BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF043O10

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004251903.1|  PREDICTED: glycerophosphodiester phosphodies...    334   3e-106   Solanum lycopersicum
ref|XP_006344880.1|  PREDICTED: probable glycerophosphoryl dieste...    327   1e-103   Solanum tuberosum [potatoes]
ref|XP_009787408.1|  PREDICTED: probable glycerophosphoryl dieste...    327   2e-103   Nicotiana sylvestris
ref|XP_003530777.1|  PREDICTED: probable glycerophosphoryl dieste...    325   1e-102   Glycine max [soybeans]
ref|XP_009625976.1|  PREDICTED: probable glycerophosphoryl dieste...    323   3e-102   Nicotiana tomentosiformis
ref|XP_009588257.1|  PREDICTED: probable glycerophosphoryl dieste...    322   1e-101   
gb|KHM99500.1|  Putative glycerophosphoryl diester phosphodiester...    321   3e-101   Glycine soja [wild soybean]
ref|XP_006346174.1|  PREDICTED: probable glycerophosphoryl dieste...    320   1e-100   Solanum tuberosum [potatoes]
ref|XP_010324292.1|  PREDICTED: glycerophosphodiester phosphodies...    319   1e-100   Solanum lycopersicum
gb|KJB62956.1|  hypothetical protein B456_009G445400                    314   4e-100   Gossypium raimondii
ref|XP_002529027.1|  glycerophosphoryl diester phosphodiesterase,...    318   7e-100   Ricinus communis
ref|XP_007020654.1|  PLC-like phosphodiesterase family protein, p...    310   2e-99    
ref|XP_009364631.1|  PREDICTED: probable glycerophosphoryl dieste...    307   2e-99    Pyrus x bretschneideri [bai li]
gb|KDP39221.1|  hypothetical protein JCGZ_00978                         316   3e-99    Jatropha curcas
ref|XP_003530778.1|  PREDICTED: probable glycerophosphoryl dieste...    315   6e-99    Glycine max [soybeans]
ref|XP_008364336.1|  PREDICTED: probable glycerophosphoryl dieste...    309   8e-99    
gb|KJB62955.1|  hypothetical protein B456_009G445400                    313   3e-98    Gossypium raimondii
ref|XP_006452490.1|  hypothetical protein CICLE_v10007536mg             312   8e-98    Citrus clementina [clementine]
ref|XP_007146553.1|  hypothetical protein PHAVU_006G0504001g            305   1e-97    Phaseolus vulgaris [French bean]
ref|XP_007214645.1|  hypothetical protein PRUPE_ppa001847mg             311   2e-97    Prunus persica
gb|KHN43860.1|  Putative glycerophosphoryl diester phosphodiester...    311   2e-97    Glycine soja [wild soybean]
ref|XP_007020653.1|  PLC-like phosphodiesterase family protein, p...    311   3e-97    
ref|XP_007020652.1|  PLC-like phosphodiesterase family protein, p...    311   3e-97    
ref|XP_003519608.1|  PREDICTED: probable glycerophosphoryl dieste...    310   4e-97    Glycine max [soybeans]
ref|XP_009335427.1|  PREDICTED: probable glycerophosphoryl dieste...    310   4e-97    Pyrus x bretschneideri [bai li]
ref|XP_008366428.1|  PREDICTED: probable glycerophosphoryl dieste...    308   2e-96    
ref|XP_011097815.1|  PREDICTED: glycerophosphodiester phosphodies...    308   2e-96    Sesamum indicum [beniseed]
ref|XP_008227060.1|  PREDICTED: probable glycerophosphoryl dieste...    308   4e-96    Prunus mume [ume]
gb|KHN23877.1|  Putative glycerophosphoryl diester phosphodiester...    307   5e-96    Glycine soja [wild soybean]
emb|CDP13760.1|  unnamed protein product                                307   7e-96    Coffea canephora [robusta coffee]
gb|KJB13801.1|  hypothetical protein B456_002G094900                    304   2e-95    Gossypium raimondii
gb|KJB13800.1|  hypothetical protein B456_002G094900                    304   2e-95    Gossypium raimondii
ref|XP_003544723.1|  PREDICTED: probable glycerophosphoryl dieste...    304   1e-94    Glycine max [soybeans]
ref|XP_007142367.1|  hypothetical protein PHAVU_008G274300g             304   1e-94    Phaseolus vulgaris [French bean]
gb|KJB13799.1|  hypothetical protein B456_002G094900                    304   1e-94    Gossypium raimondii
ref|XP_004491450.1|  PREDICTED: probable glycerophosphoryl dieste...    302   4e-94    Cicer arietinum [garbanzo]
gb|KDO62177.1|  hypothetical protein CISIN_1g003550mg                   296   4e-94    Citrus sinensis [apfelsine]
ref|XP_004293798.1|  PREDICTED: glycerophosphodiester phosphodies...    302   4e-94    Fragaria vesca subsp. vesca
gb|KCW70260.1|  hypothetical protein EUGRSUZ_F03515                     297   7e-94    Eucalyptus grandis [rose gum]
gb|EYU33686.1|  hypothetical protein MIMGU_mgv1a001772mg                302   8e-94    Erythranthe guttata [common monkey flower]
ref|XP_007142366.1|  hypothetical protein PHAVU_008G274200g             301   1e-93    Phaseolus vulgaris [French bean]
ref|XP_007146559.1|  hypothetical protein PHAVU_006G050800g             301   1e-93    Phaseolus vulgaris [French bean]
ref|XP_010545539.1|  PREDICTED: glycerophosphodiester phosphodies...    300   2e-93    Tarenaya hassleriana [spider flower]
gb|KDO62176.1|  hypothetical protein CISIN_1g003550mg                   298   2e-93    Citrus sinensis [apfelsine]
ref|XP_011014752.1|  PREDICTED: glycerophosphodiester phosphodies...    300   2e-93    Populus euphratica
gb|KHG12016.1|  putative glycerophosphoryl diester phosphodiester...    301   2e-93    Gossypium arboreum [tree cotton]
ref|XP_008349893.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    292   2e-93    
emb|CAN61355.1|  hypothetical protein VITISV_027762                     297   3e-93    Vitis vinifera
gb|KCW70259.1|  hypothetical protein EUGRSUZ_F03515                     297   4e-93    Eucalyptus grandis [rose gum]
gb|KHG08046.1|  putative glycerophosphoryl diester phosphodiester...    300   7e-93    Gossypium arboreum [tree cotton]
gb|KEH28442.1|  glycerophosphoryl diester phosphodiesterase famil...    296   1e-92    Medicago truncatula
ref|XP_011095489.1|  PREDICTED: glycerophosphodiester phosphodies...    298   1e-92    Sesamum indicum [beniseed]
gb|KDO62175.1|  hypothetical protein CISIN_1g003550mg                   298   2e-92    Citrus sinensis [apfelsine]
ref|XP_010253010.1|  PREDICTED: glycerophosphodiester phosphodies...    297   2e-92    Nelumbo nucifera [Indian lotus]
ref|XP_010545263.1|  PREDICTED: glycerophosphodiester phosphodies...    297   4e-92    Tarenaya hassleriana [spider flower]
ref|XP_010064948.1|  PREDICTED: probable glycerophosphoryl dieste...    296   5e-92    
ref|XP_002276757.1|  PREDICTED: glycerophosphodiester phosphodies...    296   8e-92    Vitis vinifera
ref|XP_004491451.1|  PREDICTED: probable glycerophosphoryl dieste...    296   8e-92    Cicer arietinum [garbanzo]
ref|XP_011013351.1|  PREDICTED: glycerophosphodiester phosphodies...    296   9e-92    Populus euphratica
ref|XP_010270134.1|  PREDICTED: glycerophosphodiester phosphodies...    296   1e-91    Nelumbo nucifera [Indian lotus]
ref|XP_007146558.1|  hypothetical protein PHAVU_006G050600g             296   1e-91    Phaseolus vulgaris [French bean]
ref|XP_003617676.1|  Glycerophosphodiesterase-like protein              296   1e-91    Medicago truncatula
gb|KDO62174.1|  hypothetical protein CISIN_1g003550mg                   297   2e-91    Citrus sinensis [apfelsine]
ref|XP_010536709.1|  PREDICTED: glycerophosphodiester phosphodies...    295   2e-91    Tarenaya hassleriana [spider flower]
ref|XP_002862842.1|  glycerophosphoryl diester phosphodiesterase ...    295   2e-91    
ref|XP_008447692.1|  PREDICTED: probable glycerophosphoryl dieste...    295   2e-91    Cucumis melo [Oriental melon]
ref|XP_010675854.1|  PREDICTED: glycerophosphodiester phosphodies...    295   3e-91    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002300353.2|  glycerophosphoryl diester phosphodiesterase ...    288   5e-91    
ref|XP_009361078.1|  PREDICTED: probable glycerophosphoryl dieste...    294   5e-91    Pyrus x bretschneideri [bai li]
ref|XP_009348463.1|  PREDICTED: probable glycerophosphoryl dieste...    294   7e-91    Pyrus x bretschneideri [bai li]
ref|XP_010099974.1|  putative glycerophosphoryl diester phosphodi...    293   1e-90    
ref|XP_004499801.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    293   1e-90    
ref|XP_011014930.1|  PREDICTED: glycerophosphodiester phosphodies...    293   2e-90    Populus euphratica
ref|XP_002883252.1|  glycerophosphoryl diester phosphodiesterase ...    292   2e-90    
ref|XP_006474966.1|  PREDICTED: probable glycerophosphoryl dieste...    292   3e-90    Citrus sinensis [apfelsine]
ref|XP_002300351.2|  hypothetical protein POPTR_0001s37160g             292   4e-90    Populus trichocarpa [western balsam poplar]
ref|XP_002864395.1|  glycerophosphoryl diester phosphodiesterase ...    291   6e-90    
ref|XP_010482994.1|  PREDICTED: glycerophosphodiester phosphodies...    291   1e-89    Camelina sativa [gold-of-pleasure]
ref|XP_009798152.1|  PREDICTED: probable glycerophosphoryl dieste...    280   2e-89    Nicotiana sylvestris
gb|KFK27133.1|  hypothetical protein AALP_AA8G339300                    290   4e-89    Arabis alpina [alpine rockcress]
ref|XP_006401453.1|  hypothetical protein EUTSA_v10012748mg             290   4e-89    Eutrema salsugineum [saltwater cress]
ref|NP_567755.1|  glycerophosphoryl diester phosphodiesterase-like 3    290   4e-89    Arabidopsis thaliana [mouse-ear cress]
gb|AAL07129.1|  unknown protein                                         290   4e-89    Arabidopsis thaliana [mouse-ear cress]
emb|CAB36515.1|  putative protein                                       290   4e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010913178.1|  PREDICTED: glycerophosphodiester phosphodies...    287   4e-89    
ref|XP_010252665.1|  PREDICTED: glycerophosphodiester phosphodies...    289   6e-89    Nelumbo nucifera [Indian lotus]
ref|XP_010443178.1|  PREDICTED: glycerophosphodiester phosphodies...    289   9e-89    Camelina sativa [gold-of-pleasure]
gb|AAO42211.1|  unknown protein                                         288   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406374.1|  hypothetical protein EUTSA_v10020151mg             287   1e-88    
ref|NP_188688.1|  glycerophosphodiester phosphodiesterase-like pr...    287   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010913177.1|  PREDICTED: glycerophosphodiester phosphodies...    287   3e-88    Elaeis guineensis
ref|XP_006280047.1|  hypothetical protein CARUB_v10025925mg             285   4e-88    
emb|CDY45656.1|  BnaC09g31980D                                          283   1e-87    Brassica napus [oilseed rape]
gb|EYU27402.1|  hypothetical protein MIMGU_mgv1a001806mg                285   1e-87    Erythranthe guttata [common monkey flower]
ref|XP_006280048.1|  hypothetical protein CARUB_v10025925mg             285   2e-87    Capsella rubella
ref|NP_200359.1|  putative glycerophosphoryl diester phosphodiest...    285   3e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010449676.1|  PREDICTED: glycerophosphodiester phosphodies...    285   3e-87    Camelina sativa [gold-of-pleasure]
ref|XP_004294052.1|  PREDICTED: glycerophosphodiester phosphodies...    284   5e-87    Fragaria vesca subsp. vesca
ref|XP_009120058.1|  PREDICTED: probable glycerophosphoryl dieste...    284   6e-87    Brassica rapa
emb|CDY17323.1|  BnaA10g09570D                                          284   7e-87    Brassica napus [oilseed rape]
ref|XP_010433460.1|  PREDICTED: glycerophosphodiester phosphodies...    281   8e-87    
ref|XP_010252664.1|  PREDICTED: glycerophosphodiester phosphodies...    283   1e-86    Nelumbo nucifera [Indian lotus]
ref|NP_001047275.1|  Os02g0588500                                       282   2e-86    
ref|XP_006297062.1|  hypothetical protein CARUB_v10013062mg             281   3e-86    Capsella rubella
ref|XP_006283180.1|  hypothetical protein CARUB_v10004210mg             281   4e-86    Capsella rubella
ref|XP_009417318.1|  PREDICTED: probable glycerophosphoryl dieste...    281   7e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004150252.1|  PREDICTED: probable glycerophosphoryl dieste...    281   7e-86    Cucumis sativus [cucumbers]
ref|XP_008806340.1|  PREDICTED: probable glycerophosphoryl dieste...    282   7e-86    Phoenix dactylifera
ref|XP_010448228.1|  PREDICTED: glycerophosphodiester phosphodies...    281   7e-86    Camelina sativa [gold-of-pleasure]
gb|KHN28413.1|  Putative glycerophosphoryl diester phosphodiester...    280   1e-85    Glycine soja [wild soybean]
ref|XP_010438711.1|  PREDICTED: glycerophosphodiester phosphodies...    280   1e-85    Camelina sativa [gold-of-pleasure]
ref|XP_002452366.1|  hypothetical protein SORBIDRAFT_04g024440          280   2e-85    Sorghum bicolor [broomcorn]
emb|CDX94294.1|  BnaC01g18900D                                          280   2e-85    
ref|XP_009415406.1|  PREDICTED: probable glycerophosphoryl dieste...    280   2e-85    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX89312.1|  BnaA01g15810D                                          280   2e-85    
ref|XP_009142640.1|  PREDICTED: probable glycerophosphoryl dieste...    280   2e-85    Brassica rapa
ref|XP_004975931.1|  PREDICTED: probable glycerophosphoryl dieste...    279   2e-85    Setaria italica
gb|KFK29182.1|  hypothetical protein AALP_AA7G100300                    279   3e-85    Arabis alpina [alpine rockcress]
gb|EPS69135.1|  glycerophosphodiesterase-like protein                   277   4e-85    Genlisea aurea
ref|XP_006413151.1|  hypothetical protein EUTSA_v10024494mg             279   5e-85    Eutrema salsugineum [saltwater cress]
emb|CDY11996.1|  BnaC03g14220D                                          279   5e-85    Brassica napus [oilseed rape]
emb|CDY72472.1|  BnaAnng41260D                                          268   6e-85    Brassica napus [oilseed rape]
gb|EMS62136.1|  putative glycerophosphoryl diester phosphodiester...    278   8e-85    Triticum urartu
ref|XP_006344951.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    268   1e-84    
gb|KFK39359.1|  hypothetical protein AALP_AA3G234500                    277   1e-84    Arabis alpina [alpine rockcress]
ref|XP_009137609.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    277   2e-84    Brassica rapa
emb|CDY14478.1|  BnaC03g21170D                                          283   2e-84    Brassica napus [oilseed rape]
ref|NP_176869.2|  putative glycerophosphoryl diester phosphodiest...    277   2e-84    Arabidopsis thaliana [mouse-ear cress]
gb|AAP40466.1|  unknown protein                                         277   2e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867546.1|  MRH5/SHV3                                          276   2e-84    
ref|XP_006391459.1|  hypothetical protein EUTSA_v10018170mg             277   3e-84    Eutrema salsugineum [saltwater cress]
emb|CDY29432.1|  BnaC05g32380D                                          273   3e-84    Brassica napus [oilseed rape]
ref|XP_009145621.1|  PREDICTED: probable glycerophosphoryl dieste...    276   3e-84    Brassica rapa
ref|NP_001169682.1|  hypothetical protein precursor                     276   3e-84    Zea mays [maize]
emb|CDY19634.1|  BnaA05g20420D                                          276   3e-84    Brassica napus [oilseed rape]
ref|XP_009105134.1|  PREDICTED: probable glycerophosphoryl dieste...    276   4e-84    Brassica rapa
ref|NP_001185333.1|  putative glycerophosphoryl diester phosphodi...    277   4e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513618.1|  PREDICTED: glycerophosphodiester phosphodies...    273   5e-84    Camelina sativa [gold-of-pleasure]
ref|XP_006652401.1|  PREDICTED: probable glycerophosphoryl dieste...    275   9e-84    Oryza brachyantha
ref|XP_002888565.1|  glycerophosphoryl diester phosphodiesterase ...    274   1e-83    
ref|XP_002446646.1|  hypothetical protein SORBIDRAFT_06g019730          275   2e-83    Sorghum bicolor [broomcorn]
ref|XP_010928867.1|  PREDICTED: glycerophosphodiester phosphodies...    275   2e-83    Elaeis guineensis
ref|XP_003579951.1|  PREDICTED: glycerophosphodiester phosphodies...    274   2e-83    Brachypodium distachyon [annual false brome]
ref|XP_009132384.1|  PREDICTED: probable glycerophosphoryl dieste...    274   3e-83    Brassica rapa
ref|XP_010511610.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    274   3e-83    Camelina sativa [gold-of-pleasure]
gb|EMT15515.1|  Putative glycerophosphoryl diester phosphodiester...    276   4e-83    
ref|XP_010511612.1|  PREDICTED: glycerophosphodiester phosphodies...    274   4e-83    Camelina sativa [gold-of-pleasure]
gb|EMS58329.1|  putative glycerophosphoryl diester phosphodiester...    273   5e-83    Triticum urartu
emb|CDY36746.1|  BnaA03g11400D                                          273   5e-83    Brassica napus [oilseed rape]
gb|EMT29224.1|  Putative glycerophosphoryl diester phosphodiester...    275   6e-83    
ref|XP_010470589.1|  PREDICTED: glycerophosphodiester phosphodies...    273   8e-83    Camelina sativa [gold-of-pleasure]
emb|CDX92782.1|  BnaC07g40400D                                          278   9e-83    
ref|XP_006647435.1|  PREDICTED: probable glycerophosphoryl dieste...    272   9e-83    Oryza brachyantha
ref|XP_010419030.1|  PREDICTED: glycerophosphodiester phosphodies...    273   1e-82    
ref|XP_010675853.1|  PREDICTED: glycerophosphodiester phosphodies...    272   1e-82    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY36036.1|  BnaC03g41620D                                          274   1e-82    Brassica napus [oilseed rape]
ref|XP_010415240.1|  PREDICTED: glycerophosphodiester phosphodies...    273   1e-82    Camelina sativa [gold-of-pleasure]
emb|CDY61647.1|  BnaCnng38120D                                          272   1e-82    Brassica napus [oilseed rape]
ref|XP_010235616.1|  PREDICTED: glycerophosphodiester phosphodies...    270   1e-82    
ref|NP_001053060.1|  Os04g0472300                                       271   2e-82    
ref|XP_010474164.1|  PREDICTED: glycerophosphodiester phosphodies...    269   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010474166.1|  PREDICTED: glycerophosphodiester phosphodies...    258   2e-82    Camelina sativa [gold-of-pleasure]
dbj|BAJ85772.1|  predicted protein                                      271   2e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ87963.1|  predicted protein                                      271   3e-82    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008645878.1|  PREDICTED: probable glycerophosphoryl dieste...    271   4e-82    Zea mays [maize]
ref|NP_001168748.1|  uncharacterized protein LOC100382543 precursor     271   4e-82    Zea mays [maize]
emb|CDY12605.1|  BnaA02g12730D                                          270   4e-82    Brassica napus [oilseed rape]
ref|XP_010913957.1|  PREDICTED: glycerophosphodiester phosphodies...    270   5e-82    
ref|XP_009390640.1|  PREDICTED: probable glycerophosphoryl dieste...    270   5e-82    Musa acuminata subsp. malaccensis [pisang utan]
emb|CAH67272.1|  B0806H07.1                                             270   7e-82    Oryza sativa [red rice]
ref|XP_006586115.1|  PREDICTED: probable glycerophosphoryl dieste...    268   8e-82    Glycine max [soybeans]
ref|XP_010913956.1|  PREDICTED: glycerophosphodiester phosphodies...    270   1e-81    Elaeis guineensis
ref|XP_008798764.1|  PREDICTED: probable glycerophosphoryl dieste...    267   1e-81    Phoenix dactylifera
ref|XP_003575252.1|  PREDICTED: glycerophosphodiester phosphodies...    269   1e-81    
ref|XP_006300773.1|  hypothetical protein CARUB_v10019847mg             269   2e-81    
ref|XP_004952935.1|  PREDICTED: probable glycerophosphoryl dieste...    268   3e-81    
ref|NP_176870.2|  suppressor of npr1-1 constitutive 4                   273   3e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782908.1|  PREDICTED: probable glycerophosphoryl dieste...    268   4e-81    Phoenix dactylifera
ref|XP_009108190.1|  PREDICTED: probable glycerophosphoryl dieste...    268   4e-81    Brassica rapa
emb|CDY46667.1|  BnaA03g48410D                                          273   6e-81    Brassica napus [oilseed rape]
ref|XP_009137635.1|  PREDICTED: probable glycerophosphoryl dieste...    273   9e-81    Brassica rapa
ref|XP_010496108.1|  PREDICTED: glycerophosphodiester phosphodies...    267   1e-80    Camelina sativa [gold-of-pleasure]
ref|XP_008798763.1|  PREDICTED: probable glycerophosphoryl dieste...    267   2e-80    Phoenix dactylifera
ref|XP_009127510.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    266   2e-80    Brassica rapa
emb|CDY13237.1|  BnaC09g24190D                                          264   2e-79    Brassica napus [oilseed rape]
ref|XP_006300797.1|  hypothetical protein CARUB_v10019878mg             261   8e-79    
gb|AAF98210.1|AC007152_6  Unknown protein                               266   1e-78    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009127505.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    267   1e-78    
ref|XP_006300799.1|  hypothetical protein CARUB_v10019878mg             260   1e-78    
ref|XP_006279181.1|  hypothetical protein CARUB_v10007932mg             259   2e-78    
ref|XP_004500131.1|  PREDICTED: probable glycerophosphoryl dieste...    260   2e-78    Cicer arietinum [garbanzo]
emb|CDY58867.1|  BnaC09g52640D                                          260   2e-78    Brassica napus [oilseed rape]
ref|XP_008799657.1|  PREDICTED: probable glycerophosphoryl dieste...    259   7e-78    Phoenix dactylifera
ref|XP_010511611.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    263   8e-78    
ref|XP_006279182.1|  hypothetical protein CARUB_v10007932mg             259   1e-77    Capsella rubella
ref|XP_006660255.1|  PREDICTED: probable glycerophosphoryl dieste...    258   3e-77    
ref|XP_010928375.1|  PREDICTED: LOW QUALITY PROTEIN: glycerophosp...    258   3e-77    Elaeis guineensis
ref|XP_010496109.1|  PREDICTED: glycerophosphodiester phosphodies...    261   4e-77    
ref|XP_002888566.1|  kinase family protein                              261   5e-77    
ref|XP_010109457.1|  putative glycerophosphoryl diester phosphodi...    257   7e-77    Morus notabilis
ref|XP_006856834.1|  hypothetical protein AMTR_s00055p00174750          256   1e-76    Amborella trichopoda
ref|XP_010485211.1|  PREDICTED: glycerophosphodiester phosphodies...    248   3e-76    Camelina sativa [gold-of-pleasure]
ref|XP_009399679.1|  PREDICTED: probable glycerophosphoryl dieste...    255   3e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008811210.1|  PREDICTED: probable glycerophosphoryl dieste...    252   3e-76    
gb|AES70468.2|  glycerophosphoryl diester phosphodiesterase famil...    253   7e-76    Medicago truncatula
ref|XP_007146557.1|  hypothetical protein PHAVU_006G050600g             252   1e-75    Phaseolus vulgaris [French bean]
ref|XP_010443532.1|  PREDICTED: glycerophosphodiester phosphodies...    249   1e-75    Camelina sativa [gold-of-pleasure]
ref|XP_003600217.1|  Glycerophosphodiesterase-like protein              253   1e-75    
ref|XP_009385529.1|  PREDICTED: probable glycerophosphoryl dieste...    250   2e-75    
ref|XP_009120321.1|  PREDICTED: probable glycerophosphoryl dieste...    253   3e-75    Brassica rapa
ref|XP_003553031.1|  PREDICTED: probable glycerophosphoryl dieste...    252   4e-75    
ref|XP_010446175.1|  PREDICTED: glycerophosphodiester phosphodies...    249   4e-75    
emb|CDY43885.1|  BnaC09g33580D                                          251   6e-75    Brassica napus [oilseed rape]
ref|XP_008811209.1|  PREDICTED: probable glycerophosphoryl dieste...    251   1e-74    Phoenix dactylifera
ref|XP_003530776.1|  PREDICTED: probable glycerophosphoryl dieste...    250   1e-74    Glycine max [soybeans]
ref|NP_001062173.1|  Os08g0503200                                       251   1e-74    
gb|KHM99502.1|  Putative glycerophosphoryl diester phosphodiester...    250   1e-74    Glycine soja [wild soybean]
ref|XP_007146552.1|  hypothetical protein PHAVU_006G050300g             249   2e-74    Phaseolus vulgaris [French bean]
ref|XP_010687738.1|  PREDICTED: glycerophosphodiester phosphodies...    250   2e-74    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004973845.1|  PREDICTED: probable glycerophosphoryl dieste...    249   2e-74    Setaria italica
dbj|BAJ93663.1|  predicted protein                                      249   5e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010453288.1|  PREDICTED: glycerophosphodiester phosphodies...    249   6e-74    Camelina sativa [gold-of-pleasure]
ref|XP_004973844.1|  PREDICTED: probable glycerophosphoryl dieste...    248   1e-73    Setaria italica
ref|XP_007020655.1|  SHV3-like 2, putative isoform 4                    244   2e-73    
ref|XP_006401135.1|  hypothetical protein EUTSA_v10012762mg             247   3e-73    
ref|XP_002866246.1|  glycerophosphoryl diester phosphodiesterase ...    246   1e-72    Arabidopsis lyrata subsp. lyrata
