY  D+  YA +DV++VGAGS+G
Sbjct  26   STTRHALSDIVREKDWS--DFQFAPIREATVSRAMTTRYFEDLYRYAVSDVVIVGAGSSG  83

Query  380  LSCAYEISKN-PNVRVAIIEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEAD  556
            LS AY ++KN P++R+AIIE +V+PGGGAWLGGQLFSAM++RKP  +FLDELE+ YE+  
Sbjct  84   LSAAYVLAKNRPDLRIAIIEANVAPGGGAWLGGQLFSAMIMRKPTHLFLDELEIPYEDEG  143

Query  557  NYVVIKHAALFTSTIMSKLLARPNVKLFNA  646
            +YVV+KHAALFTST++SK+L  PNVKLFNA
Sbjct  144  DYVVVKHAALFTSTVLSKVLQFPNVKLFNA  173



>gb|ACB70465.1| thiazole biosynthetic enzyme [Trichoderma aureoviride]
Length=322

 Score =   186 bits (472),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 109/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEI-SKNPNVRVAI  430
            +SF F PI+ES V+R MT+RY  D+  YA++D+++VGAGS GLS AY + +K P++++AI
Sbjct  44   ESFAFSPIRESQVSRAMTKRYFEDLDRYAESDIVIVGAGSCGLSTAYVLGTKRPDLKIAI  103

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAMV+RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  104  IEASVSPGGGAWLGGQLFSAMVMRKPADAFLREIGVPYEDEGNYVVVKHAALFTSTIMSK  163

Query  611  LLARPNVKLFNA  646
            +L  PNVKLFNA
Sbjct  164  VLQLPNVKLFNA  175



>gb|EXK40264.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK40265.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXL76153.1| thiamine biosynthetic enzyme [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
Length=373

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISKN-PNVRVAI  430
            D FKF PI+ES V+R MTRRY  D+  YA++D++++GAGS GLS AY + K  P++++AI
Sbjct  95   DDFKFAPIRESQVSRAMTRRYFQDLDNYAESDIVIIGAGSCGLSAAYILGKKRPDLKIAI  154

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGGAWLGGQLFSAM++RKPA  FL E+ V YE+  NYVV+KHAALFTSTIMSK
Sbjct  155  IEASVSPGGGAWLGGQLFSAMIMRKPADAFLREVGVPYEDEGNYVVVKHAALFTSTIMSK  214

Query  611  LLARPNVKLFNA  646
            +L  PN+KLFNA
Sbjct  215  VLQMPNIKLFNA  226



>ref|XP_001904665.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP64572.1| unnamed protein product [Podospora anserina S mat+]
Length=276

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 108/132 (82%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            DSF F PI+ES V+R MTRRY  D+  Y ++D+ +VGAGSAGLSCAY +    P+++++I
Sbjct  75   DSFTFAPIRESTVSRAMTRRYFNDLDTYTESDITIVGAGSAGLSCAYVLGTLRPDLKISI  134

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            +E  V+PGGGAWLGGQLFSAMV+RKPA +FL+++ V +E+  +YVV+KHAALFTSTIMSK
Sbjct  135  LEAGVAPGGGAWLGGQLFSAMVMRKPAHLFLEQVGVPFEDEGDYVVVKHAALFTSTIMSK  194

Query  611  LLARPNVKLFNA  646
            +L  PNVKLFNA
Sbjct  195  VLQMPNVKLFNA  206



>gb|KIW39396.1| thiamine thiazole synthase, variant 1 [Exophiala oligosperma]
 gb|KIW39397.1| thiamine thiazole synthase, variant 2 [Exophiala oligosperma]
Length=329

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 110/132 (83%), Gaps = 1/132 (1%)
 Frame = +2

Query  254  DSFKFQPIKESIVAREMTRRYMTDMIIYADTDVIVVGAGSAGLSCAYEISK-NPNVRVAI  430
            +SFKF PI+ES V+R MTRRY  D+  YA++DV++VGAGS GLS AY ++K  P++++AI
Sbjct  50   ESFKFAPIRESQVSRAMTRRYFADLDRYAESDVVIVGAGSCGLSTAYTLAKARPDLKIAI  109

Query  431  IEQSVSPGGGAWLGGQLFSAMVVRKPAQVFLDELEVEYEEADNYVVIKHAALFTSTIMSK  610
            IE SVSPGGG WLGGQLFSAMV+RKPA  FL+++ V +E+  NYVV+KHAALF ST+MSK
Sbjct  110  IEASVSPGGGCWLGGQLFSAMVLRKPADEFLNDIGVPFEDEGNYVVVKHAALFMSTLMSK  169

Query  611  LLARPNVKLFNA  646
            +LA PNVKLFNA
Sbjct  170  VLAMPNVKLFNA  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000