ref|XP_007201937.1|  hypothetical protein PRUPE_ppa001673mg             246   1e-72    Prunus persica
gb|EMT33222.1|  Putative glycerophosphoryl diester phosphodiester...    246   1e-72    
ref|XP_010483370.1|  PREDICTED: glycerophosphodiester phosphodies...    245   2e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010943202.1|  PREDICTED: glycerophosphodiester phosphodies...    244   4e-72    Elaeis guineensis
ref|XP_002866252.1|  glycerophosphoryl diester phosphodiesterase ...    244   4e-72    Arabidopsis lyrata subsp. lyrata
ref|NP_200625.1|  glycerophosphodiester phosphodiesterase like 7        244   6e-72    Arabidopsis thaliana [mouse-ear cress]
ref|NP_200613.2|  glycerophosphodiester phosphodiesterase like 6        243   8e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282081.1|  hypothetical protein CARUB_v10028327mg             243   8e-72    Capsella rubella
ref|XP_010453117.1|  PREDICTED: glycerophosphodiester phosphodies...    243   1e-71    Camelina sativa [gold-of-pleasure]
gb|EMS66577.1|  putative glycerophosphoryl diester phosphodiester...    248   1e-71    Triticum urartu
ref|XP_008384576.1|  PREDICTED: LOW QUALITY PROTEIN: probable gly...    243   2e-71    
ref|XP_008343908.1|  PREDICTED: probable glycerophosphoryl dieste...    243   2e-71    
ref|XP_008242952.1|  PREDICTED: probable glycerophosphoryl dieste...    243   2e-71    Prunus mume [ume]
ref|XP_008440682.1|  PREDICTED: probable glycerophosphoryl dieste...    241   6e-71    Cucumis melo [Oriental melon]
ref|XP_003572357.1|  PREDICTED: glycerophosphodiester phosphodies...    241   8e-71    
ref|XP_002461022.1|  hypothetical protein SORBIDRAFT_02g039350          237   9e-71    
ref|XP_010656583.1|  PREDICTED: glycerophosphodiester phosphodies...    240   9e-71    Vitis vinifera
ref|XP_006829998.1|  hypothetical protein AMTR_s00252p00015420          240   1e-70    Amborella trichopoda
emb|CBI18678.3|  unnamed protein product                                240   1e-70    Vitis vinifera
ref|XP_002445920.1|  hypothetical protein SORBIDRAFT_07g028050          242   1e-70    
ref|XP_010536984.1|  PREDICTED: glycerophosphodiester phosphodies...    239   2e-70    Tarenaya hassleriana [spider flower]
emb|CDY11831.1|  BnaC03g12570D                                          236   2e-70    Brassica napus [oilseed rape]
ref|XP_009366150.1|  PREDICTED: probable glycerophosphoryl dieste...    239   4e-70    Pyrus x bretschneideri [bai li]
dbj|BAD28342.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    237   5e-70    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009396661.1|  PREDICTED: probable glycerophosphoryl dieste...    238   5e-70    
emb|CDY02788.1|  BnaC02g11010D                                          238   7e-70    
ref|XP_009358473.1|  PREDICTED: probable glycerophosphoryl dieste...    238   8e-70    Pyrus x bretschneideri [bai li]
ref|XP_002523503.1|  glycerophosphoryl diester phosphodiesterase,...    238   1e-69    Ricinus communis
gb|KCW78936.1|  hypothetical protein EUGRSUZ_C00368                     238   1e-69    Eucalyptus grandis [rose gum]
emb|CDY02800.1|  BnaC02g10890D                                          238   1e-69    
gb|AFW70514.1|  hypothetical protein ZEAMMB73_076757                    236   1e-69    
ref|XP_009126781.1|  PREDICTED: probable glycerophosphoryl dieste...    237   1e-69    
ref|XP_009126782.1|  PREDICTED: probable glycerophosphoryl dieste...    237   2e-69    
emb|CDY32720.1|  BnaA02g07820D                                          237   2e-69    Brassica napus [oilseed rape]
gb|AFW66254.1|  hypothetical protein ZEAMMB73_246886                    236   3e-69    
tpg|DAA47913.1|  TPA: hypothetical protein ZEAMMB73_887943              234   3e-69    
ref|XP_004951679.1|  PREDICTED: probable glycerophosphoryl dieste...    236   4e-69    
ref|XP_004965787.1|  PREDICTED: probable glycerophosphoryl dieste...    233   5e-69    
ref|XP_008361197.1|  PREDICTED: probable glycerophosphoryl dieste...    236   5e-69    
ref|XP_009132086.1|  PREDICTED: probable glycerophosphoryl dieste...    236   5e-69    Brassica rapa
ref|XP_007011972.1|  SHV3-like 5                                        235   8e-69    
ref|XP_008645346.1|  PREDICTED: probable glycerophosphoryl dieste...    235   9e-69    Zea mays [maize]
emb|CDY32730.1|  BnaA02g07920D                                          234   1e-68    Brassica napus [oilseed rape]
ref|XP_009126795.1|  PREDICTED: probable glycerophosphoryl dieste...    234   1e-68    Brassica rapa
ref|XP_002325146.2|  hypothetical protein POPTR_0018s11890g             234   1e-68    Populus trichocarpa [western balsam poplar]
ref|XP_004979884.1|  PREDICTED: probable glycerophosphoryl dieste...    237   1e-68    Setaria italica
emb|CDX88656.1|  BnaA03g09930D                                          235   2e-68    
ref|XP_008677441.1|  PREDICTED: uncharacterized protein LOC100304...    236   2e-68    
ref|XP_008677440.1|  PREDICTED: uncharacterized protein LOC100304...    236   3e-68    
ref|XP_008677439.1|  PREDICTED: uncharacterized protein LOC100304...    236   3e-68    
ref|XP_010050300.1|  PREDICTED: probable glycerophosphoryl dieste...    234   5e-68    
ref|XP_008645839.1|  PREDICTED: uncharacterized protein LOC100384...    233   5e-68    
ref|XP_004965786.1|  PREDICTED: probable glycerophosphoryl dieste...    233   7e-68    
gb|KHN28414.1|  Putative glycerophosphoryl diester phosphodiester...    231   1e-67    
ref|XP_004143578.1|  PREDICTED: probable glycerophosphoryl dieste...    232   1e-67    
ref|XP_004160165.1|  PREDICTED: probable glycerophosphoryl dieste...    232   1e-67    
gb|EAY86479.1|  hypothetical protein OsI_07859                          231   1e-67    
ref|XP_010241663.1|  PREDICTED: glycerophosphodiester phosphodies...    232   1e-67    
ref|NP_001170117.1|  hypothetical protein                               230   4e-67    
gb|AFW72078.1|  hypothetical protein ZEAMMB73_869244                    222   4e-67    
ref|XP_010483369.1|  PREDICTED: glycerophosphodiester phosphodies...    224   5e-66    
ref|XP_011033465.1|  PREDICTED: glycerophosphodiester phosphodies...    226   1e-65    
ref|XP_008679540.1|  PREDICTED: probable glycerophosphoryl dieste...    227   2e-65    
ref|XP_006279180.1|  hypothetical protein CARUB_v10007932mg             222   2e-65    
gb|KDO59429.1|  hypothetical protein CISIN_1g005894mg                   224   4e-65    
ref|NP_001046128.1|  Os02g0187400                                       224   4e-65    
ref|XP_011460616.1|  PREDICTED: glycerophosphodiester phosphodies...    225   5e-65    
ref|XP_006474608.1|  PREDICTED: probable glycerophosphoryl dieste...    225   6e-65    
gb|KHM99501.1|  Putative glycerophosphoryl diester phosphodiester...    211   7e-65    
dbj|BAD15424.1|  glycerophosphoryl diester phosphodiesterase 2 pr...    224   1e-64    
gb|EEE56466.1|  hypothetical protein OsJ_05675                          224   4e-64    
emb|CDY46687.1|  BnaA03g48210D                                          221   7e-64    
ref|XP_002437331.1|  hypothetical protein SORBIDRAFT_10g025000          221   1e-63    
gb|EEC72640.1|  hypothetical protein OsI_06154                          223   2e-63    
gb|EEE53168.1|  hypothetical protein OsJ_36008                          224   2e-63    
ref|XP_006300798.1|  hypothetical protein CARUB_v10019878mg             219   3e-63    
ref|NP_001062919.2|  Os09g0339800                                       218   5e-63    
gb|KDP38642.1|  hypothetical protein JCGZ_03995                         219   9e-63    
gb|EYU25341.1|  hypothetical protein MIMGU_mgv1a001922mg                219   9e-63    
ref|XP_003570935.1|  PREDICTED: glycerophosphodiester phosphodies...    216   7e-62    
ref|XP_009803613.1|  PREDICTED: probable glycerophosphoryl dieste...    215   8e-62    
ref|XP_002308389.2|  hypothetical protein POPTR_0006s20170g             216   1e-61    
gb|KHN22089.1|  Putative glycerophosphoryl diester phosphodiester...    215   2e-61    
ref|XP_009803612.1|  PREDICTED: probable glycerophosphoryl dieste...    216   2e-61    
ref|XP_011084009.1|  PREDICTED: glycerophosphodiester phosphodies...    215   2e-61    
gb|KEH37864.1|  glycerophosphoryl diester phosphodiesterase famil...    216   2e-61    
ref|XP_003541467.2|  PREDICTED: probable glycerophosphoryl dieste...    215   4e-61    
emb|CDP10204.1|  unnamed protein product                                214   4e-61    
gb|EEC69228.1|  hypothetical protein OsI_38235                          215   7e-61    
gb|EMT03737.1|  Putative glycerophosphoryl diester phosphodiester...    216   8e-61    
gb|EPS68532.1|  hypothetical protein M569_06231                         212   9e-61    
ref|XP_009594117.1|  PREDICTED: probable glycerophosphoryl dieste...    213   2e-60    
emb|CDX92806.1|  BnaC07g40640D                                          211   4e-60    
gb|EMS54688.1|  putative glycerophosphoryl diester phosphodiester...    211   4e-60    
gb|KHN18329.1|  Putative glycerophosphoryl diester phosphodiester...    211   5e-60    
ref|XP_006600556.1|  PREDICTED: probable glycerophosphoryl dieste...    211   6e-60    
gb|EMT22700.1|  Putative glycerophosphoryl diester phosphodiester...    211   1e-59    
ref|XP_010231120.1|  PREDICTED: glycerophosphodiester phosphodies...    207   7e-59    
dbj|BAK08209.1|  predicted protein                                      207   1e-58    
ref|XP_006340538.1|  PREDICTED: probable glycerophosphoryl dieste...    207   2e-58    
ref|XP_010315575.1|  PREDICTED: glycerophosphodiester phosphodies...    207   2e-58    
ref|XP_003566003.1|  PREDICTED: glycerophosphodiester phosphodies...    206   4e-58    
ref|XP_010231119.1|  PREDICTED: glycerophosphodiester phosphodies...    205   7e-58    
emb|CDY60415.1|  BnaC02g45340D                                          207   9e-58    
gb|AFW66253.1|  hypothetical protein ZEAMMB73_246886                    196   1e-57    
gb|AES92567.2|  glycerophosphoryl diester phosphodiesterase famil...    204   1e-57    
gb|AFW70515.1|  hypothetical protein ZEAMMB73_076757                    197   2e-57    
gb|KJB54927.1|  hypothetical protein B456_009G054700                    201   2e-56    
tpg|DAA63616.1|  TPA: hypothetical protein ZEAMMB73_629479              194   3e-56    
gb|AAD10252.1|  S222                                                    196   3e-56    
ref|XP_011017989.1|  PREDICTED: glycerophosphodiester phosphodies...    200   4e-56    
ref|NP_001142429.1|  uncharacterized protein LOC100274608               193   6e-56    
gb|AAV64200.1|  unknown                                                 192   3e-55    
gb|AAV64238.1|  unknown                                                 191   5e-55    
ref|XP_006340583.1|  PREDICTED: probable glycerophosphoryl dieste...    193   1e-53    
ref|XP_007154910.1|  hypothetical protein PHAVU_003G158000g             193   2e-53    
ref|XP_003610370.1|  GPI-anchored protein                               191   6e-53    
ref|XP_010315562.1|  PREDICTED: glycerophosphodiester phosphodies...    189   3e-52    
emb|CDY71959.1|  BnaCnng75290D                                          180   2e-51    
gb|KHG04342.1|  putative glycerophosphoryl diester phosphodiester...    182   4e-50    
gb|EEE69509.1|  hypothetical protein OsJ_28963                          153   3e-40    
ref|XP_002983605.1|  hypothetical protein SELMODRAFT_118548             152   6e-39    
ref|XP_001766682.1|  predicted protein                                  150   1e-38    
ref|XP_002973791.1|  hypothetical protein SELMODRAFT_100702             149   6e-38    
ref|XP_001756342.1|  predicted protein                                  145   2e-36    
ref|XP_010488033.1|  PREDICTED: glycerophosphodiester phosphodies...    124   1e-30    
ref|XP_001756508.1|  predicted protein                                  120   1e-27    
emb|CDX82242.1|  BnaA03g35790D                                          113   1e-25    
ref|NP_001066731.1|  Os12g0456700                                       108   3e-24    
emb|CDY12599.1|  BnaA02g12670D                                          106   1e-23    
emb|CDX86766.1|  BnaA09g21560D                                          105   2e-22    
ref|WP_041549205.1|  glycerophosphodiester phosphodiesterase          67.4    1e-09    
gb|AFY93535.1|  glycerophosphoryl diester phosphodiesterase           67.4    2e-09    
ref|WP_036813012.1|  glycerophosphodiester phosphodiesterase          66.2    2e-09    
emb|CDS53213.1|  Glycerophosphoryl diester phosphodiesterase          66.2    2e-09    
ref|WP_006197333.1|  Phytase                                          66.6    3e-09    
ref|WP_009768887.1|  glycerophosphoryl diester phosphodiesterase ...  66.2    3e-09    
ref|WP_036269981.1|  glycerophosphodiester phosphodiesterase          64.3    6e-09    
ref|WP_015191413.1|  glycerophosphoryl diester phosphodiesterase      63.9    9e-09    
ref|WP_006275748.1|  Glycerophosphoryl diester phosphodiesterase      64.3    1e-08    
ref|WP_044205264.1|  glycerophosphodiester phosphodiesterase          63.5    1e-08    
gb|EDX77851.1|  Glycerophosphoryl diester phosphodiesterase family    63.2    1e-08    
ref|WP_008273762.1|  glycerophosphoryl diester phosphodiesterase      63.2    1e-08    
ref|WP_033428338.1|  glycerophosphodiester phosphodiesterase          61.6    6e-08    
ref|WP_015216930.1|  glycerophosphoryl diester phosphodiesterase      62.4    6e-08    
ref|WP_039887913.1|  glycerophosphodiester phosphodiesterase          61.6    6e-08    
ref|WP_039205034.1|  glycerophosphodiester phosphodiesterase          61.2    8e-08    
ref|WP_015200313.1|  glycerophosphoryl diester phosphodiesterase      61.6    9e-08    
gb|EGK84189.1|  glycerophosphoryl diester phosphodiesterase           61.2    1e-07    
ref|XP_010489971.1|  PREDICTED: glycerophosphodiester phosphodies...  60.5    1e-07    
ref|WP_027401018.1|  glycerophosphodiester phosphodiesterase          60.5    1e-07    
gb|AFZ58601.1|  glycerophosphoryl diester phosphodiesterase           60.1    2e-07    
ref|WP_042465084.1|  glycerophosphodiester phosphodiesterase          60.1    2e-07    
ref|XP_008345038.1|  PREDICTED: probable glycerophosphoryl dieste...  60.1    2e-07    
ref|WP_034264366.1|  glycerophosphodiester phosphodiesterase          59.7    3e-07    
ref|WP_015182722.1|  glycerophosphoryl diester phosphodiesterase      59.3    4e-07    
gb|KJC37893.1|  glycerophosphodiester phosphodiesterase               59.3    5e-07    
ref|WP_044401406.1|  glycerophosphodiester phosphodiesterase          58.9    5e-07    
ref|WP_029554214.1|  glycerophosphodiester phosphodiesterase          58.9    5e-07    
ref|WP_019495104.1|  hypothetical protein                             59.3    6e-07    
ref|WP_016876731.1|  hypothetical protein                             59.3    6e-07    
ref|WP_027550747.1|  glycerophosphodiester phosphodiesterase          58.9    6e-07    
ref|WP_015860505.1|  glycerophosphoryl diester phosphodiesterase      58.5    6e-07    
ref|WP_036772477.1|  glycerophosphodiester phosphodiesterase          58.5    6e-07    
ref|WP_024814502.1|  glycerophosphodiester phosphodiesterase          58.5    6e-07    
gb|AFY31135.1|  glycerophosphoryl diester phosphodiesterase           58.5    7e-07    
ref|WP_005460366.1|  glycerophosphoryl diester phosphodiesterase      58.5    7e-07    
gb|AFY41077.1|  3-phytase, Glycerophosphodiester phosphodiesterase    58.9    7e-07    
ref|WP_044500445.1|  phytase                                          58.9    7e-07    
ref|WP_027522653.1|  glycerophosphodiester phosphodiesterase          58.5    8e-07    
ref|WP_033436466.1|  glycerophosphodiester phosphodiesterase          58.2    8e-07    
ref|WP_042341163.1|  glycerophosphodiester phosphodiesterase          58.2    8e-07    
ref|WP_035061408.1|  glycerophosphodiester phosphodiesterase          58.2    1e-06    
ref|WP_043640045.1|  glycerophosphodiester phosphodiesterase          58.2    1e-06    
ref|WP_006921089.1|  glycerophosphoryl diester phosphodiesterase      57.8    1e-06    
ref|WP_035158284.1|  hypothetical protein                             58.2    1e-06    
ref|WP_035962596.1|  glycerophosphodiester phosphodiesterase          57.8    1e-06    
gb|KDR35626.1|  glycerophosphodiester phosphodiesterase               57.8    1e-06    
ref|WP_009157090.1|  glycerophosphoryl diester phosphodiesterase      57.4    2e-06    
gb|EFV96129.1|  glycerophosphodiester phosphodiesterase family pr...  57.4    2e-06    
ref|WP_022977963.1|  glycerophosphoryl diester phosphodiesterase      57.4    2e-06    
ref|WP_040530492.1|  glycerophosphodiester phosphodiesterase          57.0    2e-06    
ref|WP_043307997.1|  glycerophosphodiester phosphodiesterase          57.0    2e-06    
ref|WP_043900403.1|  glycerophosphodiester phosphodiesterase          57.0    2e-06    
ref|WP_014495011.1|  glycerophosphoryl diester phosphodiesterase      57.0    2e-06    
ref|WP_039148137.1|  glycerophosphodiester phosphodiesterase          57.0    3e-06    
gb|ACF74306.1|  putative glycerophosphoryl diesterphosphodiestera...  55.5    3e-06    
ref|WP_035970536.1|  glycerophosphodiester phosphodiesterase          57.0    3e-06    
ref|WP_027548264.1|  glycerophosphodiester phosphodiesterase          57.0    3e-06    
gb|AGC70933.1|  glycerophosphoryl diester phosphodiesterase           56.6    3e-06    
ref|WP_028156078.1|  glycerophosphodiester phosphodiesterase          56.6    3e-06    
ref|WP_035225304.1|  glycerophosphodiester phosphodiesterase          56.6    4e-06    
ref|WP_035207582.1|  glycerophosphodiester phosphodiesterase          56.6    4e-06    
ref|XP_006603452.1|  PREDICTED: probable glycerophosphoryl dieste...  56.2    4e-06    
gb|ADX45239.1|  glycerophosphoryl diester phosphodiesterase           56.2    4e-06    
ref|WP_041829004.1|  glycerophosphodiester phosphodiesterase          56.2    4e-06    
ref|WP_026436377.1|  glycerophosphodiester phosphodiesterase          56.2    4e-06    
ref|WP_009545338.1|  MULTISPECIES: glycerophosphoryl diester phos...  56.6    4e-06    
gb|KJC37332.1|  glycerophosphodiester phosphodiesterase               56.2    4e-06    
ref|WP_038943066.1|  glycerophosphodiester phosphodiesterase          56.2    5e-06    
ref|WP_035799738.1|  hypothetical protein                             56.2    5e-06    
ref|WP_015080678.1|  glycerophosphoryl diester phosphodiesterase      55.8    5e-06    
ref|WP_038975827.1|  glycerophosphodiester phosphodiesterase          55.8    6e-06    
ref|WP_008906374.1|  glycerophosphoryl diester phosphodiesterase      55.8    6e-06    
ref|WP_043855696.1|  glycerophosphodiester phosphodiesterase          55.8    6e-06    
ref|WP_010463978.1|  glycerophosphoryl diester phosphodiesterase      55.8    6e-06    
ref|WP_024579993.1|  glycerophosphodiester phosphodiesterase          55.8    6e-06    
ref|WP_035666150.1|  glycerophosphodiester phosphodiesterase          55.8    6e-06    
gb|EAZ90224.1|  glycerophosphoryl diester phosphodiesterase           56.2    6e-06    
ref|WP_037223887.1|  glycerophosphodiester phosphodiesterase          55.5    7e-06    
ref|WP_015079761.1|  glycerophosphoryl diester phosphodiesterase      55.8    8e-06    
ref|WP_027404969.1|  glycerophosphodiester phosphodiesterase          55.5    9e-06    
ref|WP_019489152.1|  hypothetical protein                             55.8    1e-05    
ref|WP_040008820.1|  glycerophosphodiester phosphodiesterase          55.1    1e-05    
gb|ERF80098.1|  glycerophosphoryl diester phosphodiesterase           55.1    1e-05    
gb|EFA70022.1|  Glycerophosphoryl diester phosphodiesterase           55.1    1e-05    
ref|WP_011320444.1|  PEP-CTERM domain protein                         55.1    1e-05    
ref|WP_041919228.1|  glycerophosphodiester phosphodiesterase          54.7    1e-05    
ref|WP_010995225.1|  PEP-CTERM domain protein                         54.7    1e-05    
ref|WP_036014998.1|  glycerophosphodiester phosphodiesterase          54.7    1e-05    
ref|WP_011806527.1|  glycerophosphoryl diester phosphodiesterase      54.7    1e-05    
ref|WP_035653003.1|  glycerophosphodiester phosphodiesterase          54.7    1e-05    
gb|AFZ31805.1|  glycerophosphoryl diester phosphodiesterase           55.1    1e-05    
ref|WP_029078971.1|  glycerophosphodiester phosphodiesterase          54.7    2e-05    
ref|WP_039201618.1|  glycerophosphodiester phosphodiesterase          55.1    2e-05    
tpg|DAA50258.1|  TPA: glycerophosphoryl diester phosphodiesterase     54.3    2e-05    
ref|NP_001150176.1|  LOC100283806 precursor                           54.3    2e-05    
ref|WP_015914076.1|  glycerophosphoryl diester phosphodiesterase      54.3    2e-05    
ref|WP_028089957.1|  glycerophosphodiester phosphodiesterase          53.9    2e-05    
ref|WP_041827855.1|  glycerophosphodiester phosphodiesterase          54.3    2e-05    
ref|WP_034280451.1|  glycerophosphodiester phosphodiesterase          53.9    2e-05    
ref|WP_012406997.1|  glycerophosphoryl diester phosphodiesterase      53.9    2e-05    
ref|WP_017651364.1|  glycerophosphoryl diester phosphodiesterase      53.9    2e-05    
gb|ABM31889.1|  glycerophosphoryl diester phosphodiesterase           53.9    3e-05    
ref|WP_044402318.1|  glycerophosphodiester phosphodiesterase          53.9    3e-05    
ref|WP_015105612.1|  Glycerophosphoryl diester phosphodiesterase      53.9    3e-05    
gb|EZH81050.1|  glycerophosphodiester phosphodiesterase               53.5    3e-05    
ref|WP_037001247.1|  glycerophosphodiester phosphodiesterase          53.5    4e-05    
gb|EFA73134.1|  Glycerophosphoryl diester phosphodiesterase           53.1    4e-05    
ref|WP_040553645.1|  glycerophosphodiester phosphodiesterase          53.1    4e-05    
ref|WP_017476207.1|  glycerophosphoryl diester phosphodiesterase      53.1    5e-05    
ref|WP_027101864.1|  glycerophosphodiester phosphodiesterase          53.1    5e-05    
gb|EJL83967.1|  glycerophosphoryl diester phosphodiesterase           52.8    6e-05    
ref|WP_036838616.1|  glycerophosphodiester phosphodiesterase          52.8    6e-05    
ref|WP_041576163.1|  glycerophosphodiester phosphodiesterase          52.8    6e-05    
gb|AHG89434.1|  glycerophosphoryl diester phosphodiesterase           52.8    7e-05    
gb|AGH96660.1|  hypothetical protein A11Q_2444                        52.8    7e-05    
gb|KID29265.1|  glycerophosphoryl diester phosphodiesterase           52.8    7e-05    
ref|WP_038955390.1|  glycerophosphodiester phosphodiesterase          52.8    8e-05    
ref|WP_039504376.1|  glycerophosphodiester phosphodiesterase          52.4    8e-05    
ref|WP_043245815.1|  glycerophosphodiester phosphodiesterase          52.4    8e-05    
gb|EHJ68228.1|  glycerophosphoryl diester phosphodiesterase, peri...  52.4    8e-05    
ref|NP_001050628.1|  Os03g0603600                                     52.4    8e-05    
ref|WP_030533632.1|  glycerophosphodiester phosphodiesterase          52.4    9e-05    
ref|XP_002966299.1|  hypothetical protein SELMODRAFT_85502            52.0    1e-04    
ref|WP_040877342.1|  glycerophosphodiester phosphodiesterase          52.0    1e-04    
ref|WP_012050886.1|  glycerophosphoryl diester phosphodiesterase      52.0    1e-04    
ref|WP_037247003.1|  glycerophosphodiester phosphodiesterase          52.0    1e-04    
ref|WP_005466927.1|  glycerophosphoryl diester phosphodiesterase      52.0    1e-04    
ref|WP_024875672.1|  glycerophosphodiester phosphodiesterase          52.0    1e-04    
ref|XP_002978269.1|  hypothetical protein SELMODRAFT_108000           52.0    1e-04    
ref|WP_016952368.1|  hypothetical protein                             51.6    1e-04    
ref|WP_029995084.1|  glycerophosphodiester phosphodiesterase          51.6    1e-04    
ref|WP_010175974.1|  glycerophosphoryl diester phosphodiesterase      52.0    1e-04    
ref|WP_030090859.1|  glycerophosphodiester phosphodiesterase          51.6    1e-04    
ref|WP_035158814.1|  glycerophosphodiester phosphodiesterase          51.6    1e-04    
ref|XP_006650282.1|  PREDICTED: probable glycerophosphoryl dieste...  51.6    1e-04    
ref|WP_016747781.1|  glycerophosphoryl diester phosphodiesterase      51.2    1e-04    
gb|KDP31354.1|  hypothetical protein JCGZ_11730                       51.6    2e-04    
gb|KIE09163.1|  glycerophosphodiester phosphodiesterase               52.0    2e-04    
ref|WP_008569389.1|  glycerophosphoryl diester phosphodiesterase      51.6    2e-04    
ref|WP_035909197.1|  glycerophosphodiester phosphodiesterase          51.6    2e-04    
ref|WP_026880196.1|  glycerophosphodiester phosphodiesterase          51.6    2e-04    
ref|WP_007856573.1|  glycerophosphoryl diester phosphodiesterase      51.2    2e-04    



>ref|XP_004251903.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Solanum lycopersicum]
Length=751

 Score =   334 bits (857),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 190/214 (89%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSM+++++S++R V+INYISSPEVNFL+SI SR+NPRVTKLVFRFLG D+ EPST
Sbjct  175  FSQHNLSMKSYIISLTRGVLINYISSPEVNFLRSILSRLNPRVTKLVFRFLGQDDVEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPKSYIWPVD +S YLQP TSLVLDAHK GL+++AS+F
Sbjct  235  NQTYGSLLKNLTFIKTFASGILVPKSYIWPVD-NSLYLQPYTSLVLDAHKEGLQIFASEF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DVPFA++YSYDP +EYLSF+DNGN+SVDGVLSDFP+TPS  IDC++H+ K  K Q  +
Sbjct  294  ANDVPFAYNYSYDPTSEYLSFVDNGNFSVDGVLSDFPVTPSATIDCFTHLDKNDKPQ-EK  352

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVI+ +GASGDYPGCTD AY+KA SDG D++DC
Sbjct  353  LLVITSEGASGDYPGCTDLAYTKAASDGADVLDC  386



>ref|XP_006344880.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   327 bits (839),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 189/214 (88%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR++++S+SR V+INYISSPEVNFL+SI +R+N RVTKLVFRFLG ++ EPST
Sbjct  177  FSQHNLSMRSYIISLSRSVLINYISSPEVNFLRSILARLNSRVTKLVFRFLGQNDVEPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTF+SGILVPKSYIWPVD +S YLQP TSLVLDAHK GL+++AS+F
Sbjct  237  NQTYGSLLKNLTFIKTFSSGILVPKSYIWPVD-NSFYLQPYTSLVLDAHKEGLQIFASEF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DVPFA++YSYDP +EYLSF+DNGN+SVDGVLSDFP+TPS  IDC++H+ K  K +  +
Sbjct  296  ANDVPFAYNYSYDPTSEYLSFVDNGNFSVDGVLSDFPVTPSATIDCFTHLDKNDKPR-EK  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+I+ +GASGDYPGCTD AY+KA SDG D++DC
Sbjct  355  LLIITSEGASGDYPGCTDLAYTKAASDGADVLDC  388



>ref|XP_009787408.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=752

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQHNLSMR+FV+S+SR V+INYISSPEVNFL+SIA R NPRVTK VFRFL  DE EPST
Sbjct  178  YSQHNLSMRSFVVSLSRSVIINYISSPEVNFLRSIARRFNPRVTKFVFRFLSEDEFEPST  237

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY SLL+NL  +KTFASGILVPK YIWPVD +S YLQP TS+VLDAHK GLE++A+DF
Sbjct  238  NQTYSSLLKNLTFVKTFASGILVPKHYIWPVD-NSLYLQPHTSVVLDAHKEGLEIFAADF  296

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DVP A++YSYDPVAEYLS+IDNGN+SVDGVLSDFP TPS ++DC+SH+ K  K QV +
Sbjct  297  ANDVPSAYNYSYDPVAEYLSYIDNGNFSVDGVLSDFPSTPSSSVDCFSHLGKNDKPQV-K  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +I+ +GASGDYPGCTD AY+KA SDG D+++C
Sbjct  356  LQIITSEGASGDYPGCTDLAYTKAASDGADVLNC  389



>ref|XP_003530777.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Glycine max]
Length=761

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 181/214 (85%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM+ FVLSVSR V +NYISSPE  FL++I +RINPR+TKLVFRFL  DE +PST
Sbjct  182  YEQHNLSMKNFVLSVSRTVNVNYISSPEAGFLRTIRARINPRITKLVFRFLEKDEVDPST  241

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NLASIKTFASGILVPK YIWP+D SS YL P TSLV DAHKVGLEV+ASDF
Sbjct  242  NQTYGSLLKNLASIKTFASGILVPKGYIWPIDPSSLYLLPHTSLVSDAHKVGLEVFASDF  301

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YSYDPVAEYL+FIDNGN+SVDGVLSDFP+TPS AIDC++H+      +V  
Sbjct  302  LNDVPISYNYSYDPVAEYLNFIDNGNFSVDGVLSDFPLTPSEAIDCFAHVGLNATKKV-N  360

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CTD AY KA+SDGVD++DC
Sbjct  361  TLVISKYGASGDYPPCTDLAYEKAISDGVDVLDC  394



>ref|XP_009625976.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Nicotiana tomentosiformis]
 dbj|BAE53680.1| putative glycerophosphoryl diester phosphodiesterase family protein 
[Nicotiana tabacum]
 dbj|BAF34116.1| glycerophosphodiesterase-like protein [Nicotiana tabacum]
Length=752

 Score =   323 bits (829),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 185/214 (86%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLS+R+FV+S+SR V++NYISSPEVNFL+SIA R NPRVTK VFRFLG D  EPST
Sbjct  178  YSQRNLSIRSFVVSLSRSVIVNYISSPEVNFLRSIARRFNPRVTKFVFRFLGEDGIEPST  237

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  +KTFASGILVPK YIWPVD +S YLQP TS+VLDAHK GLE++A+DF
Sbjct  238  NQTYGSLLKNLTFVKTFASGILVPKHYIWPVD-NSLYLQPHTSVVLDAHKEGLEIFAADF  296

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DVP A++YSYDPVAEYLS+IDNG++SVDGVLSDFP+TPS ++DC+SH+ K  K QV +
Sbjct  297  ANDVPSAYNYSYDPVAEYLSYIDNGDFSVDGVLSDFPLTPSSSVDCFSHLGKNDKPQV-K  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +I+ +GASGDYPGCTD AY+KA SDG D++ C
Sbjct  356  LQIITSEGASGDYPGCTDLAYTKAASDGADVLGC  389



>ref|XP_009588257.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana tomentosiformis]
Length=741

 Score =   322 bits (825),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 184/214 (86%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR+F++++SR V+INYISSPEVNFL+SI +R +P+VTKLVFRFLG D+ EPST
Sbjct  166  FSQHNLSMRSFIITLSRSVIINYISSPEVNFLRSIVARFDPQVTKLVFRFLGQDDVEPST  225

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  I TFASGILVPKSYIWPVD +S YLQP TSLVLDAH+ GL+++A++F
Sbjct  226  NQTYGSLLKNLTFINTFASGILVPKSYIWPVD-NSLYLQPHTSLVLDAHEEGLQIFAAEF  284

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVPFA++YSYDP  EYLSFIDNGN+SVDGVLSDFPITPS  IDC++H+ K  K Q  +
Sbjct  285  VNDVPFAYNYSYDPATEYLSFIDNGNFSVDGVLSDFPITPSATIDCFTHLGKNDKPQA-K  343

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+++ +GASGDYPGCTD AY+KA  DG D++ C
Sbjct  344  LLIMTSEGASGDYPGCTDLAYTKAAMDGADVLGC  377



>gb|KHM99500.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   321 bits (823),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/214 (72%), Positives = 180/214 (84%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM+ FVLSVSR V +NYISSPE  FL++I + INPR+TKLVFRFL  DE +PST
Sbjct  182  YEQHNLSMKNFVLSVSRTVNVNYISSPEAGFLRTIRAHINPRITKLVFRFLKKDEVDPST  241

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NLASIKTF+SGILVPK YIWP+D SS YL P TSLV DAHKVGLEV+ASDF
Sbjct  242  NQTYGSLLKNLASIKTFSSGILVPKGYIWPIDPSSLYLLPHTSLVSDAHKVGLEVFASDF  301

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YSYDPVAEYL+FIDNGN+SVDGVLSDFP+TPS AIDC++H+      +V  
Sbjct  302  LNDVPISYNYSYDPVAEYLNFIDNGNFSVDGVLSDFPLTPSEAIDCFAHVGLNATKKV-N  360

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CTD AY KA+SDGVD++DC
Sbjct  361  TLVISKYGASGDYPPCTDLAYEKAISDGVDVLDC  394



>ref|XP_006346174.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Solanum tuberosum]
Length=753

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 183/214 (86%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQHNLSMR+FV+S+SR V+ NYISSPEVNFL+SIASR+NPRVTK VFRFL  D+ EPST
Sbjct  178  YSQHNLSMRSFVISLSRSVIANYISSPEVNFLRSIASRLNPRVTKRVFRFLNEDDIEPST  237

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            +QTYGSL++NL  IKTFA+GILVPK YIWP+D SS YLQP TS+V DAHK GLE+YA+DF
Sbjct  238  SQTYGSLVKNLTFIKTFAAGILVPKHYIWPMD-SSLYLQPHTSVVSDAHKEGLEIYAADF  296

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVPFA++YSYDPVAEYLSFIDNG +SVDGVLSDFP++PS ++DC+SH+    K QV +
Sbjct  297  VNDVPFAYNYSYDPVAEYLSFIDNGEFSVDGVLSDFPMSPSASVDCFSHLGANDKPQV-K  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +I+  GASG+YPGCTD AY+KA SDG DI+ C
Sbjct  356  LQIITPQGASGEYPGCTDLAYTKAASDGADILGC  389



>ref|XP_010324292.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Solanum 
lycopersicum]
Length=753

 Score =   319 bits (818),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 181/214 (85%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQHNLSMR+FV+S+SR V+ NYISSPEVNFL+SIASR+NPRVTK VFRFL  D+ EPST
Sbjct  178  YSQHNLSMRSFVVSLSRSVIANYISSPEVNFLRSIASRLNPRVTKRVFRFLNEDDIEPST  237

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            +QTYGSL++NL  +KTFA+GILVPK YIWP D SS YLQP TS+V DAHK GLE+YA+DF
Sbjct  238  SQTYGSLVKNLTFVKTFAAGILVPKHYIWPTD-SSLYLQPHTSVVSDAHKEGLEIYAADF  296

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVPFA++YSYDPVAEYLSFIDNG +SVDGVLSDFP++PS ++DC+SH+    K QV  
Sbjct  297  VNDVPFAYNYSYDPVAEYLSFIDNGEFSVDGVLSDFPMSPSASVDCFSHLGANDKPQV-T  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +I+  GASGDYPGCTD AY+KA SDG DII C
Sbjct  356  LQIIAPQGASGDYPGCTDLAYTKAASDGADIIGC  389



>gb|KJB62956.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=604

 Score =   314 bits (805),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 180/216 (83%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRR--VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+QHNLSMR+FVLSV+R   V I+YISSPEV FL++IA       T LVFRFLG ++ EP
Sbjct  25   YTQHNLSMRSFVLSVTRNRNVTIDYISSPEVAFLQNIAPSFQRSATNLVFRFLGQNDVEP  84

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STNQTYGSLL+N+  IKTFASGI+VPKSYIWPVDK   YL P+TSLVLDAHK GLEV+AS
Sbjct  85   STNQTYGSLLKNITFIKTFASGIIVPKSYIWPVDKDL-YLLPSTSLVLDAHKEGLEVFAS  143

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
            DF +DVPF+F+YSYDPVAEYL FIDNG +SVDG++SDFPITPS AIDC++H+ +    QV
Sbjct  144  DFYNDVPFSFNYSYDPVAEYLQFIDNGEFSVDGMISDFPITPSAAIDCFAHLGRNASKQV  203

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             + LVIS +GASGDYPGCTD AYSKA+ DGVD+IDC
Sbjct  204  -DLLVISSNGASGDYPGCTDMAYSKAIQDGVDVIDC  238



>ref|XP_002529027.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
 gb|EEF33338.1| glycerophosphoryl diester phosphodiesterase, putative [Ricinus 
communis]
Length=768

 Score =   318 bits (814),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 183/214 (86%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHNLSMR++VLS+S++VVINYISSPE+ FL+ IASR NP+VTKLVFRFLG +E EPST
Sbjct  188  FTQHNLSMRSYVLSLSKKVVINYISSPEMAFLRGIASRFNPKVTKLVFRFLGPNEIEPST  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY +L +NL  IKTFASGIL+PK YIWPVD +S YLQP TS+V DAHK GLEV+AS+F
Sbjct  248  NQTYSALSKNLTFIKTFASGILIPKGYIWPVD-ASLYLQPHTSVVSDAHKAGLEVFASEF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVPF+F+YSYDP++EYLSF+DNG++S+DGVLSDFPITPSGA DC+S + +    Q   
Sbjct  307  YNDVPFSFNYSYDPISEYLSFVDNGDFSIDGVLSDFPITPSGAFDCFSQIGQNATKQ-SN  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYPGCTD AY KA+SDG D+IDC
Sbjct  366  VLVISKNGASGDYPGCTDMAYQKAISDGADVIDC  399



>ref|XP_007020654.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
 gb|EOY12179.1| PLC-like phosphodiesterase family protein, putative isoform 3 
[Theobroma cacao]
Length=514

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 181/216 (84%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVI--NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+QHNLSMR FV+S++R V +  +YISSPEV FL+SIA+R     TKLVFRFL  D  EP
Sbjct  181  YAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKLVFRFLELDTVEP  240

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+VLDAHK GLEV+AS
Sbjct  241  STNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVVLDAHKEGLEVFAS  299

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
            DF +DVPF+F+YSYDPVAEYL F+DNG +SVDGV+SDFPITPS AI+C++H+ +    QV
Sbjct  300  DFTNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVISDFPITPSAAINCFAHLGRNASKQV  359

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             + LVIS +GASGDYPGCTD AY+KA+ DGVD+IDC
Sbjct  360  -DLLVISKNGASGDYPGCTDQAYTKAIQDGVDVIDC  394



>ref|XP_009364631.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
 ref|XP_009364652.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Pyrus x bretschneideri]
Length=447

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 179/214 (84%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHNLSMR +VLSVSR+VV+NYISSPEV FL SI SR++P VTKLVFRFL  DETEPST
Sbjct  175  FAQHNLSMRNYVLSVSRQVVVNYISSPEVAFLNSIKSRVSPSVTKLVFRFLAQDETEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+VLDAHK GL V+ASDF
Sbjct  235  NQTYGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVVLDAHKEGLTVFASDF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP  ++YSYDPV+EYL F+DNG++SVDGVLSDFPITPS AI+C++H+      Q   
Sbjct  294  VNDVPLPYNYSYDPVSEYLQFVDNGDFSVDGVLSDFPITPSEAIECFAHLASNASGQAKP  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGD+P CTD AY+KA++DGVD++DC
Sbjct  354  -LVISKYGASGDFPSCTDLAYTKAIADGVDVLDC  386



>gb|KDP39221.1| hypothetical protein JCGZ_00978 [Jatropha curcas]
Length=767

 Score =   316 bits (810),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 181/214 (85%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHNLSMR +VL++SR+ VINYISSPEV FL+SIA RINP +TKLVFRFLG  + EPST
Sbjct  180  FTQHNLSMRNYVLAISRKAVINYISSPEVGFLRSIAPRINPNITKLVFRFLGPSDIEPST  239

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY + L+NL SIKTFASGIL+PK+YIWPVD ++ YLQP TS+V DAHK GLEV+AS+F
Sbjct  240  NQTYSAFLKNLTSIKTFASGILIPKNYIWPVD-ATLYLQPHTSVVSDAHKAGLEVFASEF  298

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVPF+F+YSYDPV EYL F+DNG++SVDGVLSDFPIT S A+DC+SH+ K    QV +
Sbjct  299  YNDVPFSFNYSYDPVTEYLYFVDNGDFSVDGVLSDFPITASEALDCFSHLGKNASTQV-D  357

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYPGCTD AY  A+SDG D+IDC
Sbjct  358  VLVISKNGASGDYPGCTDKAYQAAISDGTDVIDC  391



>ref|XP_003530778.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Glycine max]
Length=761

 Score =   315 bits (808),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 179/214 (84%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM+ FVLSVSR V ++YISSPE  FL+SI + INPR+TK+VFRFL  DE +PST
Sbjct  181  YAQHNLSMKNFVLSVSRTVNVSYISSPEAGFLRSIKAHINPRITKVVFRFLEKDEVDPST  240

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGSLL+NLASIKTFASGILVPK YIWPVD +  YL P TSLV DAHKVGLEV+ASD 
Sbjct  241  NRTYGSLLKNLASIKTFASGILVPKGYIWPVDPTGLYLLPHTSLVSDAHKVGLEVFASDI  300

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D+P +++YSYDPVAEYL+FIDNGN+SVDGVLSDFP+TPS AIDC++H+      +V  
Sbjct  301  LNDIPISYNYSYDPVAEYLNFIDNGNFSVDGVLSDFPLTPSEAIDCFAHIGLNSPKKV-N  359

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CTD AY KA+SDGVD++DC
Sbjct  360  ILVISKYGASGDYPPCTDLAYEKAISDGVDVLDC  393



>ref|XP_008364336.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=549

 Score =   309 bits (792),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 179/214 (84%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR +VLSVS++VVINYISSPEV FL SI +R++P  TKLVFRFLG DETEPST
Sbjct  175  FSQHNLSMRNYVLSVSKQVVINYISSPEVAFLNSIKARVSPSATKLVFRFLGQDETEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGIL+PK+YIWPV K  +YL+P TS+V DAHK GL V+ASDF
Sbjct  235  NQTYGSLLKNLTFIKTFASGILIPKTYIWPVTK-DNYLEPHTSVVTDAHKEGLTVFASDF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP A++YSYDPV+EYL FIDNG++SVDGVLSDFPITPS AIDC++H+      Q   
Sbjct  294  VNDVPLAYNYSYDPVSEYLQFIDNGDFSVDGVLSDFPITPSEAIDCFAHLGSNASGQAKP  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGD P CTDXAY KA+++GVD++DC
Sbjct  354  -LVISKHGASGDLPSCTDXAYEKAIANGVDVLDC  386



>gb|KJB62955.1| hypothetical protein B456_009G445400 [Gossypium raimondii]
Length=760

 Score =   313 bits (803),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 180/216 (83%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRR--VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+QHNLSMR+FVLSV+R   V I+YISSPEV FL++IA       T LVFRFLG ++ EP
Sbjct  181  YTQHNLSMRSFVLSVTRNRNVTIDYISSPEVAFLQNIAPSFQRSATNLVFRFLGQNDVEP  240

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STNQTYGSLL+N+  IKTFASGI+VPKSYIWPVDK   YL P+TSLVLDAHK GLEV+AS
Sbjct  241  STNQTYGSLLKNITFIKTFASGIIVPKSYIWPVDKDL-YLLPSTSLVLDAHKEGLEVFAS  299

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
            DF +DVPF+F+YSYDPVAEYL FIDNG +SVDG++SDFPITPS AIDC++H+ +    QV
Sbjct  300  DFYNDVPFSFNYSYDPVAEYLQFIDNGEFSVDGMISDFPITPSAAIDCFAHLGRNASKQV  359

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             + LVIS +GASGDYPGCTD AYSKA+ DGVD+IDC
Sbjct  360  -DLLVISSNGASGDYPGCTDMAYSKAIQDGVDVIDC  394



>ref|XP_006452490.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
 gb|ESR65730.1| hypothetical protein CICLE_v10007536mg [Citrus clementina]
Length=764

 Score =   312 bits (800),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 178/214 (83%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSV R VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+T
Sbjct  183  YAQHNLSMRSFVLSVYRSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTT  242

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+F
Sbjct  243  NQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNF  301

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +F+YSYDP+ EYLSFIDN ++SVDGVLSDFP+TPS A+DC++H+ K        
Sbjct  302  ANDIPISFNYSYDPLTEYLSFIDNRDFSVDGVLSDFPLTPSAAVDCFAHLGKNASKSA-N  360

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CT+ AY KA+SDGVD IDC
Sbjct  361  LLVISKNGASGDYPSCTNLAYQKAISDGVDFIDC  394



>ref|XP_007146553.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
 gb|ESW18547.1| hypothetical protein PHAVU_006G0504001g, partial [Phaseolus vulgaris]
Length=503

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 176/214 (82%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM+ F+ SVS  V ++YISSPE +FL+SI + INP++TKLVFRFLG +E +PS 
Sbjct  184  YTQHNLSMKNFIRSVSTTVNVSYISSPEASFLRSIKTDINPKITKLVFRFLGKEEVDPSI  243

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             QTYGSLLQNL SIKTFASGILVPK YIWPVD +S YLQP TSLV DAHKVGLEV+AS F
Sbjct  244  KQTYGSLLQNLTSIKTFASGILVPKDYIWPVDPTSHYLQPHTSLVSDAHKVGLEVFASTF  303

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D+P +++YSYDPV+E+LSFI+NGN+SVDGVLSDFP+T S AIDC++HM      +V  
Sbjct  304  QNDIPISYNYSYDPVSEHLSFIENGNFSVDGVLSDFPLTSSAAIDCFAHMGLNAPKKV-N  362

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CTD AY KA+ DGVDI+DC
Sbjct  363  TLVISKYGASGDYPPCTDLAYKKAILDGVDILDC  396



>ref|XP_007214645.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
 gb|EMJ15844.1| hypothetical protein PRUPE_ppa001847mg [Prunus persica]
Length=756

 Score =   311 bits (798),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 180/214 (84%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR +VLSVSR+VV+NYISSPEV FL SI +R++P  TKLVFRFLG D+TEPST
Sbjct  178  FSQHNLSMRNYVLSVSRKVVVNYISSPEVAFLNSIKARVSPSATKLVFRFLGQDDTEPST  237

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             Q YGSLL+NL  IKTFASGIL+PK+YIWPV  +  YL+P TS+VLDAHK GL V+ASDF
Sbjct  238  KQNYGSLLKNLTYIKTFASGILIPKTYIWPV-TTDLYLEPHTSIVLDAHKAGLTVFASDF  296

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP A++YSYDPV+EYL+F+DNG++SVDGVLSDFPITPS AIDC++H+      Q  +
Sbjct  297  VNDVPLAYNYSYDPVSEYLNFVDNGDFSVDGVLSDFPITPSEAIDCFAHLGNNASGQA-K  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGD+P CTD AYSKA++DGVD++DC
Sbjct  356  PLVISKYGASGDFPSCTDLAYSKAIADGVDVLDC  389



>gb|KHN43860.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=753

 Score =   311 bits (796),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 180/214 (84%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSVSR+VV +YISSPEV FL+SIASR NP+ TKLVFRF+G  + +PST
Sbjct  177  YAQHNLSMRSFVLSVSRKVVFSYISSPEVGFLRSIASRFNPKTTKLVFRFMGLSDVDPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGSLLQNL  IKTFASGILVPK YIWPVD ++ YLQ  TSLV DAHK GLEV+ASDF
Sbjct  237  NRTYGSLLQNLTFIKTFASGILVPKGYIWPVD-ATLYLQSHTSLVSDAHKAGLEVFASDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVPF+F+YSYDP+AEYL F+DNG++SVDGVLSDFPITP  AI C++H+      +  +
Sbjct  296  VNDVPFSFNYSYDPLAEYLQFVDNGDFSVDGVLSDFPITPFEAIGCFAHLATNATKK-DK  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CTD AY+KA+SDGVD++DC
Sbjct  355  TLVISKYGASGDYPACTDLAYNKAISDGVDVLDC  388



>ref|XP_007020653.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
 gb|EOY12178.1| PLC-like phosphodiesterase family protein, putative isoform 2 
[Theobroma cacao]
Length=758

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 181/216 (84%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVI--NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+QHNLSMR FV+S++R V +  +YISSPEV FL+SIA+R     TKLVFRFL  D  EP
Sbjct  181  YAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKLVFRFLELDTVEP  240

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+VLDAHK GLEV+AS
Sbjct  241  STNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVVLDAHKEGLEVFAS  299

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
            DF +DVPF+F+YSYDPVAEYL F+DNG +SVDGV+SDFPITPS AI+C++H+ +    QV
Sbjct  300  DFTNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVISDFPITPSAAINCFAHLGRNASKQV  359

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             + LVIS +GASGDYPGCTD AY+KA+ DGVD+IDC
Sbjct  360  -DLLVISKNGASGDYPGCTDQAYTKAIQDGVDVIDC  394



>ref|XP_007020652.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
 gb|EOY12177.1| PLC-like phosphodiesterase family protein, putative isoform 1 
[Theobroma cacao]
Length=760

 Score =   311 bits (796),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 181/216 (84%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVI--NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+QHNLSMR FV+S++R V +  +YISSPEV FL+SIA+R     TKLVFRFL  D  EP
Sbjct  181  YAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKLVFRFLELDTVEP  240

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+VLDAHK GLEV+AS
Sbjct  241  STNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVVLDAHKEGLEVFAS  299

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
            DF +DVPF+F+YSYDPVAEYL F+DNG +SVDGV+SDFPITPS AI+C++H+ +    QV
Sbjct  300  DFTNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVISDFPITPSAAINCFAHLGRNASKQV  359

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             + LVIS +GASGDYPGCTD AY+KA+ DGVD+IDC
Sbjct  360  -DLLVISKNGASGDYPGCTDQAYTKAIQDGVDVIDC  394



>ref|XP_003519608.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=753

 Score =   310 bits (795),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 151/214 (71%), Positives = 180/214 (84%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSVSR+VV +YISSPEV FL+SIASR NP+ TKLVFRF+G  + +PST
Sbjct  177  YAQHNLSMRSFVLSVSRKVVFSYISSPEVGFLRSIASRFNPKTTKLVFRFMGLSDVDPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGSLLQNL  IKTFASGILVPK YIWPVD ++ YLQ  TSLV DAHK GLEV+ASDF
Sbjct  237  NRTYGSLLQNLTFIKTFASGILVPKGYIWPVD-ATLYLQSHTSLVSDAHKAGLEVFASDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVPF+F+YSYDP+AEYL F+DNG++SVDGVLSDFPITP  AI C++H+      +  +
Sbjct  296  VNDVPFSFNYSYDPLAEYLQFVDNGDFSVDGVLSDFPITPFEAIGCFAHLGTNATKK-DK  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CTD AY+KA+SDGVD++DC
Sbjct  355  TLVISKYGASGDYPACTDLAYNKAISDGVDVLDC  388



>ref|XP_009335427.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   310 bits (795),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 180/214 (84%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR++VLSVSR+VV++YISSPEV FL SI SR++P VTKLVFRFL  DETEPST
Sbjct  175  FSQHNLSMRSYVLSVSRQVVVSYISSPEVAFLNSIKSRVSPSVTKLVFRFLAQDETEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+VLDAHK GL V+ASDF
Sbjct  235  NQTYGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVVLDAHKEGLTVFASDF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP  ++YSYDPV+EYL F+DNG++SVDGVLSDFPITPS AIDC++H+      Q   
Sbjct  294  VNDVPLPYNYSYDPVSEYLQFVDNGDFSVDGVLSDFPITPSEAIDCFAHLASNASGQAKP  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGD+P CTD AY+KA++DGVD++DC
Sbjct  354  -LVISKYGASGDFPSCTDLAYTKAIADGVDVLDC  386



>ref|XP_008366428.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=752

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 178/214 (83%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR +VLSVSR+VV+NYISSPEV FL SI SR++P VTKLVFRFLG D TEPST
Sbjct  175  FSQHNLSMRNYVLSVSRQVVVNYISSPEVAFLNSIKSRVSPSVTKLVFRFLGQDXTEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+VLDAHK GL V+ SDF
Sbjct  235  NQTYGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVVLDAHKEGLTVFGSDF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP  ++YSYDPV+EYL F+DNG++SVDGVLSDFPITPS AI+C++H+      Q   
Sbjct  294  VNDVPLPYNYSYDPVSEYLQFVDNGDFSVDGVLSDFPITPSEAIECFAHLASNASGQAKP  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGD+P CTD AY+KA++DGVD++DC
Sbjct  354  -LVISKYGASGDFPSCTDLAYTKAIADGVDVLDC  386



>ref|XP_011097815.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=760

 Score =   308 bits (790),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 175/214 (82%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR+F+LSVSRRV++NY+SSPEV FL+SI SR     TKLVF+FLG D+ EP+T
Sbjct  181  FSQHNLSMRSFILSVSRRVIVNYVSSPEVGFLRSIVSRFRTGPTKLVFQFLGPDDVEPTT  240

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N TYG+LL NL  IKTFASGILVPK YIWPVD +S YL   TSLV+DAH  GLEV+AS+F
Sbjct  241  NSTYGTLLNNLTFIKTFASGILVPKYYIWPVD-NSQYLLNYTSLVVDAHAAGLEVFASNF  299

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D P A+DYSYDPV EYL+FIDNG +SVDGVLSDFPITPS  IDC+SH+ K    Q   
Sbjct  300  ANDAPLAYDYSYDPVVEYLNFIDNGKFSVDGVLSDFPITPSETIDCFSHIGKNDTVQA-N  358

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYPGCTD AY KAVSDGVDI+DC
Sbjct  359  ILVISSEGASGDYPGCTDKAYQKAVSDGVDILDC  392



>ref|XP_008227060.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=755

 Score =   308 bits (788),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 179/214 (84%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR +VLSVSR+VV+NYISSPEV FL SI +R++P  TKLVF+FLG D+TEPST
Sbjct  177  FSQHNLSMRNYVLSVSRKVVVNYISSPEVAFLNSIKARVSPSTTKLVFQFLGQDDTEPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             QTYGSLL+NL  IKTFASGIL+PK YIWPV K   YL+P TS+VLDAHK GL V+ASDF
Sbjct  237  KQTYGSLLKNLTYIKTFASGILIPKIYIWPVTK-DLYLEPHTSIVLDAHKAGLTVFASDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP A++YSYDPV+EYL+F+DN ++SVDGVLSDFPITPS AIDC++H+ K    Q  +
Sbjct  296  VNDVPLAYNYSYDPVSEYLNFVDNDDFSVDGVLSDFPITPSEAIDCFAHLGKNTSGQA-K  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGD+P CTD AY KA++DGVD++DC
Sbjct  355  PLVISKYGASGDFPSCTDLAYLKAIADGVDVLDC  388



>gb|KHN23877.1| Putative glycerophosphoryl diester phosphodiesterase 3 [Glycine 
soja]
Length=754

 Score =   307 bits (787),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 178/214 (83%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSVSR VV +YISSPEV FL+SIASR NP+ TKLVFRF+   + +PST
Sbjct  177  YAQHNLSMRSFVLSVSRSVVFSYISSPEVGFLRSIASRFNPKTTKLVFRFMRQSDVDPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD ++ YLQ  TSLV DAHK GLEV+ASDF
Sbjct  237  NQTYGSLLKNLTFIKTFASGILVPKGYIWPVD-ATLYLQSHTSLVSDAHKAGLEVFASDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVPF+F+YSYDP+AEYL F+DNG++SVDGVLSDFPITP  AI C++H+      +  +
Sbjct  296  VNDVPFSFNYSYDPLAEYLQFVDNGDFSVDGVLSDFPITPFEAIGCFAHLGTNATKK-DK  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CTD AY+KA+SDGVD++DC
Sbjct  355  TLVISKYGASGDYPACTDLAYNKAISDGVDVLDC  388



>emb|CDP13760.1| unnamed protein product [Coffea canephora]
Length=745

 Score =   307 bits (786),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 182/214 (85%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQHNLSMR++V+SVSR VV+NYISSPEVNFLKSIA+R  P VTKLVFRFLG  + EPST
Sbjct  175  YSQHNLSMRSYVISVSRSVVVNYISSPEVNFLKSIAARFRPSVTKLVFRFLGPADIEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY SL +NL  IKTFASGILVPK YIWPVD SS YL P TS+VLDAH+ GLEVYAS+F
Sbjct  235  NQTYSSLQKNLTFIKTFASGILVPKYYIWPVDSSSQYLLPHTSIVLDAHEAGLEVYASEF  294

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            +SDV FA+DY+YDPVAEYLS+IDNGN+SVDGVLSDFPITPS  IDC+SH+ K + +Q  +
Sbjct  295  SSDVTFAYDYNYDPVAEYLSYIDNGNFSVDGVLSDFPITPSETIDCFSHIGKNETDQA-K  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASG +PGCTD AY +A++DG D IDC
Sbjct  354  VLIISHEGASGTFPGCTDKAYDQAITDGADFIDC  387



>gb|KJB13801.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=686

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 178/216 (82%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+ HNLSMR+FVLSVSR  +V ++YISSPEV FL++IA       TK+VFRFLG  + EP
Sbjct  181  YAAHNLSMRSFVLSVSRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKVVFRFLGPKDVEP  240

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STNQTY SLL NL  IKTFASGI+VPKSYIWPVD  + YLQP+TS+VLDAHK GLEV+AS
Sbjct  241  STNQTYDSLLTNLTFIKTFASGIIVPKSYIWPVD-GALYLQPSTSIVLDAHKEGLEVFAS  299

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
            DF +DVPF+F+YSYDPVAEYL F+DNG +SVDGVL+DFPITP+ AIDC++H+ K    Q 
Sbjct  300  DFYNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVLTDFPITPAAAIDCFAHIGKNASKQA  359

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             + LVIS +GASGDYPGCTD AY+KA+ DGVD++DC
Sbjct  360  -DLLVISNNGASGDYPGCTDMAYTKAIQDGVDVLDC  394



>gb|KJB13800.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=691

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 178/216 (82%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+ HNLSMR+FVLSVSR  +V ++YISSPEV FL++IA       TK+VFRFLG  + EP
Sbjct  181  YAAHNLSMRSFVLSVSRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKVVFRFLGPKDVEP  240

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STNQTY SLL NL  IKTFASGI+VPKSYIWPVD  + YLQP+TS+VLDAHK GLEV+AS
Sbjct  241  STNQTYDSLLTNLTFIKTFASGIIVPKSYIWPVD-GALYLQPSTSIVLDAHKEGLEVFAS  299

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
            DF +DVPF+F+YSYDPVAEYL F+DNG +SVDGVL+DFPITP+ AIDC++H+ K    Q 
Sbjct  300  DFYNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVLTDFPITPAAAIDCFAHIGKNASKQA  359

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             + LVIS +GASGDYPGCTD AY+KA+ DGVD++DC
Sbjct  360  -DLLVISNNGASGDYPGCTDMAYTKAIQDGVDVLDC  394



>ref|XP_003544723.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3-like [Glycine max]
Length=754

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSVSR VV +YISSPEV FL+SIASR NP+ TKLVFRF+   + +PST
Sbjct  177  YAQHNLSMRSFVLSVSRSVVFSYISSPEVGFLRSIASRFNPKTTKLVFRFMRQSDVDPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD ++ YLQ  TSLV DAHK GLEV+ASDF
Sbjct  237  NQTYGSLLKNLTFIKTFASGILVPKGYIWPVD-ATLYLQSHTSLVSDAHKAGLEVFASDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +F+YSYDP+AEYL F+DNG++SVDGVLSDFPITP  AI C++H+      +  +
Sbjct  296  VNDVPSSFNYSYDPLAEYLQFVDNGDFSVDGVLSDFPITPFEAIGCFAHLGTNATKK-DK  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CTD AY+KA+SDGVD++DC
Sbjct  355  TLVISKYGASGDYPACTDLAYNKAISDGVDVLDC  388



>ref|XP_007142367.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
 gb|ESW14361.1| hypothetical protein PHAVU_008G274300g [Phaseolus vulgaris]
Length=753

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 175/214 (82%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FV+S S+R++ +YISSPEVNFL+ I+SR+N + TKLVFRF+  DE EPS 
Sbjct  174  YAQHNLSMRSFVISASKRIIFSYISSPEVNFLRGISSRLNLKTTKLVFRFMDKDELEPSI  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD  S YLQP TSLV DAHKVGLEV+ SDF
Sbjct  234  NQTYGSLLKNLTFIKTFASGILVPKGYIWPVD-GSLYLQPHTSLVSDAHKVGLEVFGSDF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +F+YSYDP+ EYL FIDNG++SVDGVLSDFP+TP  AI C+SH+      Q  +
Sbjct  293  VNDVPSSFNYSYDPLTEYLQFIDNGDFSVDGVLSDFPVTPFEAIGCFSHLGTNATKQ-DK  351

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS  GASGDYP CT+ AY KA++DGVD++DC
Sbjct  352  TLIISKYGASGDYPACTNLAYDKAIADGVDVLDC  385



>gb|KJB13799.1| hypothetical protein B456_002G094900 [Gossypium raimondii]
Length=762

 Score =   304 bits (778),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 178/216 (82%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+ HNLSMR+FVLSVSR  +V ++YISSPEV FL++IA       TK+VFRFLG  + EP
Sbjct  181  YAAHNLSMRSFVLSVSRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKVVFRFLGPKDVEP  240

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STNQTY SLL NL  IKTFASGI+VPKSYIWPVD  + YLQP+TS+VLDAHK GLEV+AS
Sbjct  241  STNQTYDSLLTNLTFIKTFASGIIVPKSYIWPVD-GALYLQPSTSIVLDAHKEGLEVFAS  299

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
            DF +DVPF+F+YSYDPVAEYL F+DNG +SVDGVL+DFPITP+ AIDC++H+ K    Q 
Sbjct  300  DFYNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVLTDFPITPAAAIDCFAHIGKNASKQA  359

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             + LVIS +GASGDYPGCTD AY+KA+ DGVD++DC
Sbjct  360  -DLLVISNNGASGDYPGCTDMAYTKAIQDGVDVLDC  394



>ref|XP_004491450.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=755

 Score =   302 bits (774),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 175/214 (82%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QH LSM+ FVLSVSRRV +NYISSPE+ FL+SI  R+NP+ TK +FRFL  +ET+PST
Sbjct  175  YAQHKLSMKRFVLSVSRRVRVNYISSPEIGFLRSIKPRLNPKKTKFIFRFLDQNETDPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IK+FASGILVPK YIWPVD  S YLQP TSLV DAHK+GLEV+AS F
Sbjct  235  NQTYGSLLKNLTFIKSFASGILVPKGYIWPVD-DSLYLQPHTSLVSDAHKLGLEVFASGF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F+F+YSYDP+AEYL FIDNG +SVDGVLSDFP+TPS AI C++H+      +  +
Sbjct  294  ANDASFSFNYSYDPLAEYLQFIDNGEFSVDGVLSDFPVTPSAAIGCFAHLGTNSTKR-DK  352

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS  GASGDYP CTD AY+KA+ DGVD++DC
Sbjct  353  TLIISKCGASGDYPACTDLAYNKAILDGVDVLDC  386



>gb|KDO62177.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
 gb|KDO62178.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=504

 Score =   296 bits (757),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 182/214 (85%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSVSR VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+T
Sbjct  230  YAQHNLSMRSFVLSVSRSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTT  289

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+F
Sbjct  290  NQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNF  348

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +F+YSYDP+ EYLSFIDNG++SVDGVLSDFP+TPS A+DC++H+ K   ++   
Sbjct  349  ANDIPISFNYSYDPLTEYLSFIDNGDFSVDGVLSDFPLTPSAAVDCFAHLGK-NASKSAN  407

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CT+ AY KA+SDGVD IDC
Sbjct  408  LLVISKNGASGDYPSCTNLAYQKAISDGVDFIDC  441



>ref|XP_004293798.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=751

 Score =   302 bits (774),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR FV SV R+VV+NYISSPEV FL SI   ++PR TKLVFRFLG  E EPST
Sbjct  172  FSQHNLSMRNFVHSVMRKVVVNYISSPEVAFLNSIKGAVSPRTTKLVFRFLGLTEIEPST  231

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK+YIWPV  + +YL+P TSLVLDAHK  L V+AS F
Sbjct  232  NQTYGSLLKNLTFIKTFASGILVPKTYIWPV-TTDNYLEPHTSLVLDAHKAKLTVFASGF  290

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D    ++YSYDP+AEYLSFIDNGN++VDGVLSDFPITPS AIDC++H+R+    Q  +
Sbjct  291  MNDATLPYNYSYDPLAEYLSFIDNGNFTVDGVLSDFPITPSAAIDCFAHLRQNASVQ-DK  349

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY KA+ DGVD++DC
Sbjct  350  PLVISKNGASGDYPDCTDLAYMKALEDGVDVLDC  383



>gb|KCW70260.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=574

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHNLSMR+FV++ S+ V+I+YISSPEV+FL+SIA R++P  TKL+FRF+G D  EPS 
Sbjct  64   FTQHNLSMRSFVIATSKSVIIDYISSPEVDFLRSIAGRVSPTKTKLIFRFMGKDVLEPSI  123

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL +NL  +KTFASGILVPK YIWPVD  S+YLQ  TSLV DAHK GL V+ASDF
Sbjct  124  NQTYGSLSKNLTFVKTFASGILVPKVYIWPVD-GSNYLQAHTSLVSDAHKAGLTVFASDF  182

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YS+DPVAE LS++DNG +SVDGV++DFPIT S AI C++H  K    Q   
Sbjct  183  VNDVPLSYNYSFDPVAETLSYVDNGAFSVDGVITDFPITSSAAIRCFAHPSKNSSVQAKP  242

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVISF+GASGDYPGCTD AYSKA+ DG DIIDC
Sbjct  243  -LVISFNGASGDYPGCTDLAYSKAIQDGADIIDC  275



>gb|EYU33686.1| hypothetical protein MIMGU_mgv1a001772mg [Erythranthe guttata]
Length=761

 Score =   302 bits (773),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            + QHNLSMR FVL+VSRRV+++YISSPEV FL+SIA+R     TKLVF+F+  D+ EP+T
Sbjct  181  FGQHNLSMRGFVLAVSRRVIVDYISSPEVGFLRSIAARFRTGRTKLVFQFMQPDDVEPTT  240

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL NL  I+TFASGI+VPKSYI PV K   YLQ +TSLV+DAHK GLEV+AS F
Sbjct  241  NQTYGSLLNNLTLIRTFASGIIVPKSYILPVGK-DQYLQNSTSLVVDAHKAGLEVFASTF  299

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  FA+DYSYDPV EYLSFIDNG +SVDGVLSDFPITPS  IDC++H+ K    Q   
Sbjct  300  ANDAAFAYDYSYDPVNEYLSFIDNGKFSVDGVLSDFPITPSETIDCFAHLGKNDTVQ-SN  358

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYPGCTD AY KAVSDGVDI+DC
Sbjct  359  ILVISNEGASGDYPGCTDKAYEKAVSDGVDILDC  392



>ref|XP_007142366.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
 gb|ESW14360.1| hypothetical protein PHAVU_008G274200g [Phaseolus vulgaris]
Length=758

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FV+S S+R+V +YISSPEVNFL+ I+SR+N + TKLVFRF+  DE EPS 
Sbjct  179  YAQHNLSMRSFVISASKRIVFSYISSPEVNFLRGISSRLNLKTTKLVFRFMDKDELEPSI  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD +S YLQP TSLV DAHKVGLEV+ SDF
Sbjct  239  NQTYGSLLKNLTFIKTFASGILVPKGYIWPVD-ASLYLQPHTSLVSDAHKVGLEVFGSDF  297

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +F+YSYDP+ EYL FIDNG +SVDGVLSDFP+TP  AI C+S +      Q  +
Sbjct  298  VNDVPSSFNYSYDPLTEYLQFIDNGEFSVDGVLSDFPVTPFEAIGCFSQLGTNATKQ-DK  356

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CT+ AY KA++DGVD++DC
Sbjct  357  TLVISKYGASGDYPACTNLAYEKAIADGVDVLDC  390



>ref|XP_007146559.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
 gb|ESW18553.1| hypothetical protein PHAVU_006G050800g [Phaseolus vulgaris]
Length=765

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 175/214 (82%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM+ FVLSVSR V ++YISSPE  FL+S+ + + P  TKLVFRFL  D+ +PST
Sbjct  186  YAQHNLSMKNFVLSVSRTVNVSYISSPEAGFLRSLRALVKPSKTKLVFRFLEKDKVDPST  245

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL SIKTFASGILVPK YIWPVD +S YL P TSLV DAHKVGLEV+ASDF
Sbjct  246  NQTYGSLLKNLTSIKTFASGILVPKEYIWPVDPTSLYLLPHTSLVSDAHKVGLEVFASDF  305

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D+  +++YSYDPVAEYL+FIDNGN+SVDGVLSDFP+T S AIDC++H+      QV  
Sbjct  306  MNDISISYNYSYDPVAEYLNFIDNGNFSVDGVLSDFPLTSSEAIDCFAHIGLNAPKQV-N  364

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS  GASGDYP CTD +Y KA+SDGVD++DC
Sbjct  365  TLIISKYGASGDYPPCTDLSYGKAISDGVDVLDC  398



>ref|XP_010545539.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL5 [Tarenaya 
hassleriana]
Length=732

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQHNLSMR +VLSVS+ V ++YISSPE++FL+SI      R+TKL+FRFL  DE EPS+
Sbjct  172  YSQHNLSMRNYVLSVSKHVAVSYISSPEISFLQSIKKNFARRMTKLIFRFLEQDEIEPSS  231

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N TYG L++NL+ I+TF+SGILVPKS+IWPVD +  YL P TSLV DAHK G+EV+AS+F
Sbjct  232  NLTYGHLMKNLSYIRTFSSGILVPKSFIWPVD-AEFYLLPHTSLVTDAHKEGIEVFASEF  290

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV FA++YSYDP+AEYLSFIDNGN+SVDG+LSD+PITP  AI+C+ H+    K Q  E
Sbjct  291  ANDVLFAYNYSYDPLAEYLSFIDNGNFSVDGILSDYPITPYQAINCFCHLNTDAK-QRGE  349

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            F +IS +GASGDYPGCTD AY KAV+DGVDI+DC
Sbjct  350  FSIISMNGASGDYPGCTDLAYQKAVNDGVDILDC  383



>gb|KDO62176.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=667

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 182/214 (85%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSVSR VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+T
Sbjct  230  YAQHNLSMRSFVLSVSRSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTT  289

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+F
Sbjct  290  NQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNF  348

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +F+YSYDP+ EYLSFIDNG++SVDGVLSDFP+TPS A+DC++H+ K   ++   
Sbjct  349  ANDIPISFNYSYDPLTEYLSFIDNGDFSVDGVLSDFPLTPSAAVDCFAHLGK-NASKSAN  407

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CT+ AY KA+SDGVD IDC
Sbjct  408  LLVISKNGASGDYPSCTNLAYQKAISDGVDFIDC  441



>ref|XP_011014752.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014753.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 175/214 (82%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            + QHNLSMR+++LS+SRRVVIN++SSPE  FL+SI  R N  +TKLVFRFL  +  EPST
Sbjct  177  FKQHNLSMRSYILSLSRRVVINHLSSPEAGFLRSIVKRFNLNITKLVFRFLEPNVIEPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGSL +N   IKTFASGIL+PKSYIWP+D +S+YL P TS+VLDAHK GLEV+ SDF
Sbjct  237  NETYGSLSRNFTFIKTFASGILIPKSYIWPLD-ASNYLLPHTSIVLDAHKAGLEVFVSDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YSYDPV EYLSF+DNG++SVDGVLSDFP+TPS  IDC+S + K    QV E
Sbjct  296  YNDVPLSYNYSYDPVTEYLSFVDNGDFSVDGVLSDFPVTPSATIDCFSGLGKNATPQV-E  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYPGCTD AY KA+ DG D+IDC
Sbjct  355  LLVISKNGASGDYPGCTDLAYQKAILDGADVIDC  388



>gb|KHG12016.1| putative glycerophosphoryl diester phosphodiesterase 1 -like 
protein [Gossypium arboreum]
Length=762

 Score =   301 bits (770),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 177/216 (82%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSR--RVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+ HNLSMR+FVLSV+R  +V ++YISSPEV FL++IA       TK+VFRFLG  + EP
Sbjct  181  YAAHNLSMRSFVLSVTRNAKVTVDYISSPEVAFLRNIAPIFRRSSTKVVFRFLGRKDVEP  240

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STNQTY SLL NL  IKTFA+GI+VPK YIWPVD  + YLQP+TS+VLDAHK GLEV+AS
Sbjct  241  STNQTYDSLLTNLTFIKTFAAGIIVPKCYIWPVD-GALYLQPSTSIVLDAHKEGLEVFAS  299

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
            DF +DVPF+F+YSYDPVAEYL F+DNG +SVDGVL+DFPITP+ AIDC++H+ K    Q 
Sbjct  300  DFYNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVLTDFPITPAAAIDCFAHIGKNASKQA  359

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             + LVIS +GASGDYPGCT+ AYSKA+ DGVD++DC
Sbjct  360  -DLLVISNNGASGDYPGCTNMAYSKAIQDGVDVLDC  394



>ref|XP_008349893.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3 [Malus domestica]
Length=448

 Score =   292 bits (748),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 174/215 (81%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR +VLSVSR+VV+NYISSPEV FL SI SR++P VTKLVFRFLG D TEPST
Sbjct  175  FSQHNLSMRNYVLSVSRQVVVNYISSPEVAFLNSIKSRVSPSVTKLVFRFLGQDXTEPST  234

Query  182  NQTY-GSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  358
                 GSLL+NL  IKTFASGIL+PK+YIWPV  + +YL P TS+VLDAHK GL V+ SD
Sbjct  235  XXNXNGSLLKNLTFIKTFASGILIPKTYIWPV-TNDNYLVPHTSVVLDAHKEGLTVFGSD  293

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
            F +DVP  ++YSYDPV+EYL F+DNG++SVDGVLSDFPITPS AI+C++H+      Q  
Sbjct  294  FVNDVPLPYNYSYDPVSEYLQFVDNGDFSVDGVLSDFPITPSEAIECFAHLASNASGQAK  353

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              LVIS  GASGD+P CTD AY+KA++DGVD++DC
Sbjct  354  P-LVISKYGASGDFPSCTDLAYTKAIADGVDVLDC  387



>emb|CAN61355.1| hypothetical protein VITISV_027762 [Vitis vinifera]
Length=642

 Score =   297 bits (761),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y++HNLSMR FVLSVS+ V+++YISSPEV FL+ ++ R     TKL+FRFL  +ET+PST
Sbjct  177  YTKHNLSMRNFVLSVSKSVIVDYISSPEVAFLRGVSQRFKATKTKLIFRFLEKEETDPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL NL  IKTFASGILVPK YIWPV+K +SYL+ +T +V +AHK GLEV+ SDF
Sbjct  237  NQTYGSLLNNLTFIKTFASGILVPKGYIWPVNK-NSYLESSTLVVQNAHKEGLEVFGSDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D+PF+++YSYDP+AE L+FIDN  +SVDGVLSDFPITPS AIDC++H+ K    Q  +
Sbjct  296  INDIPFSYNYSYDPIAEVLNFIDNDAFSVDGVLSDFPITPSAAIDCFAHIGKNASGQ-EK  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS++GASGDYP CTD AY+KA+SDGVD++DC
Sbjct  355  PLIISYNGASGDYPSCTDLAYTKAISDGVDVLDC  388



>gb|KCW70259.1| hypothetical protein EUGRSUZ_F03515 [Eucalyptus grandis]
Length=640

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHNLSMR+FV++ S+ V+I+YISSPEV+FL+SIA R++P  TKL+FRF+G D  EPS 
Sbjct  64   FTQHNLSMRSFVIATSKSVIIDYISSPEVDFLRSIAGRVSPTKTKLIFRFMGKDVLEPSI  123

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL +NL  +KTFASGILVPK YIWPVD  S+YLQ  TSLV DAHK GL V+ASDF
Sbjct  124  NQTYGSLSKNLTFVKTFASGILVPKVYIWPVD-GSNYLQAHTSLVSDAHKAGLTVFASDF  182

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YS+DPVAE LS++DNG +SVDGV++DFPIT S AI C++H  K    Q   
Sbjct  183  VNDVPLSYNYSFDPVAETLSYVDNGAFSVDGVITDFPITSSAAIRCFAHPSKNSSVQAKP  242

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVISF+GASGDYPGCTD AYSKA+ DG DIIDC
Sbjct  243  -LVISFNGASGDYPGCTDLAYSKAIQDGADIIDC  275



>gb|KHG08046.1| putative glycerophosphoryl diester phosphodiesterase 2 -like 
protein [Gossypium arboreum]
Length=775

 Score =   300 bits (767),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 177/230 (77%), Gaps = 17/230 (7%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRR--VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+QHNLSMR+FVLS++R   V I+YISSPEV FL++IA       T LVFRFLG ++ EP
Sbjct  181  YTQHNLSMRSFVLSITRNRNVTIDYISSPEVAFLQNIAPSFRRSATNLVFRFLGQNDVEP  240

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STNQTYGSLL+N+  IKTFA GI+VPKSYIWPVDK   YL P+TSLVLDAHK GLEV+AS
Sbjct  241  STNQTYGSLLKNITFIKTFAFGIIVPKSYIWPVDKDL-YLLPSTSLVLDAHKEGLEVFAS  299

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ-  532
            DF +DVPF+F+YSYDPVAEYL FIDNG +SVDG++SDFPITPS AIDC++H+ +    Q 
Sbjct  300  DFYNDVPFSFNYSYDPVAEYLQFIDNGEFSVDGMISDFPITPSAAIDCFAHLGRNASKQG  359

Query  533  -------------VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
                           + LVIS +GASGDYPGCTD AYS A+ DGVD+IDC
Sbjct  360  TNIAKLFFFCCNVTVDLLVISSNGASGDYPGCTDVAYSTAIQDGVDVIDC  409



>gb|KEH28442.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=659

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 176/214 (82%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQHNLSMR+FVL+VSRR+ ++YISSPE  FL+SI  R NP+ TKLVFRFL  ++T+PST
Sbjct  177  YSQHNLSMRSFVLAVSRRLHVSYISSPEAGFLRSITKRFNPKTTKLVFRFLNQEDTDPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS L+NL  IKTFASGILVPK YIWPVD +S YLQP TSLV DAHK GLEV+A+DF
Sbjct  237  NQTYGSFLKNLTFIKTFASGILVPKGYIWPVD-ASLYLQPHTSLVSDAHKAGLEVFAADF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            ++D+  +++YS+DP+AE L FIDNG ++VDGVL+DFP+TPS AIDC++H+      +  +
Sbjct  296  SNDIVISYNYSFDPLAESLQFIDNGEFTVDGVLTDFPLTPSAAIDCFAHIGNNATRR-DK  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS  GASGD+P CT+ AY+KA+ DGVD++DC
Sbjct  355  TLIISKYGASGDFPACTNLAYNKAIQDGVDVLDC  388



>ref|XP_011095489.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
 ref|XP_011095490.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Sesamum indicum]
Length=767

 Score =   298 bits (764),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR+F++S SRR+++NYISSPEV FL+SI SR     TKLVF+FLG D+ EP T
Sbjct  178  FSQHNLSMRSFIISASRRMIVNYISSPEVGFLRSIVSRFRTGPTKLVFQFLGPDDVEPLT  237

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY  L++NL  IKTFA+GI+VPKSYIWPVD +S YL   TSLVLD+H+ GLEV+ASDF
Sbjct  238  NQTYRLLMKNLTFIKTFATGIIVPKSYIWPVD-NSLYLHNYTSLVLDSHEAGLEVFASDF  296

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDPV EYLSFIDNG +SVDGVLSDFPIT S  IDC+SHM K    Q  +
Sbjct  297  ANDASLPYNYSYDPVVEYLSFIDNGQFSVDGVLSDFPITASATIDCFSHMGKNDTVQA-K  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYPGCTD AY+KAVSDGVDI+DC
Sbjct  356  LLIISSEGASGDYPGCTDEAYAKAVSDGVDILDC  389



>gb|KDO62175.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=733

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 182/214 (85%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSVSR VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+T
Sbjct  230  YAQHNLSMRSFVLSVSRSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTT  289

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+F
Sbjct  290  NQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNF  348

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +F+YSYDP+ EYLSFIDNG++SVDGVLSDFP+TPS A+DC++H+ K   ++   
Sbjct  349  ANDIPISFNYSYDPLTEYLSFIDNGDFSVDGVLSDFPLTPSAAVDCFAHLGK-NASKSAN  407

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CT+ AY KA+SDGVD IDC
Sbjct  408  LLVISKNGASGDYPSCTNLAYQKAISDGVDFIDC  441



>ref|XP_010253010.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Nelumbo nucifera]
Length=734

 Score =   297 bits (761),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 177/216 (82%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QH LSMR+++LS SRR VINYISSPEV FL +IA R     TKL+FRFLG+DE EPST
Sbjct  173  YRQHKLSMRSYILSASRRFVINYISSPEVAFLSTIAERFKGSKTKLIFRFLGSDEIEPST  232

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IK FASGILVPK+YIWPV+ ++ YLQ  TS+V DAH+ GLEV+ASDF
Sbjct  233  NQTYGSLLKNLKFIKKFASGILVPKNYIWPVN-TALYLQHHTSIVSDAHREGLEVFASDF  291

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHM-RKGQKNQVP  538
            A+DV F+++YSY+P+AEYLSFIDNG++SVDGVLSDFP+TPS AIDC+SH+  K     +P
Sbjct  292  ANDVVFSYNYSYNPLAEYLSFIDNGDFSVDGVLSDFPVTPSAAIDCFSHISNKSSGKAMP  351

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
              +VIS +GASG YPGCTD AY +AV DG D+IDC+
Sbjct  352  --IVISHNGASGVYPGCTDLAYKQAVEDGADVIDCS  385


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 52/90 (58%), Gaps = 5/90 (6%)
 Frame = +2

Query  212  LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFD  388
            +  IK FA  +++ KS I+P++  S++L   T +V   H   L VY S F ++ V  A+D
Sbjct  561  IMDIKQFAHSLVIRKSSIFPLN--SAFLTGVTKIVSKLHSFNLTVYTSVFRNEFVSSAWD  618

Query  389  YSYDPVAEYLSFIDNGNYSVDGVLSDFPIT  478
            +  DPV E  SF+      +DGV++DFP T
Sbjct  619  FYSDPVVEINSFVMGA--GIDGVITDFPGT  646



>ref|XP_010545263.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=764

 Score =   297 bits (761),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 173/215 (80%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLS+S+ VVI++ISSPEVNFL+SIA R   +  + VF+FLG ++ EPST
Sbjct  188  YAQHNLSMRSFVLSISKSVVIDFISSPEVNFLRSIAGRFGRKGPRFVFQFLGQEDVEPST  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL NL  IKTFASGI+VPK YIWPV  SS YL P TSLV DAHK GLEVYAS F
Sbjct  248  NQTYGSLLHNLTFIKTFASGIIVPKIYIWPV--SSLYLLPPTSLVQDAHKAGLEVYASGF  305

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DPVAEYLSF+DNGN SVDGVLSDFPIT S A+DC+SH+ +    Q  +
Sbjct  306  ANDFDMAYNYSFDPVAEYLSFMDNGNLSVDGVLSDFPITASEAVDCFSHLDRNAPKQA-D  364

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS DGASGD P CT+ AY KA+ DG D+IDC+
Sbjct  365  FLVISKDGASGDLPSCTNVAYDKAIKDGADVIDCS  399



>ref|XP_010064948.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Eucalyptus grandis]
Length=746

 Score =   296 bits (759),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHNLSMR+FV++ S+ V+I+YISSPEV+FL+SIA R++P  TKL+FRF+G D  EPS 
Sbjct  170  FTQHNLSMRSFVIATSKSVIIDYISSPEVDFLRSIAGRVSPTKTKLIFRFMGKDVLEPSI  229

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL +NL  +KTFASGILVPK YIWPVD  S+YLQ  TSLV DAHK GL V+ASDF
Sbjct  230  NQTYGSLSKNLTFVKTFASGILVPKVYIWPVD-GSNYLQAHTSLVSDAHKAGLTVFASDF  288

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YS+DPVAE LS++DNG +SVDGV++DFPIT S AI C++H  K    Q   
Sbjct  289  VNDVPLSYNYSFDPVAETLSYVDNGAFSVDGVITDFPITSSAAIRCFAHPSKNSSVQAKP  348

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVISF+GASGDYPGCTD AYSKA+ DG DIIDC
Sbjct  349  -LVISFNGASGDYPGCTDLAYSKAIQDGADIIDC  381



>ref|XP_002276757.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Vitis 
vinifera]
 emb|CBI26719.3| unnamed protein product [Vitis vinifera]
Length=757

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 177/214 (83%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y++HNLSMR FVLSVS+ V+++YISSPEV FL+ ++ R     TKL+FRFL  +ET+PST
Sbjct  177  YTKHNLSMRNFVLSVSKSVIVDYISSPEVAFLRGVSQRFKATKTKLIFRFLEKEETDPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL NL  IKTFASGILVPK YIWPV+K +SYL+ +T +V +AHK GLEV+ SDF
Sbjct  237  NQTYGSLLNNLTFIKTFASGILVPKGYIWPVNK-NSYLESSTLVVQNAHKEGLEVFGSDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D+PF+++YSYDP+AE L+FIDN  +SVDGVLSDFPITPS AIDC++H+ K    Q  +
Sbjct  296  INDIPFSYNYSYDPIAEVLNFIDNDAFSVDGVLSDFPITPSAAIDCFAHIGKNASGQ-EK  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS++GASGDYP CTD AY+KA+SDGVD++DC
Sbjct  355  PLIISYNGASGDYPSCTDLAYTKAISDGVDVLDC  388



>ref|XP_004491451.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cicer arietinum]
Length=762

 Score =   296 bits (759),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 176/214 (82%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QH LSMR++VLSVSRRV ++YISSPEV FL+SI +R +P++TKLVFRFL  D+T+PST
Sbjct  184  YTQHKLSMRSYVLSVSRRVPVSYISSPEVGFLRSITTRFDPKITKLVFRFLNQDDTDPST  243

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD +S YLQ  T+LV DAHK GLEVYASDF
Sbjct  244  NQTYGSLLKNLTFIKTFASGILVPKEYIWPVD-ASLYLQQHTTLVSDAHKAGLEVYASDF  302

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            ++DV  +++YSYDP+AEYL FIDNG++SVDGVL+DFPITPS AI C++H+      +  +
Sbjct  303  SNDVVNSYNYSYDPLAEYLQFIDNGDFSVDGVLTDFPITPSEAIGCFAHL-GANATRKDK  361

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS  GASGDYP CTD AY  A+ DG D++DC
Sbjct  362  TLIISKYGASGDYPACTDLAYKNAILDGADVLDC  395



>ref|XP_011013351.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   296 bits (758),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 142/214 (66%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            + QHNLSMR+++LS+SRRVVIN++SSPE  FL+SI  R N  +TKLVFRFL  +  EPST
Sbjct  177  FKQHNLSMRSYILSLSRRVVINHLSSPEAGFLRSIVKRFNLNITKLVFRFLEPNVIEPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGSL +N   IKTFASGIL+PKSYIWP+D +S+YL P TS+VLDAHK GLEV+ SDF
Sbjct  237  NETYGSLSRNFTFIKTFASGILIPKSYIWPLD-ASNYLLPHTSIVLDAHKAGLEVFVSDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YSYDPV EYLSF+DNG++SVDGVLSDFP+TPS  I C+S + K    QV +
Sbjct  296  YNDVPLSYNYSYDPVTEYLSFVDNGDFSVDGVLSDFPVTPSATIGCFSGLGKNATPQV-K  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYPGCTD AY KA+ DG D+IDC
Sbjct  355  ILVISKNGASGDYPGCTDLAYQKAILDGADVIDC  388



>ref|XP_010270134.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Nelumbo 
nucifera]
Length=751

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 172/215 (80%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSVSRRV++NYISSPEV FL SIA+R     TKLVFRFLG D+ EPST
Sbjct  177  YTQHNLSMRSFVLSVSRRVIVNYISSPEVAFLSSIAARFRRSTTKLVFRFLGADDIEPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLLQNL  +K FASGILVPK+ IWPV  SS YLQP TS+V +AHK GLEV+ASDF
Sbjct  237  NQTYGSLLQNLTFVKAFASGILVPKTSIWPV-TSSLYLQPPTSVVSNAHKEGLEVFASDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YSYDP+ EYL+FIDNG +SVDGVLSDFPITPS AIDC++H       +   
Sbjct  296  TNDVPLSYNYSYDPIKEYLNFIDNGVFSVDGVLSDFPITPSEAIDCFAHANMNSSGKANP  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+IS +GASGDYPG TD AY +A   G D+IDC+
Sbjct  356  -LIISHNGASGDYPGSTDLAYMEARDAGADVIDCS  389



>ref|XP_007146558.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18552.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=762

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 170/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM+ F+  V   V ++YISSPE  FLKSI + INP++TKLVFRFLG +E +PST
Sbjct  182  YTQHNLSMKNFIRFVYTTVNVSYISSPEAGFLKSIKTDINPKITKLVFRFLGKEEVDPST  241

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             QTYGSLLQNL  IKTFASGILVPK YIWPVD +S YLQP TSLV DAHKVGLEV+AS F
Sbjct  242  KQTYGSLLQNLTFIKTFASGILVPKDYIWPVDPTSHYLQPHTSLVSDAHKVGLEVFASTF  301

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D+P +++YSYDP  E+LSFI+NGN+SVDGVLSDFP+T S AIDC+ HM      +V  
Sbjct  302  QNDIPISYNYSYDPFFEHLSFIENGNFSVDGVLSDFPLTSSAAIDCFVHMGLNAPKKV-N  360

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CTD AY KA+ DGVDI+DC
Sbjct  361  TLVISKYGASGDYPPCTDLAYKKAILDGVDILDC  394



>ref|XP_003617676.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
 gb|AET00635.1| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=754

 Score =   296 bits (758),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 176/214 (82%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQHNLSMR+FVL+VSRR+ ++YISSPE  FL+SI  R NP+ TKLVFRFL  ++T+PST
Sbjct  177  YSQHNLSMRSFVLAVSRRLHVSYISSPEAGFLRSITKRFNPKTTKLVFRFLNQEDTDPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS L+NL  IKTFASGILVPK YIWPVD +S YLQP TSLV DAHK GLEV+A+DF
Sbjct  237  NQTYGSFLKNLTFIKTFASGILVPKGYIWPVD-ASLYLQPHTSLVSDAHKAGLEVFAADF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            ++D+  +++YS+DP+AE L FIDNG ++VDGVL+DFP+TPS AIDC++H+      +  +
Sbjct  296  SNDIVISYNYSFDPLAESLQFIDNGEFTVDGVLTDFPLTPSAAIDCFAHIGNNATRR-DK  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS  GASGD+P CT+ AY+KA+ DGVD++DC
Sbjct  355  TLIISKYGASGDFPACTNLAYNKAIQDGVDVLDC  388



>gb|KDO62174.1| hypothetical protein CISIN_1g003550mg [Citrus sinensis]
Length=811

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 180/214 (84%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSVSR VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+T
Sbjct  230  YAQHNLSMRSFVLSVSRSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTT  289

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+F
Sbjct  290  NQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNF  348

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +F+YSYDP+ EYLSFIDNG++SVDGVLSDFP+TPS A+DC++H+ K        
Sbjct  349  ANDIPISFNYSYDPLTEYLSFIDNGDFSVDGVLSDFPLTPSAAVDCFAHLGKNASKSA-N  407

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CT+ AY KA+SDGVD IDC
Sbjct  408  LLVISKNGASGDYPSCTNLAYQKAISDGVDFIDC  441



>ref|XP_010536709.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Tarenaya hassleriana]
Length=752

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/215 (70%), Positives = 172/215 (80%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSMR+FVLSVSR V+I+YISSPEV+FL+SIA        K VFRFLG DE EPST
Sbjct  178  YGQHNLSMRSFVLSVSRNVIIDYISSPEVSFLRSIAGSFRRNGPKFVFRFLGQDEVEPST  237

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK+YI PV+  + YL   TSLV DAHK GLE+YAS F
Sbjct  238  NQTYGSLLRNLTFIKTFASGILVPKNYILPVN--NLYLLQPTSLVQDAHKAGLEIYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DPVAEYLSF+DNGN+SVDGVLSDFPIT S AI C+SH+ K    QV +
Sbjct  296  ANDFDMAYNYSFDPVAEYLSFVDNGNFSVDGVLSDFPITASEAIGCFSHLGKNATKQV-D  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPG TD AY KA+ DG DIIDC+
Sbjct  355  FLVISKNGASGDYPGSTDLAYDKAIKDGADIIDCS  389



>ref|XP_002862842.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH39100.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=719

 Score =   295 bits (754),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 176/214 (82%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR  V+S+SRR+++N+ISSPE++FLKS+ + + P VTKL+F+FL  D+ EP T
Sbjct  158  YTQHNLSMRNSVISLSRRLIVNFISSPEISFLKSMKNSVKPTVTKLIFKFLKQDDIEPFT  217

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+YGSL +NL+ I+TF+SGILVPKSYIWPVD S+ YLQP TSLV DAHK GL+V+AS+F
Sbjct  218  NQSYGSLAKNLSYIRTFSSGILVPKSYIWPVD-SALYLQPHTSLVTDAHKEGLQVFASEF  276

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP AEYLSFIDNGN+SVDG LSDFP+TP  AI+C+SH+   +  +  +
Sbjct  277  ANDFVIAYNYSYDPTAEYLSFIDNGNFSVDGFLSDFPVTPYRAINCFSHLDTKKAKEQAK  336

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +IS +GASGD+PGCTD AY +A +DG DI+DC
Sbjct  337  ITIISKNGASGDFPGCTDLAYQRAATDGADILDC  370



>ref|XP_008447692.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
 ref|XP_008447693.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Cucumis melo]
Length=764

 Score =   295 bits (756),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 175/214 (82%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHN SMR FVLSV+RR+V+NYISSPEV FL+SIA+R+ PR TKL+ RFLG  +TE +T
Sbjct  181  FTQHNASMRNFVLSVTRRIVVNYISSPEVGFLRSIAARV-PRTTKLILRFLGPTDTEITT  239

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK+YIWP+  +  Y+Q  T LV DAHK  LEV+AS+F
Sbjct  240  NQTYGSLLRNLTFIKTFASGILVPKTYIWPMG-TDGYVQAQTPLVSDAHKAQLEVFASEF  298

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             SD+P  ++YSYDPV EYLS+ DNG +SVDGVLSDFPITPS AIDC++H+ K  K+Q   
Sbjct  299  FSDLPLGYNYSYDPVTEYLSYFDNGKFSVDGVLSDFPITPSSAIDCFAHLDKNAKSQAKP  358

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYPGCTD AY+ A+SDGV+++DC
Sbjct  359  -LVISKFGASGDYPGCTDLAYTNAMSDGVEVLDC  391



>ref|XP_010675854.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=764

 Score =   295 bits (756),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 174/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQHNLSMR+F+L+ +  + I++ISSPEVNFL+ +A+      TKLVFRFL  DETEPST
Sbjct  190  YSQHNLSMRSFILNAAESMNISHISSPEVNFLRGLATPFASTSTKLVFRFLDQDETEPST  249

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+YGSLL NL  I TFASGILVPK+YIWPVD ++SYL P TSLV DAH+VGLEVYA+ F
Sbjct  250  NQSYGSLLTNLTMISTFASGILVPKNYIWPVD-ATSYLLPHTSLVADAHRVGLEVYAAGF  308

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV FA+++SY+PV EYLSFIDNGN+SVDGVLSDFPITPS A DC++H+      Q   
Sbjct  309  ANDVSFAYNFSYNPVDEYLSFIDNGNFSVDGVLSDFPITPSEARDCFAHLGVNASAQATP  368

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS++GASGDYPGCTD AY++A+ DG D IDC
Sbjct  369  -LVISYNGASGDYPGCTDIAYTQAIRDGADFIDC  401



>ref|XP_002300353.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
 gb|EEE85158.2| glycerophosphoryl diester phosphodiesterase family protein, partial 
[Populus trichocarpa]
Length=495

 Score =   288 bits (736),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 169/214 (79%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHNLSMR +VLS+SRRVVIN++SSPE  FL+SI  R N  +TKLVFRFL  +  EPST
Sbjct  177  FTQHNLSMRIYVLSLSRRVVINHLSSPEAGFLRSIVKRFNLNITKLVFRFLEPNVIEPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGSL +N   IKTFASGIL+PKSYIWP+D +S+YLQP TS+V DAHK GLEV+ S+F
Sbjct  237  NETYGSLSKNFTFIKTFASGILIPKSYIWPLD-ASNYLQPQTSIVSDAHKAGLEVFVSEF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YSYDPV EYL F+DNG +SVDG+LSDFP+TPS  I C+  + K    QV  
Sbjct  296  YNDVPLSYNYSYDPVTEYLRFVDNGEFSVDGMLSDFPVTPSATIACFHGLGKNDTPQV-N  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              VIS +GASGDYPGCTD AY KA+ DG D+IDC
Sbjct  355  LSVISKNGASGDYPGCTDLAYQKAILDGADVIDC  388



>ref|XP_009361078.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 172/214 (80%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR +VLSVS++VVINYISSPEV FL SI +R++P  TKLVFRFLG DETEPST
Sbjct  175  FSQHNLSMRKYVLSVSKQVVINYISSPEVAFLNSIKARVSPSATKLVFRFLGQDETEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGIL+PK YIWP  K  +YL+P T +V DAHK GL V+ASDF
Sbjct  235  NQTYGSLLKNLTFIKTFASGILIPKIYIWPFTK-DNYLEPHTPVVTDAHKEGLTVFASDF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D P A++YSYDPV+EYL FIDN ++SVDGVLSDFP+T S AIDC++H+      Q   
Sbjct  294  VNDYPLAYNYSYDPVSEYLQFIDNVDFSVDGVLSDFPMTASEAIDCFAHLGSNASRQAKP  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGD P CTD AY +A+++GVD++DC
Sbjct  354  -LVISKYGASGDLPSCTDLAYERAIANGVDVLDC  386



>ref|XP_009348463.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=752

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 173/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR +VLSVS++VVINYISSPEV FL SI +R++P  TKLVFRFLG DETEPST
Sbjct  175  FSQHNLSMRKYVLSVSKQVVINYISSPEVAFLNSIKARVSPSATKLVFRFLGQDETEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGIL+PK YIWP  K  +YL+P T +V DAHK GL V+ASDF
Sbjct  235  NQTYGSLLKNLTFIKTFASGILIPKIYIWPFTK-DNYLEPHTPVVTDAHKEGLTVFASDF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D P A++YSYDPV+EYL FIDN ++SVDGVLSDFP+T S AIDC++H+      Q  +
Sbjct  294  VNDYPLAYNYSYDPVSEYLQFIDNVDFSVDGVLSDFPMTASEAIDCFAHLGSNASRQA-K  352

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGD P CTD AY +A+++GVD++DC
Sbjct  353  PLVISKYGASGDLPSCTDLAYERAIANGVDVLDC  386



>ref|XP_010099974.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
 gb|EXB81079.1| putative glycerophosphoryl diester phosphodiesterase 2 [Morus 
notabilis]
Length=748

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 170/214 (79%), Gaps = 15/214 (7%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QH L+MR++VL++S+ +++NYISSPEV FL  I SR N + TKLVFRFLG DET+PST
Sbjct  177  FTQHKLNMRSYVLNISKHIIVNYISSPEVAFLNGIKSRFNQKTTKLVFRFLGKDETDPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD   SYLQP TSLV DAHK GLEV+ASDF
Sbjct  237  NQTYGSLLKNLTYIKTFASGILVPKIYIWPVDP-KSYLQPHTSLVSDAHKEGLEVFASDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D P +F+YSYDPVAEYL+FIDNGN+SVDGVLSDFPITPS AI               +
Sbjct  296  VNDFPLSFNYSYDPVAEYLNFIDNGNFSVDGVLSDFPITPSAAI--------------VK  341

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDY GCTD AY+KA+ DGVD++DC
Sbjct  342  TLVISKYGASGDYTGCTDKAYTKAIEDGVDVLDC  375



>ref|XP_004499801.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 3-like [Cicer arietinum]
Length=763

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 173/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QH LS+R++VLSVSR V ++YISSPEV FL+SI +R NP++TKLVFRFL  D+T+PST
Sbjct  185  YTQHKLSIRSYVLSVSRSVPVSYISSPEVGFLRSITTRFNPKITKLVFRFLNQDDTDPST  244

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD  S YLQP T+LV DAHK GLEVYASDF
Sbjct  245  NQTYGSLLKNLTFIKTFASGILVPKEYIWPVD-VSLYLQPHTTLVSDAHKAGLEVYASDF  303

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DV  +++YSYDP+AEYL FIDNG +SVDGVL+DFPITPS AI C++H+      +  +
Sbjct  304  FNDVVNSYNYSYDPLAEYLQFIDNGEFSVDGVLTDFPITPSEAIGCFAHL-GANATRKDK  362

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS  GASGDYP CTD AY  A+ DG D++DC
Sbjct  363  TLIISKYGASGDYPACTDLAYKNAILDGADVLDC  396



>ref|XP_011014930.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
 ref|XP_011014931.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Populus euphratica]
Length=753

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 171/214 (80%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            + QHNLSMR+++LS+S+RVVIN++SSPE  FL+ I  R N  VTKLVFRFL  +  EPST
Sbjct  177  FKQHNLSMRSYILSLSKRVVINHLSSPEAGFLRGIVKRFNLNVTKLVFRFLEPNVIEPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGSL  N   IKTFASGIL+ KSYIWP+D +S+YLQP TS+V DAHK GLEV+ SDF
Sbjct  237  NETYGSLSTNFTFIKTFASGILIQKSYIWPLD-ASNYLQPHTSIVSDAHKAGLEVFVSDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YSYDPV EYL F+DNG++SVDGVLSDFP+TPS  IDC+S + K    QV E
Sbjct  296  YNDVPLSYNYSYDPVTEYLGFVDNGDFSVDGVLSDFPVTPSATIDCFSGLGKNATPQV-E  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYPGCTD AY KA+ DG D+IDC
Sbjct  355  LLVISKNGASGDYPGCTDLAYQKAILDGADVIDC  388



>ref|XP_002883252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH59511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=731

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 176/215 (82%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR  VLS+SRR+ +N+ISSPE++FLKS+ + + P VTKL+F+FL  D  EP T
Sbjct  158  YAQHNLSMRNSVLSLSRRLKVNFISSPEISFLKSMKNSVKPTVTKLIFKFLKQDHIEPFT  217

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+YGSL +NL+ I+TF+SGILVPKSYIWP+D S+ YLQP TSLV DAHK GL+V+AS+F
Sbjct  218  NQSYGSLAKNLSYIRTFSSGILVPKSYIWPID-SALYLQPHTSLVTDAHKEGLQVFASEF  276

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHM-RKGQKNQVP  538
            A+D   A++YSYDP AEYLSFIDNGN+SVDG LSDFP+TP  AI+C+SH+  KG K Q  
Sbjct  277  ANDFVIAYNYSYDPTAEYLSFIDNGNFSVDGFLSDFPVTPYRAINCFSHVDTKGAKKQA-  335

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            +  ++S +GASGD+PGCTD AY +A SDG DI+DC
Sbjct  336  KITILSKNGASGDFPGCTDLAYERAASDGADILDC  370



>ref|XP_006474966.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Citrus sinensis]
Length=764

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 150/214 (70%), Positives = 179/214 (84%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+FVLSVSR VV+NYISSPEVNFL+SIA+R  P +TKLVFRFLG  E EP+T
Sbjct  183  YAQHNLSMRSFVLSVSRSVVVNYISSPEVNFLRSIAARFRPSMTKLVFRFLGKSEIEPTT  242

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPVD+ S YL P T++VLDAHK  LEV+AS+F
Sbjct  243  NQTYGSLLKNLTFIKTFASGILVPKDYIWPVDE-SLYLLPHTTIVLDAHKERLEVFASNF  301

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +F+YS+DP+ EYLSFIDN ++SVDGVLSDFP+TPS A+DC++H+ K        
Sbjct  302  ANDIPISFNYSHDPLTEYLSFIDNRDFSVDGVLSDFPLTPSAAVDCFAHLGKNASKSA-N  360

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CT+ AY KA+SDGVD IDC
Sbjct  361  LLVISKNGASGDYPSCTNLAYQKAISDGVDFIDC  394



>ref|XP_002300351.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
 gb|EEE85156.2| hypothetical protein POPTR_0001s37160g [Populus trichocarpa]
Length=754

 Score =   292 bits (747),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 172/214 (80%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHNLSMR++VLS+ RRVVIN++SSPE  FL+SI  R N  +TKLVFRFL ++  EPST
Sbjct  177  FTQHNLSMRSYVLSLYRRVVINHLSSPEAGFLRSIVKRFNLNITKLVFRFLESNVIEPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGSL +N   IKTFASGIL+PKSYIWP+D +S+YLQP TS+V DAHK GLEV+ S+F
Sbjct  237  NETYGSLSKNFTFIKTFASGILIPKSYIWPLD-ASNYLQPHTSIVSDAHKAGLEVFVSEF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVP +++YSYDPV EYL F+DNG +SVDGVLSDFP+TPS  IDC+S + K    QV  
Sbjct  296  YNDVPLSYNYSYDPVTEYLRFVDNGEFSVDGVLSDFPVTPSATIDCFSGLGKNATPQV-N  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              VIS +GASGDYPGCTD AY KA+ DG D+IDC
Sbjct  355  LSVISKNGASGDYPGCTDLAYQKAILDGADVIDC  388



>ref|XP_002864395.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH40654.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=757

 Score =   291 bits (746),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 173/215 (80%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F+LS+S+ V+I+Y+SSPEVNF ++I SR   +  K VFRFL  D+ E ST
Sbjct  179  YAQHNLSMSSFLLSISKTVIIDYLSSPEVNFFRNIGSRFGRKGPKFVFRFLEKDDVEVST  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL  NL  +KTFASGILVPKSYIWPV+  S YL P TS V DAHK GLEVYAS F
Sbjct  239  NQTYGSLAGNLTFVKTFASGILVPKSYIWPVE--SQYLLPHTSFVQDAHKAGLEVYASGF  296

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DP+AEYLSF+DNG++SVDGVLSDFP+T S A+DC+SH+     +QV +
Sbjct  297  ANDFDLAYNYSFDPLAEYLSFVDNGDFSVDGVLSDFPLTASSAVDCFSHLGSNASSQV-D  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY+KA+ DG D+IDC+
Sbjct  356  FLVISKNGASGDYPGCTDLAYTKAIKDGADVIDCS  390



>ref|XP_010482994.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 [Camelina 
sativa]
Length=769

 Score =   291 bits (745),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 172/215 (80%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLS+ +F+LSVS+ V INY+SSPEVNF ++I SR   +  K VFRFL  D+ E ST
Sbjct  191  YAQHNLSISSFLLSVSKTVTINYLSSPEVNFFRNIGSRFGRKGPKFVFRFLEKDDVEVST  250

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL  NL  IKTFASGILVPKSYIWPV+  S YL P TS+V DAHK GLEVYAS F
Sbjct  251  NQTYGSLAGNLTFIKTFASGILVPKSYIWPVE--SQYLLPHTSVVQDAHKAGLEVYASGF  308

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DP+AEYLSF+DNG++SVDG+LSDFP+T S A+DC+SH+      QV +
Sbjct  309  ANDFDIAYNYSFDPLAEYLSFVDNGDFSVDGLLSDFPLTASSAVDCFSHLGTNASTQV-D  367

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AYSKA+ DG D+IDC+
Sbjct  368  FLVISKNGASGDYPGCTDLAYSKAIKDGADVIDCS  402



>ref|XP_009798152.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Nicotiana sylvestris]
Length=391

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 156/178 (88%), Gaps = 1/178 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR+F++S+SR V++NYISSPEVNFLKSI SR NP VTKLVFRFLG  + EPST
Sbjct  191  FSQHNLSMRSFIISLSRSVIVNYISSPEVNFLKSIVSRFNPLVTKLVFRFLGQGDIEPST  250

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK+YIWPVD +S YLQP TSLVLDAHK GL+++AS+F
Sbjct  251  NQTYGSLLKNLTFIKTFASGILVPKTYIWPVD-NSLYLQPHTSLVLDAHKEGLQIFASEF  309

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
             +DVPFA++YSYDP  EYLSFIDNG++SVDGVLSDFPITPS  IDC++H+ K  K QV
Sbjct  310  VNDVPFAYNYSYDPATEYLSFIDNGDFSVDGVLSDFPITPSATIDCFTHLGKNDKPQV  367



>gb|KFK27133.1| hypothetical protein AALP_AA8G339300 [Arabis alpina]
Length=764

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/215 (66%), Positives = 172/215 (80%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM TF+LSVS+ V I+Y+SSPEVNF ++I SR   +  K VFRFL  D+ E ST
Sbjct  185  YAQHNLSMSTFLLSVSKTVTIDYLSSPEVNFFRNIGSRFGKKGPKFVFRFLEKDDVEVST  244

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N TYGSL++NL  +KTFASG++VPKSYIWPV+  S YL P TS V DAHK GLEVYAS F
Sbjct  245  NLTYGSLVKNLTFVKTFASGVMVPKSYIWPVE--SLYLLPHTSFVQDAHKAGLEVYASGF  302

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DP+AEYLSF+DNG++SVDGVLSDFP+T S A+DC+SH+      QV +
Sbjct  303  ANDFDLAYNYSFDPMAEYLSFVDNGDFSVDGVLSDFPLTASSAVDCFSHLGSNASPQV-D  361

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AYSKA+ DG DIIDC+
Sbjct  362  FLVISKNGASGDYPGCTDLAYSKAIKDGADIIDCS  396



>ref|XP_006401453.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
 gb|ESQ42906.1| hypothetical protein EUTSA_v10012748mg [Eutrema salsugineum]
Length=768

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F+L+VS+ V I+Y+SSPEVNF ++I  R      K VFRFL  D+ E ST
Sbjct  188  YAQHNLSMSSFLLTVSKTVFIDYLSSPEVNFFRNIGGRFGKNGPKFVFRFLEKDDIEVST  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL+ NL  IKTFASG+LVPKSYIWP++  S YL+P TS V DAHK GLEVYAS F
Sbjct  248  NQTYGSLIGNLTFIKTFASGVLVPKSYIWPLE--SKYLRPHTSFVQDAHKAGLEVYASGF  305

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DP+AEYLSF+DNG++SVDGVLSDFP+T S A+DC+SH+      QV +
Sbjct  306  ANDFDLAYNYSFDPLAEYLSFMDNGDFSVDGVLSDFPLTASSAVDCFSHLGTNASTQV-D  364

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AYSKA+ DG DIIDC+
Sbjct  365  FLVISKNGASGDYPGCTDLAYSKAIKDGADIIDCS  399



>ref|NP_567755.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
 sp|Q9SZ11.3|GPDL3_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL3; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
3; Short=ATGDPDL3; AltName: Full=Glycerophosphodiesterase-like 
2; AltName: Full=Protein MUTANT ROOT HAIR 5; AltName: Full=Protein 
SHAVEN 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE85238.1| glycerophosphoryl diester phosphodiesterase-like 3 [Arabidopsis 
thaliana]
Length=759

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 170/215 (79%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F+++ S+ V+I++ISSPEVNF K IA R       LVFRFLG DE EP+T
Sbjct  182  YAQHNLSMSSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRNGPSLVFRFLGQDEFEPTT  241

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GLEV+ S F
Sbjct  242  NRTYGSILSNLTFVKTFASGILVPKSYILPLDD-QQYLLPHTSLVQDAHKAGLEVFVSGF  300

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  A DYS+DPV+EYLSF+DNGN+SVDGVLSDFPIT S ++DC+SH+ +    QV +
Sbjct  301  ANDIDIAHDYSFDPVSEYLSFVDNGNFSVDGVLSDFPITASASLDCFSHVGRNATKQV-D  359

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVI+ DGASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  360  FLVITKDGASGDYPGCTDLAYKKAIKDGADVIDCS  394



>gb|AAL07129.1| unknown protein [Arabidopsis thaliana]
Length=759

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 170/215 (79%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F+++ S+ V+I++ISSPEVNF K IA R       LVFRFLG DE EP+T
Sbjct  182  YAQHNLSMSSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRNGPSLVFRFLGQDEFEPTT  241

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GLEV+ S F
Sbjct  242  NRTYGSILSNLTFVKTFASGILVPKSYILPLD-DQQYLLPHTSLVQDAHKAGLEVFVSGF  300

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  A DYS+DPV+EYLSF+DNGN+SVDGVLSDFPIT S ++DC+SH+ +    QV +
Sbjct  301  ANDIDIAHDYSFDPVSEYLSFVDNGNFSVDGVLSDFPITASASLDCFSHVGRNATKQV-D  359

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVI+ DGASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  360  FLVITKDGASGDYPGCTDLAYKKAIKDGADVIDCS  394



>emb|CAB36515.1| putative protein [Arabidopsis thaliana]
 emb|CAB79524.1| putative protein [Arabidopsis thaliana]
Length=770

 Score =   290 bits (741),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 170/215 (79%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F+++ S+ V+I++ISSPEVNF K IA R       LVFRFLG DE EP+T
Sbjct  193  YAQHNLSMSSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRNGPSLVFRFLGQDEFEPTT  252

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GLEV+ S F
Sbjct  253  NRTYGSILSNLTFVKTFASGILVPKSYILPLD-DQQYLLPHTSLVQDAHKAGLEVFVSGF  311

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  A DYS+DPV+EYLSF+DNGN+SVDGVLSDFPIT S ++DC+SH+ +    QV +
Sbjct  312  ANDIDIAHDYSFDPVSEYLSFVDNGNFSVDGVLSDFPITASASLDCFSHVGRNATKQV-D  370

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVI+ DGASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  371  FLVITKDGASGDYPGCTDLAYKKAIKDGADVIDCS  405



>ref|XP_010913178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4 isoform 
X2 [Elaeis guineensis]
Length=674

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 171/214 (80%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +HNL+MR++VLSVSRRV++NYISSPEVNFL+SI +R     TKLVFRFL  D  EPST
Sbjct  181  YRKHNLNMRSYVLSVSRRVIVNYISSPEVNFLRSIEARFRKSKTKLVFRFLNQDIPEPST  240

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG LL+NL  IKTFASGILVPK YIW V  S +YLQ  TS+V+DAHK GLE++A+DF
Sbjct  241  NQTYGLLLKNLTFIKTFASGILVPKHYIWLV-TSDNYLQSYTSIVMDAHKAGLEIFAADF  299

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP++EYL FIDNG +SVDGVL+D+PITPS AI C+SH+ K   + V  
Sbjct  300  ANDNIISYNYSYDPLSEYLYFIDNGFFSVDGVLTDYPITPSEAIGCFSHINKSSMDHVRP  359

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  360  -LIISHNGASGDYPDCTDLAYQKAVKDGADVIDC  392



>ref|XP_010252665.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=754

 Score =   289 bits (739),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 172/214 (80%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHNLSMR+FVLSVSRRV+++YISSPEV FL+SI +R     TKLVFRFL  D+ EP+T
Sbjct  180  FTQHNLSMRSFVLSVSRRVIVSYISSPEVAFLRSITARFKQSTTKLVFRFLRADDIEPTT  239

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY S+L+NL  +KTFAS ILVPK+YIWPV+ +  YLQP TS+VL+AH+ GLEV+ASDF
Sbjct  240  NQTYDSILKNLTFVKTFASAILVPKNYIWPVN-TDLYLQPHTSVVLNAHREGLEVFASDF  298

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DVP +++YSYDP+ E LSFIDNG +SVDG+LSDFPITPS AIDC++H+      + P 
Sbjct  299  ANDVPLSYNYSYDPIKECLSFIDNGKFSVDGILSDFPITPSEAIDCFAHLSTNSSGKAP-  357

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASG YP  TD AY +A  DG D+IDC
Sbjct  358  -LVISHNGASGIYPSSTDIAYKQAFDDGADVIDC  390



>ref|XP_010443178.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
[Camelina sativa]
Length=767

 Score =   289 bits (739),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 172/215 (80%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLS+ +F+LSVS+ V +NY+SSPEV+F ++I SR   +  K VFRFL  D+ E ST
Sbjct  189  YAQHNLSISSFLLSVSKTVTVNYLSSPEVDFFRNIGSRFERKGPKFVFRFLEKDDVEVST  248

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL  NL  IKTFASGILVPKSYIWPV+  S YL P TS+V DAHK GLEVYAS F
Sbjct  249  NQTYGSLAGNLTFIKTFASGILVPKSYIWPVE--SQYLLPHTSVVQDAHKAGLEVYASGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DP+AEYLSF+DNG++SVDG+LSDFP+T S A+DC+SH+      QV +
Sbjct  307  ANDFDIAYNYSFDPLAEYLSFVDNGDFSVDGLLSDFPLTASSAVDCFSHLGTNASTQV-D  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AYSKA+ DG D+IDC+
Sbjct  366  FLVISKNGASGDYPGCTDLAYSKAIKDGADVIDCS  400



>gb|AAO42211.1| unknown protein [Arabidopsis thaliana]
Length=729

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 173/214 (81%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y++HNLSMR  V+S+SRR+ +N+ISSP ++FLKS+ + + P VTKL+FRFL  +  EP T
Sbjct  158  YAKHNLSMRNSVVSLSRRLKVNFISSPGISFLKSMKNSVKPTVTKLIFRFLKQEHIEPFT  217

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+YGSL +NL+ I+TF+SGILVPKSYIWPVD S+ YLQP TSLV DAHK GL+V+AS+F
Sbjct  218  NQSYGSLAKNLSYIRTFSSGILVPKSYIWPVD-SALYLQPHTSLVTDAHKEGLQVFASEF  276

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP AEYLSFIDNGN+SVDG LSDFP+TP  AI+C+SH+   +  +  +
Sbjct  277  ANDFVIAYNYSYDPTAEYLSFIDNGNFSVDGFLSDFPVTPYRAINCFSHVDPKRAKEQAK  336

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +IS +GASGD+PGCTD AY +A SDG DI+DC
Sbjct  337  ITIISKNGASGDFPGCTDLAYQRAASDGADILDC  370



>ref|XP_006406374.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
 gb|ESQ47827.1| hypothetical protein EUTSA_v10020151mg [Eutrema salsugineum]
Length=727

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 169/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR  V+S+SRR+ I +ISSPE++FL+++   +N  VTKL+FRFL  D  +P T
Sbjct  158  YAQHNLSMRNSVVSLSRRMKIKFISSPEISFLRNMKKDVNTTVTKLIFRFLNQDRIDPFT  217

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+YGSL +NL+ IKTF+SGILVPKSYIWP+  S  YLQP TS V DAHK GL+V+ASDF
Sbjct  218  NQSYGSLAKNLSYIKTFSSGILVPKSYIWPLG-SDLYLQPHTSFVTDAHKEGLQVFASDF  276

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  FA++YSYDP AEYLSFIDNGN+SVDG LSDFP+TP  AI C+SH+   +  +   
Sbjct  277  ANDFVFAYNYSYDPTAEYLSFIDNGNFSVDGFLSDFPLTPYRAISCFSHLDTKKAKEQAN  336

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +IS DGASGD+ GCTD AY KAVSDGVDI+DC
Sbjct  337  VTIISKDGASGDFAGCTDLAYEKAVSDGVDILDC  370



>ref|NP_188688.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
 sp|F4JEQ1.1|GPDL5_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL5; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
5; Short=ATGDPDL5; AltName: Full=Glycerophosphodiesterase-like 
4; AltName: Full=Protein SHV3-LIKE 3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE76390.1| glycerophosphodiester phosphodiesterase-like protein [Arabidopsis 
thaliana]
Length=729

 Score =   287 bits (735),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 173/214 (81%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y++HNLSMR  V+S+SRR+ +N+ISSP ++FLKS+ + + P VTKL+FRFL  +  EP T
Sbjct  158  YAKHNLSMRNSVVSLSRRLKVNFISSPGISFLKSMKNSVKPTVTKLIFRFLKQEHIEPFT  217

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+YGSL +NL+ I+TF+SGILVPKSYIWPVD S+ YLQP TSLV DAHK GL+V+AS+F
Sbjct  218  NQSYGSLAKNLSYIRTFSSGILVPKSYIWPVD-SALYLQPHTSLVTDAHKEGLQVFASEF  276

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP AEYLSFIDNGN+SVDG LSDFP+TP  AI+C+SH+   +  +  +
Sbjct  277  ANDFVIAYNYSYDPTAEYLSFIDNGNFSVDGFLSDFPVTPYRAINCFSHVDPKRAKEQAK  336

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +IS +GASGD+PGCTD AY +A SDG DI+DC
Sbjct  337  ITIISKNGASGDFPGCTDLAYQRAASDGADILDC  370



>ref|XP_010913177.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 isoform 
X1 [Elaeis guineensis]
Length=759

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 141/214 (66%), Positives = 171/214 (80%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +HNL+MR++VLSVSRRV++NYISSPEVNFL+SI +R     TKLVFRFL  D  EPST
Sbjct  181  YRKHNLNMRSYVLSVSRRVIVNYISSPEVNFLRSIEARFRKSKTKLVFRFLNQDIPEPST  240

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG LL+NL  IKTFASGILVPK YIW V  S +YLQ  TS+V+DAHK GLE++A+DF
Sbjct  241  NQTYGLLLKNLTFIKTFASGILVPKHYIWLV-TSDNYLQSYTSIVMDAHKAGLEIFAADF  299

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP++EYL FIDNG +SVDGVL+D+PITPS AI C+SH+ K   + V  
Sbjct  300  ANDNIISYNYSYDPLSEYLYFIDNGFFSVDGVLTDYPITPSEAIGCFSHINKSSMDHVRP  359

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  360  -LIISHNGASGDYPDCTDLAYQKAVKDGADVIDC  392



>ref|XP_006280047.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12945.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=682

 Score =   285 bits (729),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLS+ +F+LS  + V I+Y+SSPEVNF ++I SR+  +  K VFRFL  D+ E ST
Sbjct  104  YAQHNLSISSFLLSAPKTVTIHYLSSPEVNFFRNIGSRLGRKGPKFVFRFLEKDDVEVST  163

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL  NL  IKTFASGILVPKSYIWPV+  S YL P TS+V DAHK GLEVYAS F
Sbjct  164  NQTYGSLAGNLTFIKTFASGILVPKSYIWPVE--SQYLLPHTSVVQDAHKAGLEVYASGF  221

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DP+AEYLSFIDNG++SVDGVLSDFP+T S A+DC+S++      QV +
Sbjct  222  ANDFDIAYNYSFDPLAEYLSFIDNGDFSVDGVLSDFPLTASSAVDCFSNLGTNASTQV-D  280

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FL+IS +GASGDYPGCTD AYSKA+ DG D+IDC+
Sbjct  281  FLIISKNGASGDYPGCTDLAYSKAIKDGADVIDCS  315



>emb|CDY45656.1| BnaC09g31980D [Brassica napus]
Length=653

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 166/215 (77%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLS+  F+LS+ + V INY+SSPEV FL+SI  R      K VFRFL  D+ E ST
Sbjct  74   YGQHNLSISKFLLSLPKTVTINYLSSPEVTFLQSIGGRFGKAGPKFVFRFLEKDDVEVST  133

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG+LL NL  IKTFASG+LVPKSYIWP++    YL P TS V DAHK GLEVYAS F
Sbjct  134  NQTYGTLLGNLTFIKTFASGVLVPKSYIWPLE--DQYLSPHTSFVQDAHKAGLEVYASGF  191

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  A++YS+DP+AEYLSF+DNG++SVDG LSDFP+T S A+DC+SH+      QV +
Sbjct  192  ANDLDMAYNYSFDPLAEYLSFMDNGDFSVDGFLSDFPLTASSAVDCFSHLGSNASTQV-D  250

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AYSKA+ DG DIIDC+
Sbjct  251  FLVISKNGASGDYPGCTDLAYSKAIKDGADIIDCS  285



>gb|EYU27402.1| hypothetical protein MIMGU_mgv1a001806mg [Erythranthe guttata]
Length=757

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 173/214 (81%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQHNLS+R+FV+S +RR+ ++YISSPEV FL+S  SR     TKL+F+FLG ++ E ST
Sbjct  182  YSQHNLSVRSFVISATRRMNVSYISSPEVGFLRSTVSRFRTGPTKLIFQFLGPNDIELST  241

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY SL +NL  IKTFASGILVPKSYIW VD S  YLQ  TSLVLDAH+  L+V+AS+F
Sbjct  242  NQTYSSLAKNLTFIKTFASGILVPKSYIWVVD-SGLYLQNYTSLVLDAHEASLQVFASNF  300

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDPVAEYLSFIDNG +SVDGVLSD PIT S  IDC+SH+ K +  QV E
Sbjct  301  ANDAFMAYNYSYDPVAEYLSFIDNGLFSVDGVLSDSPITASSTIDCHSHIAKNETAQV-E  359

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYPGCTD AY+KAVSDGVDI+DC
Sbjct  360  LLIISSEGASGDYPGCTDKAYAKAVSDGVDILDC  393



>ref|XP_006280048.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
 gb|EOA12946.1| hypothetical protein CARUB_v10025925mg [Capsella rubella]
Length=767

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLS+ +F+LS  + V I+Y+SSPEVNF ++I SR+  +  K VFRFL  D+ E ST
Sbjct  189  YAQHNLSISSFLLSAPKTVTIHYLSSPEVNFFRNIGSRLGRKGPKFVFRFLEKDDVEVST  248

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL  NL  IKTFASGILVPKSYIWPV+  S YL P TS+V DAHK GLEVYAS F
Sbjct  249  NQTYGSLAGNLTFIKTFASGILVPKSYIWPVE--SQYLLPHTSVVQDAHKAGLEVYASGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DP+AEYLSFIDNG++SVDGVLSDFP+T S A+DC+S++      QV +
Sbjct  307  ANDFDIAYNYSFDPLAEYLSFIDNGDFSVDGVLSDFPLTASSAVDCFSNLGTNASTQV-D  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FL+IS +GASGDYPGCTD AYSKA+ DG D+IDC+
Sbjct  366  FLIISKNGASGDYPGCTDLAYSKAIKDGADVIDCS  400



>ref|NP_200359.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
 sp|Q9FJ62.1|GPDL4_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL4; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
4; Short=ATGDPDL4; AltName: Full=Glycerophosphodiesterase-like 
1; AltName: Full=Protein SHV3-LIKE 1; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB08565.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94382.1| At5g55480 [Arabidopsis thaliana]
 gb|AAV59273.1| At5g55480 [Arabidopsis thaliana]
 gb|AED96633.1| putative glycerophosphoryl diester phosphodiesterase 1 [Arabidopsis 
thaliana]
Length=766

 Score =   285 bits (729),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 170/215 (79%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F+LS+S+ V+I+Y+SSPEVNF ++I  R      K VFRFL  D+ E ST
Sbjct  188  YAQHNLSMSSFLLSISKTVIIDYLSSPEVNFFRNIGRRFGRNGPKFVFRFLEKDDVEVST  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL  NL  +KTFASG+LVPKSYIWP++  S YL P TS V DAHK GLEVYAS F
Sbjct  248  NQTYGSLAGNLTFLKTFASGVLVPKSYIWPIE--SQYLLPRTSFVQDAHKAGLEVYASGF  305

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D   A++YS+DP+AEYLSF+DNG++SVDG+LSDFP+T S A+DC+SH+     +QV +
Sbjct  306  GNDFDLAYNYSFDPLAEYLSFMDNGDFSVDGLLSDFPLTASSAVDCFSHLGSNASSQV-D  364

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY+KA+ DG D+IDC+
Sbjct  365  FLVISKNGASGDYPGCTDLAYTKAIKDGADVIDCS  399



>ref|XP_010449676.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Camelina sativa]
 ref|XP_010449685.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Camelina sativa]
Length=767

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 171/215 (80%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLS+ +F+LS ++ V +NY+SSPEVNF ++I SR   +  K VFRFL  D+ E ST
Sbjct  189  YAQHNLSISSFLLSATKTVTVNYLSSPEVNFFRNIGSRFGRKGPKFVFRFLEKDDVEVST  248

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL  NL  IKTFASGILVPKSYIWPV+  S YL P TS+V DAHK GLEVYAS F
Sbjct  249  NQTYGSLAGNLTFIKTFASGILVPKSYIWPVE--SQYLLPHTSVVQDAHKAGLEVYASGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DP+AEYLSF+DNG++SVDG++SDFP+T S A+DC+SH+      QV +
Sbjct  307  ANDFDIAYNYSFDPLAEYLSFVDNGDFSVDGLVSDFPLTASSAVDCFSHLGTNASTQV-D  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AYSKA+ DG D+I+C+
Sbjct  366  FLVISKNGASGDYPGCTDLAYSKAIKDGADVINCS  400



>ref|XP_004294052.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Fragaria vesca subsp. vesca]
Length=753

 Score =   284 bits (726),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 177/215 (82%), Gaps = 4/215 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +SQHNLSMR +VLSVS++VV+N+ISSPEV+FL SI +R++P  TKL+F+FL   E EPST
Sbjct  176  FSQHNLSMRNYVLSVSKKVVVNFISSPEVDFLNSIKARVSPTTTKLIFKFLDEAEIEPST  235

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGI+VPK+YIWPV    +YL+P TS+V DAHK GL V+AS+ 
Sbjct  236  NQTYGSLLKNLTFIKTFASGIIVPKTYIWPV-TVDNYLKPHTSIVSDAHKAGLTVFASEL  294

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +DVPF F+YSYDPV+EYLSF DNG++SVDGVLSDFP+TPS AIDCY+H  K     VP 
Sbjct  295  YNDVPFPFNYSYDPVSEYLSFFDNGDFSVDGVLSDFPLTPSAAIDCYAHPEKNA--SVPA  352

Query  542  F-LVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              LVIS DGASGDYPGCTD AY  A++DGVD++DC
Sbjct  353  TPLVISKDGASGDYPGCTDLAYMHAITDGVDVLDC  387



>ref|XP_009120058.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=768

 Score =   284 bits (726),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 166/215 (77%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLS+  F+LS+ + V INY+SSPEV FL+SI  R      K VFRFL  D+ E ST
Sbjct  189  YAQHNLSISKFMLSLPKTVTINYLSSPEVTFLRSIGGRFGKAGPKFVFRFLEKDDVEVST  248

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG+LL NL  IKTFASG+LVPKSYIWP++    YL P TS V DAHK GLEVYAS F
Sbjct  249  NQTYGTLLGNLTFIKTFASGVLVPKSYIWPLE--DQYLSPHTSFVQDAHKAGLEVYASGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DP+AEYLSF+DNG++SVDG LSDFP+T S A+DC+SH+      QV +
Sbjct  307  ANDFDMAYNYSFDPLAEYLSFMDNGDFSVDGFLSDFPLTASSAVDCFSHLGSNASTQV-D  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AYSKA+ DG DIIDC+
Sbjct  366  FLVISKNGASGDYPGCTDLAYSKAIKDGADIIDCS  400



>emb|CDY17323.1| BnaA10g09570D [Brassica napus]
Length=768

 Score =   284 bits (726),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 166/215 (77%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLS+  F+LS+ + V INY+SSPEV FL+SI  R      K VFRFL  D+ E ST
Sbjct  189  YAQHNLSISKFLLSLPKTVTINYLSSPEVTFLRSIGGRFGKAGPKFVFRFLEKDDVEVST  248

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG+LL NL  IKTFASG+LVPKSYIWP++    YL P TS V DAHK GLEVYAS F
Sbjct  249  NQTYGTLLGNLTFIKTFASGVLVPKSYIWPLE--DQYLSPHTSFVQDAHKAGLEVYASGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DP+AEYLSF+DNG++SVDG LSDFP+T S A+DC+SH+      QV +
Sbjct  307  ANDFDMAYNYSFDPLAEYLSFMDNGDFSVDGFLSDFPLTASSAVDCFSHLGSNASTQV-D  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AYSKA+ DG DIIDC+
Sbjct  366  FLVISKNGASGDYPGCTDLAYSKAIKDGADIIDCS  400



>ref|XP_010433460.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Camelina 
sativa]
Length=661

 Score =   281 bits (719),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 168/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+Q NLSM +F+++ S+ V+I++ISSPEVNF K IA R   +    VFRFLG +E EP+T
Sbjct  179  YAQQNLSMSSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRKGPSFVFRFLGQEEFEPTT  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSY+ P+D     L P TSLV DAHK GLEV+ S F
Sbjct  239  NRTYGSILSNLTFVKTFASGILVPKSYVLPLDDKQYLLAP-TSLVQDAHKAGLEVFVSGF  297

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYS+DPV+EYLSF+DN N+SVDGVLSDFPIT S + DC+SH+ +  KNQV +
Sbjct  298  ANDVDIAHDYSFDPVSEYLSFVDNANFSVDGVLSDFPITASASRDCFSHVGRKAKNQV-D  356

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  357  FLVISKNGASGDYPGCTDVAYEKAIKDGADVIDCS  391



>ref|XP_010252664.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Nelumbo nucifera]
Length=756

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 171/214 (80%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            + QHNLSMR+FVLSVSRRV ++YISSPEV FLKSI ++     TKLVFRFL  D+ EP+T
Sbjct  181  FKQHNLSMRSFVLSVSRRVNVSYISSPEVAFLKSITTQFKRSTTKLVFRFLRADDIEPTT  240

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL  +KTFAS IL+PK+YIWPV ++  YLQP TS+VL+AH  GLEV+ASDF
Sbjct  241  NQTYGSILKNLTFVKTFASAILIPKNYIWPV-RTDLYLQPHTSVVLNAHGEGLEVFASDF  299

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDPV EYLSFIDNG +SVDG+LSDFP+T S AIDC++H+      +VP 
Sbjct  300  ANDGLISYNYSYDPVKEYLSFIDNGKFSVDGILSDFPVTASEAIDCFAHVSTNSSGKVP-  358

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS++GASG YPG TD AY +A  DG D+IDC
Sbjct  359  -LIISYNGASGIYPGSTDIAYMQAFDDGADVIDC  391



>ref|NP_001047275.1| Os02g0588500 [Oryza sativa Japonica Group]
 dbj|BAD17453.1| putative GPI-anchored protein [Oryza sativa Japonica Group]
 dbj|BAF09189.1| Os02g0588500 [Oryza sativa Japonica Group]
 gb|EAZ23618.1| hypothetical protein OsJ_07316 [Oryza sativa Japonica Group]
Length=749

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 173/214 (81%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSMR+++LSVS++ + +YISSPEVNFL S++ R+N + TKLVFR L     EPST
Sbjct  177  YSQFNLSMRSYILSVSKQYIADYISSPEVNFLTSLSGRVNKK-TKLVFRLLNELAVEPST  235

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL  IKTFASGILVPK+YIWPV + + YLQP+TS+V DAHK GLEVYA+DF
Sbjct  236  NQTYGSMLKNLTFIKTFASGILVPKNYIWPVTQDN-YLQPSTSVVGDAHKAGLEVYAADF  294

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP+ EYL+FIDNG +SVDGVL+DFPITPS AI C+S++   + +    
Sbjct  295  ANDFLLSYNYSYDPLTEYLNFIDNGAFSVDGVLTDFPITPSEAIGCFSNLNNSKTDNAKP  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD AY KAV+DG D+IDC
Sbjct  355  -LIISHNGASGDYPDCTDLAYQKAVTDGADVIDC  387



>ref|XP_006297062.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
 gb|EOA29960.1| hypothetical protein CARUB_v10013062mg [Capsella rubella]
Length=729

 Score =   281 bits (719),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQHN++MR FV+S+S+RV   +ISSPE+ FLKS+ +     VTKL+FRFL  D+ EP T
Sbjct  158  YSQHNMNMRNFVVSISKRVRFKFISSPEITFLKSMKNSAKRTVTKLIFRFLNQDQIEPFT  217

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+YGSL +NL+ I+TF+SGILVPKSYIWPVD S  YLQP TSLV DAHK GL+V+AS+F
Sbjct  218  NQSYGSLSKNLSYIRTFSSGILVPKSYIWPVD-SYLYLQPHTSLVTDAHKEGLQVFASEF  276

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP AEYLSFIDNGN+SVDG LSDFP+TP  AI+C+SH+   +     +
Sbjct  277  ANDFVIAYNYSYDPTAEYLSFIDNGNFSVDGFLSDFPVTPYRAINCFSHVDTKKAEDQAK  336

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +IS +GASG +PGCTD AY +A  DGVDI+DC
Sbjct  337  VTIISKNGASGYFPGCTDLAYQRAADDGVDILDC  370



>ref|XP_006283180.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
 gb|EOA16078.1| hypothetical protein CARUB_v10004210mg [Capsella rubella]
Length=757

 Score =   281 bits (720),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 168/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F+++ S+ V I++ISSPEVNF + IA R        VFRFLG +E EP+T
Sbjct  180  YAQHNLSMSSFLIAASKTVPIDFISSPEVNFFRKIAGRFGRNGPSFVFRFLGQEEFEPTT  239

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK+GLEV+ S F
Sbjct  240  NRTYGSILSNLTFVKTFASGILVPKSYILPLDD-QLYLLPPTSLVQDAHKLGLEVFVSGF  298

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYS+DPV+EYLSF+DNGN+SVDGVLSDFPIT S + DC+SH+ +    QV +
Sbjct  299  ANDVDIAHDYSFDPVSEYLSFVDNGNFSVDGVLSDFPITASASRDCFSHIGRNATKQV-D  357

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  358  FLVISKNGASGDYPGCTDLAYEKAIKDGADVIDCS  392



>ref|XP_009417318.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=753

 Score =   281 bits (718),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 167/214 (78%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSMR +VLSVS+RV++NY+SSPE+ FL  IA R     TKL+FRFLG D TEPST
Sbjct  176  YRQHNLSMRNYVLSVSKRVIVNYLSSPELAFLSGIAPRFRNTKTKLIFRFLGKDTTEPST  235

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG LL NL  IKTFASGILVPK+YIWP   S +YL+P TS+V DA K GLEVYA+DF
Sbjct  236  NQTYGLLLNNLTFIKTFASGILVPKNYIWPT-TSDNYLRPYTSIVTDAQKSGLEVYAADF  294

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F+++YSYDP+AE LSFIDNG +SVDGV++DFP+TPS AI C+S + K   +   +
Sbjct  295  ANDYLFSYNYSYDPLAECLSFIDNGFFSVDGVVTDFPVTPSVAIGCFSQLNKSSIDH-GK  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDY  CTD AY KAV DG D+IDC
Sbjct  354  PLIISHNGASGDYADCTDLAYQKAVDDGADVIDC  387



>ref|XP_004150252.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 ref|XP_004163282.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Cucumis sativus]
 gb|KGN59083.1| Glycerophosphoryl diester phosphodiesterase [Cucumis sativus]
Length=764

 Score =   281 bits (719),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 172/216 (80%), Gaps = 6/216 (3%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSV--SRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            ++QHN+SMR FVLSV  +R  ++NYISSPEV FL+SIA+R+ PR TKL+ RFLG  + E 
Sbjct  181  FTQHNVSMRNFVLSVIRTRSTIVNYISSPEVGFLRSIAARV-PRTTKLILRFLGPTDREI  239

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            +TNQTY SL QNL  IKTFASGILVPK+YIWP +   SYLQ  TSLV DAHK  LEV+AS
Sbjct  240  TTNQTYDSLKQNLTFIKTFASGILVPKTYIWPTE--DSYLQAQTSLVSDAHKAQLEVFAS  297

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
            DF SD+P  ++YSYDPVAEYLS+ DNG +SVDGVLSDFPITPS AI C++H+ K  K+Q 
Sbjct  298  DFYSDLPLPYNYSYDPVAEYLSYFDNGKFSVDGVLSDFPITPSSAIACFAHLGKNAKSQ-  356

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             + LVIS  GASGD+P CTD AY+ A+SDGV+++DC
Sbjct  357  DKPLVISKFGASGDFPACTDLAYTNAISDGVEVLDC  392



>ref|XP_008806340.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=808

 Score =   282 bits (721),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 166/214 (78%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSMR++VLSV +RV++NYISSPEVNFL SI  R     TKLVFRFL  D  EPST
Sbjct  230  YQQHNLSMRSYVLSVFKRVIVNYISSPEVNFLTSIEKRFRQSTTKLVFRFLNEDIAEPST  289

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY  LL+NL  IKTFASGILVPK YIWPV    +YLQP TS+V+DAHK GLE++A+DF
Sbjct  290  NQTYSLLLKNLTFIKTFASGILVPKHYIWPV-TPDNYLQPYTSIVMDAHKAGLEIFAADF  348

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP++EYL FIDNG +SVDGVL+DFPITPS  + C+SH+ K   +    
Sbjct  349  ANDNIISYNYSYDPLSEYLYFIDNGFFSVDGVLTDFPITPSEVVACFSHINKSSIDH-GR  407

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS  GASGDYP CTD AY KAV+DG D+IDC
Sbjct  408  PLIISHYGASGDYPDCTDLAYQKAVNDGADVIDC  441



>ref|XP_010448228.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   281 bits (718),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 168/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+Q NLSM +F+++ S+ V I++ISSPEVNF K IA R   +    VFRFLG +E EP+T
Sbjct  179  YAQQNLSMSSFLVAASKTVFIDFISSPEVNFFKKIAGRFGRKGPSFVFRFLGQEEFEPTT  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSY+ P+D+    L P TSLV DAHK GLEV+ S F
Sbjct  239  NRTYGSILSNLTFVKTFASGILVPKSYVLPLDEEQYLLAP-TSLVQDAHKAGLEVFVSGF  297

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYS+DPV+EYLSF+DN N+SVDGVLSDFPIT S + DC+SH+ +  KNQV +
Sbjct  298  ANDVDIAHDYSFDPVSEYLSFMDNANFSVDGVLSDFPITASASRDCFSHVGRKAKNQV-D  356

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  357  FLVISKNGASGDYPGCTDVAYEKAIKDGADVIDCS  391



>gb|KHN28413.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Glycine 
soja]
Length=761

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 171/214 (80%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y++HNLSM+ ++LSVSR V ++YISSPE  FL+SI ++IN R TKLVFRFL  ++ +PST
Sbjct  183  YTKHNLSMKNYILSVSRTVNVSYISSPEAGFLRSIRTQINQRKTKLVFRFLKKNDVDPST  242

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            +  YGSLL+NL SIK FASGILVPK YIWPV  ++ YL   TSLV DAHKVGLEV+ASDF
Sbjct  243  SLMYGSLLKNLTSIKAFASGILVPKEYIWPVHPTNLYLLSHTSLVSDAHKVGLEVFASDF  302

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D+P +F+YSYDPVAEYL+FIDN N+SVDGVLSDFP+T S AIDC++H+      +V +
Sbjct  303  QNDIPISFNYSYDPVAEYLNFIDNENFSVDGVLSDFPLTSSEAIDCFAHVGLNATKKV-K  361

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS  GASGDYP CT+ AY  ++SDG DI+DC
Sbjct  362  TLVISKYGASGDYPPCTNLAYENSISDGADILDC  395



>ref|XP_010438711.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Camelina sativa]
Length=757

 Score =   280 bits (717),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 169/215 (79%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+Q NLSM +F+++ S+ V+I++ISSPEVNF K IA R   +    VFRFLG +E EP+T
Sbjct  179  YAQQNLSMSSFLVAASKTVLIDFISSPEVNFFKKIAGRFGRKGPSFVFRFLGQEEFEPTT  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSY+ P+D+    L P TSLV DAHK GLEV+ S F
Sbjct  239  NRTYGSILSNLTFVKTFASGILVPKSYVLPLDEEQYLLAP-TSLVQDAHKAGLEVFVSGF  297

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYS+DPV+EYLSF+DN N+SVDGVLSDFPIT S + +C+SH+ +  KNQV +
Sbjct  298  ANDVDIAHDYSFDPVSEYLSFMDNANFSVDGVLSDFPITASASRNCFSHVGRKAKNQV-D  356

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  357  FLVISKNGASGDYPGCTDVAYEKAIKDGADVIDCS  391



>ref|XP_002452366.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
 gb|EES05342.1| hypothetical protein SORBIDRAFT_04g024440 [Sorghum bicolor]
Length=753

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 171/214 (80%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ  LSMR+++LS+ +  V++YISSPEVNFL SI+ R++ + TKLVFRFL     EPST
Sbjct  182  YSQFKLSMRSYILSLLKNFVVDYISSPEVNFLTSISGRVSKK-TKLVFRFLDERSIEPST  240

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL  +KTFASGILVPKSYIWPV    +YL P TS+V DAHK GLE+YA+DF
Sbjct  241  NQTYGSMLKNLTFVKTFASGILVPKSYIWPV-TPDNYLLPYTSVVDDAHKAGLEIYAADF  299

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP+AEYLSFIDNG +SVDGVLSDFPITPS A+DC+S++   + +    
Sbjct  300  ANDFTISYNYSYDPLAEYLSFIDNGAFSVDGVLSDFPITPSEAVDCFSNLNNSKIDHAKP  359

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY KAV+DG D+IDC
Sbjct  360  -LVISHNGASGDYPDCTDQAYEKAVADGADVIDC  392



>emb|CDX94294.1| BnaC01g18900D [Brassica napus]
Length=757

 Score =   280 bits (716),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 170/215 (79%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM  F++SV++ V++++ISSPEVNF + IA R        VFRFL  ++ EP+T
Sbjct  179  YAQHNLSMSNFLISVTKTVIVDFISSPEVNFFRKIAGRFGREGPSFVFRFLEKEQFEPTT  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S F
Sbjct  239  NRTYGSILSNLTFVKTFASGILVPKSYVLPLDDKQ-YLLPSTSLVQDAHKAGLEVFVSGF  297

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYS+DPV+EYLSF+DNGN+SVDGVLSDFPIT S +++C+SH+ +    QV +
Sbjct  298  ANDVDIAHDYSFDPVSEYLSFMDNGNFSVDGVLSDFPITASASVECFSHVARNATKQV-D  356

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCT+ AY KA++DG D+IDC+
Sbjct  357  FLVISKNGASGDYPGCTNLAYEKAINDGADVIDCS  391



>ref|XP_009415406.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=760

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/214 (65%), Positives = 170/214 (79%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM  +VLSVS+RV +NY+SSPE+ FL SIA+  +   TKLVFRFLG D  EPST
Sbjct  182  YGQHNLSMTEYVLSVSKRVPVNYLSSPELAFLSSIAADFSNSDTKLVFRFLGKDIAEPST  241

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            +QTYGSLL NL  IKTF SGILVPKSYIWPV  + +YL P TS+V DAHK+GLE+YA+DF
Sbjct  242  SQTYGSLLNNLTYIKTFVSGILVPKSYIWPV-TADNYLLPYTSIVKDAHKLGLEIYAADF  300

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F+++YSYDP+AEYLSF+DNG +SVDGV++DFPITPS AI C+SH+ K   +   +
Sbjct  301  ANDNTFSYNYSYDPLAEYLSFVDNGVFSVDGVVTDFPITPSEAIGCFSHINKSVIDH-GK  359

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD +Y KAV DG D IDC
Sbjct  360  PLIISHNGASGDYPDCTDWSYQKAVDDGSDFIDC  393



>emb|CDX89312.1| BnaA01g15810D [Brassica napus]
Length=757

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 170/215 (79%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM  F++SV++ V++++ISSPEVNF + IA R        VFRFL  ++ EP+T
Sbjct  179  YAQHNLSMSNFLVSVTKTVIVDFISSPEVNFFRKIAGRFGREGPSFVFRFLEKEQFEPTT  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S F
Sbjct  239  NRTYGSILSNLTFVKTFASGILVPKSYVLPLDDKQ-YLLPSTSLVQDAHKAGLEVFVSGF  297

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYS+DPV+EYLSF+DNGN+SVDGVLSDFPIT S +++C+SH+ +    QV +
Sbjct  298  ANDVDIAHDYSFDPVSEYLSFMDNGNFSVDGVLSDFPITASASVECFSHVARNATKQV-D  356

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCT+ AY KA++DG D+IDC+
Sbjct  357  FLVISKNGASGDYPGCTNLAYEKAINDGADVIDCS  391



>ref|XP_009142640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=757

 Score =   280 bits (715),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 170/215 (79%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM  F++SV++ V++++ISSPEVNF + IA R        VFRFL  ++ EP+T
Sbjct  179  YAQHNLSMSNFLVSVTKTVIVDFISSPEVNFFRKIAGRFGREGPSFVFRFLEKEQFEPTT  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S F
Sbjct  239  NRTYGSILSNLTFVKTFASGILVPKSYVLPLDDKQ-YLLPSTSLVQDAHKAGLEVFVSGF  297

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYS+DPV+EYLSF+DNGN+SVDGVLSDFPIT S +++C+SH+ +    QV +
Sbjct  298  ANDVDIAHDYSFDPVSEYLSFMDNGNFSVDGVLSDFPITASASVECFSHVARNATKQV-D  356

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCT+ AY KA++DG D+IDC+
Sbjct  357  FLVISKNGASGDYPGCTNLAYEKAINDGADVIDCS  391



>ref|XP_004975931.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=747

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 172/214 (80%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSMR +++SVS+RVV+NYISSPEV+FL S+  R++ + TKLVFR+L     EPS 
Sbjct  175  YSQFNLSMRNYIISVSKRVVVNYISSPEVSFLTSVLGRVSKK-TKLVFRYLDESTLEPSM  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL  +KTFASGILVPKSYIWP   + +YLQP TS+V DAHK GLE+YA+DF
Sbjct  234  NQTYGSMLKNLTFVKTFASGILVPKSYIWPT-SADNYLQPHTSVVNDAHKAGLEIYAADF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP+AE L+FIDNG +SVDGVL+DFP+TPS AI C++++ K   +   +
Sbjct  293  ANDFMISYNYSYDPLAECLTFIDNGVFSVDGVLTDFPVTPSEAIGCFTNLNKSNTDH-GK  351

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYPGCTD AY KAV DG D+IDC
Sbjct  352  PLIISHNGASGDYPGCTDLAYQKAVDDGADVIDC  385



>gb|KFK29182.1| hypothetical protein AALP_AA7G100300 [Arabis alpina]
Length=758

 Score =   279 bits (714),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 167/216 (77%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM  F+LS S+  +I++ISSPEVNF K IA R   +    VFRFLG +E EP+T
Sbjct  179  YAQHNLSMSNFLLSASKTAIIDFISSPEVNFFKKIAGRFGRKGPTFVFRFLGTEEFEPTT  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYL-QPTTSLVLDAHKVGLEVYASD  358
            NQTYGS+L NL  +KTFAS ILVPKSY+ PV K   YL  P  SLV DAHK GLEV+ S 
Sbjct  239  NQTYGSILSNLTFVKTFASAILVPKSYVLPVAK--QYLVPPPRSLVQDAHKAGLEVFVSG  296

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
            FA+DV  A+DYS+DPV+EYLSF+DNGN+SVDGVL+DFPIT S ++ C+SH+ +    QV 
Sbjct  297  FANDVDIAYDYSFDPVSEYLSFVDNGNFSVDGVLTDFPITASASVACFSHIGRNATKQV-  355

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            +FLVIS +GASGDYPGCTD AY+KA+ DG D+IDC+
Sbjct  356  DFLVISKNGASGDYPGCTDLAYAKAIKDGADVIDCS  391



>gb|EPS69135.1| glycerophosphodiesterase-like protein, partial [Genlisea aurea]
Length=689

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 169/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            +S+H LSMR+F++SVSR V+INYISSPE+ FL S+ASR+    TKLVFRFLG D+ EP+T
Sbjct  141  FSEHKLSMRSFIISVSRDVIINYISSPEIGFLHSVASRLT-NSTKLVFRFLGPDDVEPTT  199

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TY SLL NL  I TFASGILVPK+YIWPV+ SS YL   TSLV DAHK GLEVYASDF
Sbjct  200  NETYSSLLSNLTLIGTFASGILVPKTYIWPVN-SSRYLLNYTSLVSDAHKAGLEVYASDF  258

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    F++ YDPV+EYLS+ DNG +SVDGV+SDFPITPS AI C+SH+ +    +V  
Sbjct  259  ANDGDLPFNFYYDPVSEYLSYFDNGVFSVDGVISDFPITPSAAIGCFSHLGRNAAIEV-N  317

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASG YPGCTD AY +A +DG D++DC
Sbjct  318  ILVISNEGASGIYPGCTDKAYEQAAADGADVLDC  351



>ref|XP_006413151.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
 gb|ESQ54604.1| hypothetical protein EUTSA_v10024494mg [Eutrema salsugineum]
Length=757

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 167/215 (78%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y++HNLSM +F++S S+ V+I++ISSPEVNF + IA R        VFRFL  +E EP+T
Sbjct  178  YAEHNLSMSSFLVSASKTVIIDFISSPEVNFFRKIAGRFGRNGPSFVFRFLEKEEFEPTT  237

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P++     L  T+SLV DAHK GLEV+AS F
Sbjct  238  NRTYGSILSNLTFVKTFASGILVPKSYILPLNDEQYLLPQTSSLVQDAHKAGLEVFASGF  297

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYSYDPV+EYLSF+DNGN+SVDGVLSDFPIT S ++DC+SHM +    QV +
Sbjct  298  ANDVDIAHDYSYDPVSEYLSFVDNGNFSVDGVLSDFPITASASVDCFSHMGRNATKQV-D  356

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLV+S +GASGDYP CT+ AY KA+ DG D+IDC+
Sbjct  357  FLVMSKNGASGDYPACTNLAYQKAIKDGADVIDCS  391



>emb|CDY11996.1| BnaC03g14220D [Brassica napus]
Length=773

 Score =   279 bits (713),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 167/214 (78%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F+LSVS+ V+I+Y+SSPEV+F ++I +R      K VFRFL  D+ E ST
Sbjct  190  YTQHNLSMSSFLLSVSKTVIIDYLSSPEVSFFRNIGARFGKTGPKFVFRFLDKDDVEVST  249

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG+L++NL  IKTFASG+LVPKSYIWPV     YL P TS V DAHK GLEVYAS F
Sbjct  250  NQTYGALMRNLTFIKTFASGVLVPKSYIWPV--KDQYLLPHTSFVRDAHKAGLEVYASGF  307

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP+ EYLSF+DNG++SVDG LSDFP+T S A+DC+SH+      QV +
Sbjct  308  ANDFDIAYNYSYDPLTEYLSFMDNGDFSVDGFLSDFPLTASSAVDCFSHLGSNASTQV-D  366

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            FLVIS +GA+GDYPG TD AY+KA+ DG DIIDC
Sbjct  367  FLVISKNGANGDYPGSTDLAYTKAIKDGADIIDC  400



>emb|CDY72472.1| BnaAnng41260D, partial [Brassica napus]
Length=376

 Score =   268 bits (685),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            + Q NLSM  F++S SR V INYISSPEVNF   I+ R        VF+FL  ++ EP+T
Sbjct  51   FEQQNLSMSKFLISASRIVSINYISSPEVNFFTKISGRFGRNGPLFVFQFLRKEDIEPTT  110

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L NL  +KTFASGILVPKSYI P+D     + P  SLV DAHK GL+VY S F
Sbjct  111  NQTYGSILSNLTFVKTFASGILVPKSYILPLDDKQYLVPPPKSLVQDAHKAGLQVYVSGF  170

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  A DYS DPV+EYLSF+DNGN+SVDGVLSDFP+T S +IDC+SH+ +    QV  
Sbjct  171  ANDIDIAHDYSSDPVSEYLSFVDNGNFSVDGVLSDFPLTASSSIDCFSHLGQNAIKQV-N  229

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  230  FLVISKNGASGDYPGCTDLAYDKAIKDGADVIDCS  264



>gb|EMS62136.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=748

 Score =   278 bits (711),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 171/214 (80%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSMR+++LS+S++  ++YISSPEV+FLKS+  R+  R TKLVFRFL     EPST
Sbjct  175  YSQFNLSMRSYILSMSKQYTVDYISSPEVSFLKSLVGRVG-RKTKLVFRFLDEGLVEPST  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL+SIKTFASGILVPK YIWPV  + +YLQP+TS+V DAHK GLE+YA+DF
Sbjct  234  NQTYGSMLKNLSSIKTFASGILVPKHYIWPV-TADNYLQPSTSVVDDAHKAGLEIYAADF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP+AEYL FIDNG + VDG+L+DFPITP  AI C+S++   + +    
Sbjct  293  ANDFALSYNYSYDPLAEYLRFIDNGAFCVDGLLTDFPITPLEAIGCFSNLNNTKADHGAP  352

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  353  -LVISHNGASGDYPDCTDLAYQKAVVDGADVIDC  385



>ref|XP_006344951.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2-like, partial [Solanum tuberosum]
Length=397

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 163/216 (75%), Gaps = 17/216 (8%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            ++QHNLSMR +++ +SR V+INYISSPEV FL +I +R NPR TKLVF FLG D+ E S 
Sbjct  147  FTQHNLSMRNYIIFISRNVLINYISSPEVTFLTNIVARFNPRFTKLVFLFLGQDDVESSI  206

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL N+  IKTFASGILVPKS IWPVD +S YLQP TSLVLDAHK  LE++AS+F
Sbjct  207  NQTYGSLLNNVTFIKTFASGILVPKSCIWPVD-NSHYLQPYTSLVLDAHKECLEIFASEF  265

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV FA +YSYDP +EYLS IDN  +SVDGVL DFP+T S  I+              +
Sbjct  266  ANDVHFAXNYSYDPTSEYLSLIDNDVFSVDGVLYDFPVTASATIE--------------K  311

Query  542  FLVISFDGASGDY--PGCTDXAYSKAVSDGVDIIDC  643
             L+I+ +GASGDY  PGCTD  Y+KAVSDG D++DC
Sbjct  312  LLIITSEGASGDYSAPGCTDMVYTKAVSDGADVLDC  347



>gb|KFK39359.1| hypothetical protein AALP_AA3G234500 [Arabis alpina]
Length=752

 Score =   277 bits (709),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 168/214 (79%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR  V+S+S+R+  N+ISSPE++FL+S+ + + PRVTKL+F+FL  D+ +P T
Sbjct  160  YAQHNLSMRNTVVSLSKRIKFNFISSPEISFLQSMKNSVKPRVTKLIFKFLDQDQIDPFT  219

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N++YGSL +NL+ I+TF+SGILVPKSYIWPV  S  YL+P TSLV DAHK GL+V+AS+F
Sbjct  220  NKSYGSLAKNLSYIRTFSSGILVPKSYIWPV-SSDHYLRPHTSLVTDAHKEGLQVFASEF  278

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDP AEYLSFIDNGN+SVDG LSDFP+TP  AI C+SH+ K +      
Sbjct  279  ANDFLIPYNYSYDPTAEYLSFIDNGNFSVDGFLSDFPVTPYRAISCFSHLDKKKATDDAN  338

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +IS +GASGD+P CTD AY +A  DG DI+DC
Sbjct  339  ITIISNNGASGDFPDCTDLAYQRAAIDGADILDC  372



>ref|XP_009137609.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=759

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 169/218 (78%), Gaps = 5/218 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGND---ETE  172
            Y+QHNLSM TF+ + S+ V+I++ISSPEVNF K IA R        VFRFL  +   + E
Sbjct  175  YAQHNLSMTTFLTTASKTVIIDFISSPEVNFFKKIAGRFGREGPIFVFRFLEKETXEQFE  234

Query  173  PSTNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYA  352
            P+TN++YGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ 
Sbjct  235  PTTNRSYGSILSNLTFVKTFASGILVPKSYVLPLD-DKQYLLPSTSLVQDAHKAGLEVFV  293

Query  353  SDFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ  532
            S FA+DV  A DYSYDPV+EYLSF+DNGN+SVDGVLSDFPI+ S +++C+SHM +    Q
Sbjct  294  SGFANDVDIAHDYSYDPVSEYLSFVDNGNFSVDGVLSDFPISASASVECFSHMGRNATKQ  353

Query  533  VPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            V +FLVIS +GASGDYPGCTD AY+KA+ DG D+IDC+
Sbjct  354  V-DFLVISKNGASGDYPGCTDLAYAKAIKDGADVIDCS  390



>emb|CDY14478.1| BnaC03g21170D [Brassica napus]
Length=1314

 Score =   283 bits (723),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+Q NLSM +F++S SR V I+Y+SSPEVNF K IA    P     VF+FLG +E EP+T
Sbjct  214  YAQQNLSMSSFLISASRNVSIDYVSSPEVNFFKKIAGDFGPNGPSFVFQFLGKEEFEPTT  273

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S F
Sbjct  274  NRTYGSILSNLTFVKTFASGILVPKSYILPLD-DKQYLLPPTSLVQDAHKAGLQVYVSGF  332

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  A DYS+DPV EYLSF+DNGN+SVDGVLSDFPIT S +I+C+SH+ K    QV +
Sbjct  333  ANDIDIAHDYSFDPVTEYLSFVDNGNFSVDGVLSDFPITASSSIECFSHLGKNATKQV-D  391

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  392  FLVISKNGASGDYPGCTDMAYDKAIKDGADVIDCS  426



>ref|NP_176869.2| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 sp|Q7Y208.2|GPDL1_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL1; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
1; Short=ATGDPDL1; AltName: Full=Glycerophosphodiesterase-like 
3; AltName: Full=Protein SHV3-LIKE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF98209.1|AC007152_5 Unknown protein [Arabidopsis thaliana]
 gb|AEE34579.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=763

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NLSM +F+LSVSR V I++ISSPEVNF K I           VF+FLG ++ EP+T
Sbjct  188  YEQQNLSMSSFLLSVSRTVSIDFISSPEVNFFKKITGSFGRNGPTFVFQFLGKEDFEPTT  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S F
Sbjct  248  NRTYGSILSNLTFVKTFASGILVPKSYILPLDDEQ-YLVPHTSLVQDAHKAGLQVYVSGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A++YS DPV+EYLSF+DNG++SVDGVLSDFPIT S A+DC+SH+ +    QV +
Sbjct  307  ANDVDIAYNYSSDPVSEYLSFVDNGDFSVDGVLSDFPITASAAVDCFSHIGRNATKQV-D  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS DGASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  366  FLVISKDGASGDYPGCTDLAYEKAIKDGADVIDCS  400



>gb|AAP40466.1| unknown protein [Arabidopsis thaliana]
Length=763

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NLSM +F+LSVSR V I++ISSPEVNF K I           VF+FLG ++ EP+T
Sbjct  188  YEQQNLSMSSFLLSVSRTVSIDFISSPEVNFFKKITGSFGRNGPTFVFQFLGKEDFEPTT  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S F
Sbjct  248  NRTYGSILSNLTFVKTFASGILVPKSYILPLDDEQ-YLVPHTSLVQDAHKAGLQVYVSGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A++YS DPV+EYLSF+DNG++SVDGVLSDFPIT S A+DC+SH+ +    QV +
Sbjct  307  ANDVDIAYNYSSDPVSEYLSFVDNGDFSVDGVLSDFPITASAAVDCFSHIGRNATKQV-D  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS DGASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  366  FLVISKDGASGDYPGCTDLAYEKAIKDGADVIDCS  400



>ref|XP_002867546.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43805.1| MRH5/SHV3 [Arabidopsis lyrata subsp. lyrata]
Length=756

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 167/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+Q NLSM +F+++ S+ V I++ISSPEVNF + I+ R       LVFRFL  +E EP+T
Sbjct  179  YAQQNLSMSSFLIAASKTVPIDFISSPEVNFFRKISGRFGRNGPSLVFRFLRQEEFEPTT  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GLEV+ S F
Sbjct  239  NRTYGSILSNLTFVKTFASGILVPKSYILPLDDQQ-YLLPPTSLVQDAHKAGLEVFVSGF  297

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  A DYS+DPV+EYLSF+DNGN+SVDGVL+DFPIT S ++DC+SH+ +    QV +
Sbjct  298  ANDIDIAHDYSFDPVSEYLSFVDNGNFSVDGVLTDFPITASASLDCFSHIGRNATKQV-D  356

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  357  FLVISKNGASGDYPGCTDVAYEKAIKDGADVIDCS  391



>ref|XP_006391459.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
 gb|ESQ28745.1| hypothetical protein EUTSA_v10018170mg [Eutrema salsugineum]
Length=763

 Score =   277 bits (708),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F++S SR V I+YISSPE+NF + +A R        VFRFLG ++ EP+T
Sbjct  185  YEQHNLSMSSFLISASRTVSIDYISSPELNFFRKVAGRFGRDGPIFVFRFLGKEDFEPTT  244

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S F
Sbjct  245  NRTYGSILSNLTFVKTFASGILVPKSYILPLDD-KQYLLPPTSLVQDAHKAGLKVYVSGF  303

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A+ YS+DPV+EYLSF+DNG +SVDGVLSDFPIT S +I+C+SH+ +    QV +
Sbjct  304  ANDVDIAYTYSFDPVSEYLSFVDNGYFSVDGVLSDFPITASASIECFSHISRNATKQV-D  362

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  363  FLVISKNGASGDYPGCTDLAYEKAIQDGADVIDCS  397



>emb|CDY29432.1| BnaC05g32380D, partial [Brassica napus]
Length=596

 Score =   273 bits (698),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 161/214 (75%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR FVLS+S  + IN+ISSP+++FLKS+     P  TKL+FRFL  D+ +P T
Sbjct  26   YTQHNLSMRNFVLSLSSHMKINFISSPDISFLKSVKKDFKPTKTKLIFRFLSQDQIDPFT  85

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+Y SL +NL  IKTFASGILVPKSYIWP+  S  YLQP TSLV DAH  GL+V+AS+F
Sbjct  86   NQSYASLAKNLTFIKTFASGILVPKSYIWPLS-SDLYLQPHTSLVTDAHGQGLQVFASEF  144

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP  EYL FIDNGN+SVDG LSDFP+TP  AI+C+SH+ K    +   
Sbjct  145  ANDAVSAYNYSYDPTNEYLYFIDNGNFSVDGFLSDFPVTPYRAINCFSHLDKKNAKKQAN  204

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +IS DGASGD+ G TD AY KA+ DGVD IDC
Sbjct  205  ITIISKDGASGDFSGGTDLAYEKAIRDGVDFIDC  238


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 64/136 (47%), Gaps = 13/136 (10%)
 Frame = +2

Query  212  LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFD  388
            +  IK+FA  I++ K  + P  +  + L+  T +V      GL VY   F+++ +   +D
Sbjct  413  IKDIKSFAGSIVISKKSVVPYSEGITRLEKETDVVPRLRSSGLRVYVETFSNEFITQPYD  472

Query  389  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAI--DCYSHMRKGQKNQV-----PEFL  547
            +  DP  E   F+   N  +DG+++DFP T S  I   CYS M + +  ++     PE L
Sbjct  473  FFSDPTVEIDYFVRADN-EIDGIITDFPATTSRYIKNQCYSKMEQIRTGELVSLANPEIL  531

Query  548  VISFDGASGDYPGCTD  595
                  A   YP   D
Sbjct  532  ----SPAEAPYPLLLD  543



>ref|XP_009145621.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=726

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 164/214 (77%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR FVLS+S  + IN+ISSP+++FLKS+   + P  TKL+FRFL  D+ +P T
Sbjct  158  YTQHNLSMRNFVLSISSHMKINFISSPDISFLKSVKKDVKPTKTKLIFRFLSQDQIDPFT  217

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+Y SL +NL  IKTF+SGILVPKSYIWPV  S  YLQP TSLV DAH+ GL+V+AS+F
Sbjct  218  NQSYASLAKNLTFIKTFSSGILVPKSYIWPVS-SDLYLQPHTSLVTDAHRQGLQVFASEF  276

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP  EYL FIDNGN+SVDG LSDFP+TP  AI+C+SH+ K +  +   
Sbjct  277  ANDAVSAYNYSYDPTNEYLYFIDNGNFSVDGFLSDFPLTPYRAINCFSHLDKKKATKQAN  336

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +IS DGASGD+ G TD AY KAV DGVD IDC
Sbjct  337  ITIISKDGASGDFSGGTDLAYEKAVRDGVDFIDC  370


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 57/111 (51%), Gaps = 4/111 (4%)
 Frame = +2

Query  212  LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFD  388
            +  IK+FA  I++ K  + P  +  + L+  T +V      GL VY   F+++ +   +D
Sbjct  545  IKDIKSFAGSIVISKKSVVPYSEGIARLEKETDIVPRLRSSGLRVYVETFSNEFITQPYD  604

Query  389  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAID--CYSHMRKGQKNQV  535
            +  DP  E   F+  G+  VDG+++DFP T S      CYS M + +  ++
Sbjct  605  FFSDPTVEIDYFV-RGDPEVDGIITDFPATTSRYTKNPCYSKMEQIRTGEL  654



>ref|NP_001169682.1| hypothetical protein precursor [Zea mays]
 gb|ACN34414.1| unknown [Zea mays]
 gb|ACN34504.1| unknown [Zea mays]
 gb|AFW62775.1| hypothetical protein ZEAMMB73_123565 [Zea mays]
Length=753

 Score =   276 bits (707),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 172/214 (80%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ  LSMR+++LS+S++ +++YISSPEVNFL SI+ R++ + TKLVFRFL     EPST
Sbjct  184  YSQFKLSMRSYILSLSKQFIVDYISSPEVNFLTSISGRVSKK-TKLVFRFLDERSIEPST  242

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL  +KTFASGILVPKSYIWPV    +YL P TS+V DAHK GLE+YA+DF
Sbjct  243  NQTYGSMLKNLTFVKTFASGILVPKSYIWPV-TPDNYLLPYTSVVDDAHKAGLEIYAADF  301

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +++YS+DP+AEYL FIDNG +SVDGVL+DFPITPS A+ C+S++   + +    
Sbjct  302  ANDLTISYNYSFDPLAEYLFFIDNGAFSVDGVLTDFPITPSEAVGCFSNLNTSKIDHAKP  361

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY KAV+DG D+IDC
Sbjct  362  -LVISHNGASGDYPDCTDQAYEKAVADGADVIDC  394



>emb|CDY19634.1| BnaA05g20420D [Brassica napus]
Length=726

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 164/214 (77%), Gaps = 1/214 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR FVLS+S  + IN+ISSP+++FLKS+   + P  TKL+FRFL  D+ +P T
Sbjct  158  YTQHNLSMRNFVLSISSHMKINFISSPDISFLKSVKKDVKPTKTKLIFRFLSQDQIDPFT  217

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+Y SL +NL  IKTF+SGILVPKSYIWPV  S  YLQP TSLV DAH+ GL+V+AS+F
Sbjct  218  NQSYASLAKNLTFIKTFSSGILVPKSYIWPVS-SDLYLQPHTSLVTDAHRQGLQVFASEF  276

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP  EYL FIDNGN+SVDG LSDFP+TP  AI+C+SH+ K +  +   
Sbjct  277  ANDAVSAYNYSYDPTNEYLYFIDNGNFSVDGFLSDFPLTPYRAINCFSHLDKKKATKQAN  336

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +IS DGASGD+ G TD AY KAV DGVD IDC
Sbjct  337  ITIISKDGASGDFSGGTDLAYEKAVRDGVDFIDC  370


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 57/111 (51%), Gaps = 4/111 (4%)
 Frame = +2

Query  212  LASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASD-VPFAFD  388
            +  IK+FA  I++ K  + P  +  + L+  T +V      GL VY   F+++ +   +D
Sbjct  545  IKDIKSFAGSIVISKKSVVPYSEGIARLEKETDVVPRLRSSGLRVYVETFSNEFITQPYD  604

Query  389  YSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAID--CYSHMRKGQKNQV  535
            +  DP  E   F+  G+  VDG+++DFP T S      CYS M + +  ++
Sbjct  605  FFSDPTVEIDYFV-RGDPEVDGIITDFPATTSRYTKNPCYSKMEQIRTGEL  654



>ref|XP_009105134.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=756

 Score =   276 bits (706),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F++S S  V I+YISSPEVNF K IA R        VF+FLG ++ EP+T
Sbjct  176  YAQHNLSMSSFLISASTTVSIDYISSPEVNFFKKIAGRFGRNGPSFVFQFLGKEDFEPTT  235

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P++     L P  SLVLDAHK GL+VY S F
Sbjct  236  NRTYGSILSNLTFVKTFASGILVPKSYILPLNDKQYLLLPPASLVLDAHKAGLQVYVSGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D   A DYS DPV+EYLSF+DNGN+SVDGVLSDFPIT S +IDC+SH+ +    QV +
Sbjct  296  VNDNDIAHDYSSDPVSEYLSFVDNGNFSVDGVLSDFPITASASIDCFSHLGRNATKQV-D  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  355  FLVISKNGASGDYPGCTDMAYDKAIKDGADVIDCS  389



>ref|NP_001185333.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
 gb|AEE34580.1| putative glycerophosphoryl diester phosphodiesterase 3 [Arabidopsis 
thaliana]
Length=785

 Score =   277 bits (708),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 137/215 (64%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NLSM +F+LSVSR V I++ISSPEVNF K I           VF+FLG ++ EP+T
Sbjct  210  YEQQNLSMSSFLLSVSRTVSIDFISSPEVNFFKKITGSFGRNGPTFVFQFLGKEDFEPTT  269

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S F
Sbjct  270  NRTYGSILSNLTFVKTFASGILVPKSYILPLDDEQ-YLVPHTSLVQDAHKAGLQVYVSGF  328

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A++YS DPV+EYLSF+DNG++SVDGVLSDFPIT S A+DC+SH+ +    QV +
Sbjct  329  ANDVDIAYNYSSDPVSEYLSFVDNGDFSVDGVLSDFPITASAAVDCFSHIGRNATKQV-D  387

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS DGASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  388  FLVISKDGASGDYPGCTDLAYEKAIKDGADVIDCS  422



>ref|XP_010513618.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like, 
partial [Camelina sativa]
Length=647

 Score =   273 bits (699),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 167/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F++SVSR V I++ISSPEVNF K I  R        VF+FLG ++ EP+T
Sbjct  47   YEQHNLSMSSFLVSVSRTVSIDFISSPEVNFFKKITGRFKRNGPSFVFQFLGKEDFEPTT  106

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFAS ILVPKSYI+P+D    YL P TSLV DAHK GLEVY S F
Sbjct  107  NRTYGSILSNLGFVKTFASKILVPKSYIFPLD-DKQYLLPPTSLVQDAHKAGLEVYVSGF  165

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDPV+EYLSF+DNG++SVDGV+SDFP+T S +IDC+SH+ +    QV +
Sbjct  166  ANDNDLAYNYSYDPVSEYLSFVDNGDFSVDGVISDFPMTASASIDCFSHIGRNATKQV-D  224

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGD+PGCT+ AY KA+ DG D+IDC+
Sbjct  225  FLVISKNGASGDFPGCTNLAYEKAIKDGSDVIDCS  259



>ref|XP_006652401.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Oryza brachyantha]
Length=745

 Score =   275 bits (703),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 172/214 (80%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSM  ++LSVS+RV++ YISSPEV+FL  ++ ++    TKLVFRFL     EPST
Sbjct  176  YSQFNLSMTNYILSVSKRVIVGYISSPEVSFLTKVSGKVRNN-TKLVFRFLDESTIEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             QTYGS+L+NL  +KTFASGI+VPK+YIWPV    +YL+P TS+V DAHK GLE+YA+DF
Sbjct  235  KQTYGSMLKNLTFVKTFASGIIVPKNYIWPV-SPDNYLEPYTSVVDDAHKAGLEIYAADF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F++++SYDP+AEYLSFIDNG++SVDGVL+DFP+TPS AI C++++ K +K+   +
Sbjct  294  ANDFMFSYNHSYDPLAEYLSFIDNGDFSVDGVLTDFPVTPSEAIGCFTNLNKSKKDH-GK  352

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD AY KAV DG D++DC
Sbjct  353  PLIISHNGASGDYPACTDLAYQKAVDDGADVVDC  386



>ref|XP_002888565.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH64824.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=708

 Score =   274 bits (700),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NLSM +F+LSVSR V I++ISSPEVNF + IA R        VF+FL  ++ EP+ 
Sbjct  188  YEQQNLSMSSFLLSVSRTVSIDFISSPEVNFFRKIAGRFGRNGPSFVFQFLRKEDFEPTM  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +KTFASGILVPKSYI P+D+   YL P TSLV DAHK GL+VY S F
Sbjct  248  NRTYGSILSNLTFVKTFASGILVPKSYILPIDEEQ-YLVPHTSLVQDAHKAGLQVYVSGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A++YS+DPV+EYLSF+DNG++SVDGVLSDFPIT S  +DC+SH+ +    QV +
Sbjct  307  ANDVDIAYNYSWDPVSEYLSFVDNGDFSVDGVLSDFPITASATVDCFSHIGRNATKQV-D  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY  A+ DG D+IDC+
Sbjct  366  FLVISKNGASGDYPGCTDVAYENAIKDGADVIDCS  400



>ref|XP_002446646.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
 gb|EES10974.1| hypothetical protein SORBIDRAFT_06g019730 [Sorghum bicolor]
Length=749

 Score =   275 bits (702),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 170/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSMR +++SVS+RVV NYISSPEV+FL SI  RI+ + TKLVFRFL     EPS 
Sbjct  177  YSQFNLSMRNYIISVSKRVVANYISSPEVSFLTSILGRISNK-TKLVFRFLDESTLEPSM  235

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+++NL  +KTFASGILVPKSYIWP +   +YLQP TS+V DAHK GLE+YA+DF
Sbjct  236  NQTYGSMMKNLTFVKTFASGILVPKSYIWP-NSPDNYLQPYTSVVDDAHKAGLEIYAADF  294

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   ++++SYDP+AEYLSFIDN  +SVDGVL+DFP+T S AI C++++ K   +   +
Sbjct  295  ANDFLLSYNHSYDPLAEYLSFIDNDVFSVDGVLTDFPVTASEAIGCFTNLNKSNTDH-GK  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYPGCTD AY KAV DG D+IDC
Sbjct  354  PLIISHNGASGDYPGCTDLAYQKAVDDGADVIDC  387



>ref|XP_010928867.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Elaeis guineensis]
Length=767

 Score =   275 bits (703),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 166/214 (78%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSMR+++LS+S+RV+++Y+SSPEV FL+SIA       TK +FRFL     EPST
Sbjct  188  YRQHNLSMRSYLLSLSKRVILSYVSSPEVIFLRSIAGTFRRTKTKFIFRFLDEATIEPST  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YIWPV  S  YLQP TS+VLDAHK GLEVYAS F
Sbjct  248  NQTYGSLLKNLTFIKTFASGILVPKQYIWPV-TSDLYLQPHTSIVLDAHKEGLEVYASGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F+++YSYDP+AEYLSFIDNG +SVDGVL+DFPIT S AI C+SH  +   ++  +
Sbjct  307  ANDALFSYNYSYDPLAEYLSFIDNGMFSVDGVLTDFPITASEAIGCFSHT-EANSSEHGK  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             +V S +GASG YP CTD AY +AV DG D IDC
Sbjct  366  PVVFSHNGASGMYPDCTDLAYQQAVKDGADFIDC  399



>ref|XP_003579951.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Brachypodium distachyon]
Length=744

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 170/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ N+SMR ++LSV++RVV++YISSPE +FL SI+ R++ + TKLVFRFL     EPST
Sbjct  176  YSQFNMSMRNYILSVTKRVVVDYISSPEASFLTSISGRVSNK-TKLVFRFLDEATLEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             QTYGS+L+NL  +KTFASGILVPK YIWPV    +YLQP TS+V DAHK GLE+YA+DF
Sbjct  235  KQTYGSMLKNLTFVKTFASGILVPKKYIWPV-SPDNYLQPYTSIVDDAHKAGLEIYAADF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   ++++SYDP+ E LSFIDNG +SVDG+L+DFP+TPS AI C++++ K   +   +
Sbjct  294  ANDFTLSYNHSYDPLTESLSFIDNGAFSVDGILTDFPVTPSEAIGCFANLNKSNTDH-GK  352

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYPGCTD AY KAV DG D+IDC
Sbjct  353  PLIISHNGASGDYPGCTDLAYQKAVDDGADVIDC  386



>ref|XP_009132384.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Brassica rapa]
Length=766

 Score =   274 bits (701),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 164/214 (77%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F+L+VS+ V+I+Y+SSPEV+F ++I  R      K VFRFL  D+ E ST
Sbjct  190  YTQHNLSMSSFLLTVSKTVIIDYLSSPEVSFFRNIGGRFGKTGPKFVFRFLDKDDVEVST  249

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL++NL  IKTFASG+LVPKSYIWPV     YL P TS V DAH  GL+VY S F
Sbjct  250  NQTYGSLMKNLTFIKTFASGVLVPKSYIWPV--KDQYLLPHTSFVRDAHTAGLQVYGSGF  307

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP+ EYLSF+DNG++SVDG LSDFP+T S AIDC+SH+      QV +
Sbjct  308  ANDFDIAYNYSYDPLTEYLSFMDNGDFSVDGFLSDFPLTASSAIDCFSHLGSNASTQV-D  366

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            FLVIS +GA+GDYPG TD AY+KA+ DG DIIDC
Sbjct  367  FLVISKNGANGDYPGSTDLAYTKAIKDGADIIDC  400



>ref|XP_010511610.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL1-like [Camelina sativa]
Length=764

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F+L  SR V +++ISSPEVNF K IA R        VF+FLG ++ EP+T
Sbjct  187  YEQHNLSMSSFILXASRTVSMDFISSPEVNFFKKIAGRFKRNGPSFVFQFLGKEDFEPTT  246

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG +L NL  +KTFASGILVPKSYI+ +D    YL P TSLV DAHK GLEVY S F
Sbjct  247  NQTYGFILSNLTFVKTFASGILVPKSYIFQLD-DKQYLIPHTSLVQDAHKAGLEVYVSGF  305

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A +YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC++H+ +    QV +
Sbjct  306  ANDVDIAHNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASASIDCFAHIGRNATKQV-D  364

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS DGASGDYPGCT+ AY KA+ DG D+IDC+
Sbjct  365  FLVISKDGASGDYPGCTNFAYEKAIKDGADVIDCS  399



>gb|EMT15515.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=880

 Score =   276 bits (705),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 170/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSMR+++LS+S++  ++YISSPEV+FLKS+  R+  R TKLV RFL     EPST
Sbjct  174  YSQFNLSMRSYILSMSKQYTVDYISSPEVSFLKSLVGRVG-RKTKLVLRFLDEGLVEPST  232

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL+SIKTFASGILVPK YIWPV  + +YLQP+TS+V DAHK GLE+YA+DF
Sbjct  233  NQTYGSILKNLSSIKTFASGILVPKHYIWPV-TADNYLQPSTSVVDDAHKAGLEIYAADF  291

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP+AEYL FIDNG + VDG+L+DFPITP  AI C+S++   + +    
Sbjct  292  ANDFALSYNYSYDPLAEYLGFIDNGAFCVDGLLTDFPITPLEAIGCFSNLNNTKADHGAP  351

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  352  -LVISHNGASGDYPDCTDLAYQKAVQDGADVIDC  384



>ref|XP_010511612.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=761

 Score =   274 bits (700),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NL M +F+LS SR V IN+ISSPEVNF K IA R        VF+FL N++ EP+T
Sbjct  189  YEQQNLIMSSFLLSASRTVSINFISSPEVNFFKKIAGRFKRNGPSFVFQFLRNEDFEPTT  248

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GLEVY S F
Sbjct  249  NQTYGSILGNLTFVKTFASGILVPKSYILPLD-DKQYLLPPTSLVQDAHKAGLEVYVSGF  307

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            ASDV  A++YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC+SH+ +    QV +
Sbjct  308  ASDVDIAYNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTESASIDCFSHIGRNATKQV-D  366

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS DGASG+YP CT+ AY KA+ DG ++IDC+
Sbjct  367  FLVISKDGASGEYPRCTNLAYDKAIRDGANVIDCS  401



>gb|EMS58329.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=744

 Score =   273 bits (698),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 170/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ N+SMR ++LSVSRRV+++YISSPE +FL SI+ R++   TKL+FRFL     EPST
Sbjct  175  YSQFNMSMRKYILSVSRRVIVDYISSPEASFLTSISGRVSNN-TKLMFRFLDEATLEPST  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             +TYGS+L+NL  IKTFASGILVPK YIWPV    +YLQP TS+V DAHK GLE+YA+DF
Sbjct  234  KETYGSMLKNLTFIKTFASGILVPKKYIWPV-SPDNYLQPYTSIVDDAHKAGLEIYAADF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   ++++SYDP+AE LSFIDNG +SVDG+L+DFP+TPS A+ C++++ K   +   +
Sbjct  293  ANDFALSYNHSYDPLAESLSFIDNGAFSVDGMLTDFPVTPSEAVGCFANLNKSNTDH-GK  351

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYPGCTD AY KAV DG D+IDC
Sbjct  352  PLIISHNGASGDYPGCTDLAYQKAVDDGADVIDC  385



>emb|CDY36746.1| BnaA03g11400D [Brassica napus]
Length=766

 Score =   273 bits (699),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 164/214 (77%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F+L+VS+ V+I+Y+SSPEV+F ++I  R      K VFRFL  D+ E ST
Sbjct  190  YTQHNLSMSSFLLTVSKTVIIDYLSSPEVSFFRNIGGRFGKTGPKFVFRFLDKDDVEVST  249

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL++NL  IKTFASG+LVPKSYIWPV     YL P TS V DAH  GL+VY S F
Sbjct  250  NQTYGSLMKNLTFIKTFASGVLVPKSYIWPV--KDQYLLPHTSFVRDAHTAGLQVYGSGF  307

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP+AEYLSF+DNG++SVDG LSDFP T S A+DC+SH+      QV +
Sbjct  308  ANDFDIAYNYSYDPLAEYLSFMDNGDFSVDGFLSDFPSTASSAVDCFSHLGSNASTQV-D  366

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            FLVIS +GA+GDYPG TD AY+KA+ DG DIIDC
Sbjct  367  FLVISKNGANGDYPGSTDLAYTKAIKDGADIIDC  400



>gb|EMT29224.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=849

 Score =   275 bits (703),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 170/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ N+SMR ++LSVSRRV+++YISSPE +FL SI+ R++   TKLVFRFL     EPST
Sbjct  175  YSQFNMSMRKYILSVSRRVIVDYISSPEASFLTSISGRVSNN-TKLVFRFLDEATLEPST  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             +TYGS+L+NL  IKTFASGILVPK YIWPV   + YLQP TS+V DAHK GLE+YA+DF
Sbjct  234  KETYGSMLKNLTFIKTFASGILVPKKYIWPVSPDN-YLQPYTSIVDDAHKAGLEIYAADF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   ++++SYDP+AE LSFIDNG +SVDG+L+DFP+TPS AI C++++ K   +   +
Sbjct  293  ANDFALSYNHSYDPLAESLSFIDNGAFSVDGILTDFPVTPSEAIGCFANLNKSNTDH-GK  351

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYPGCTD AY KAV DG D+IDC
Sbjct  352  PLIISHNGASGDYPGCTDLAYQKAVDDGADVIDC  385



>ref|XP_010470589.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=765

 Score =   273 bits (697),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 167/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F++SVSR V I++ISSPEVNF K I  R+       VF+FLG ++ EPST
Sbjct  193  YEQHNLSMSSFLVSVSRTVSIDFISSPEVNFFKKITGRVKRNGPSFVFQFLGKEDFEPST  252

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TY S+L NLA +KTFAS ILVPKSYI+P+D    YL P TSLV DAHK GLEVY S F
Sbjct  253  NRTYASILSNLAFVKTFASKILVPKSYIFPLD-DKQYLLPLTSLVQDAHKAGLEVYVSGF  311

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC++H+ +    QV +
Sbjct  312  ANDADIAYNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASTSIDCFAHVGRNATKQV-D  370

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS  GASGDYP CT+ AY KA+ DGVD+IDC+
Sbjct  371  FLVISKGGASGDYPSCTNLAYEKAIKDGVDVIDCS  405



>emb|CDX92782.1| BnaC07g40400D [Brassica napus]
Length=1322

 Score =   278 bits (711),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 165/215 (77%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM TF++S S+ V ++Y+SSPEVNF   IA R      K VFRFL  ++ EP+T
Sbjct  176  YAQHNLSMSTFLISASKTVSVDYLSSPEVNFFTKIAGRFGRNGPKFVFRFLEKEQFEPTT  235

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL  +K FASGILVPKSY+ P+D    YL P+TSLV DA K GLEV+ S F
Sbjct  236  NRTYGSILSNLTFVKNFASGILVPKSYVLPLD-DKQYLLPSTSLVQDAQKAGLEVFVSGF  294

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYSYDPV+EYLSF+DNGN+SVDGVLSDFPIT S +I+C+SH+ +    Q  +
Sbjct  295  ANDVDIAHDYSYDPVSEYLSFMDNGNFSVDGVLSDFPITASASIECFSHLGRNAIKQGID  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  355  FLVISKNGASGDYPGCTDLAYDKAIKDGADVIDCS  389



>ref|XP_006647435.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=747

 Score =   272 bits (696),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 171/214 (80%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NL+MR+++LSVS++  ++YISSPEVNFL S+  R++ + TKLVFRFL     EPST
Sbjct  174  YSQFNLNMRSYILSVSKQFAVDYISSPEVNFLNSLLGRVSKK-TKLVFRFLDEQTVEPST  232

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKT ASG+LVPK YI PV K + YLQP TS+V DAHK GLE+YA+DF
Sbjct  233  NQTYGSLLKNLTFIKTIASGVLVPKHYILPVTKDN-YLQPHTSVVDDAHKAGLEIYAADF  291

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F+++YSYDP+AEYLSFIDNG +S+DGVL+DFPIT S AI C++++   + +   +
Sbjct  292  ANDFSFSYNYSYDPLAEYLSFIDNGAFSIDGVLTDFPITSSEAIGCFTNLNNSKIDH-GK  350

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY KAV+DG D+IDC
Sbjct  351  PLVISHNGASGDYPDCTDLAYQKAVADGADVIDC  384



>ref|XP_010419030.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=772

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 167/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +HNLSM +F+LS S+ V +++ISSPEVNF K IA R        VF+FLG ++ EP+T
Sbjct  193  YEEHNLSMSSFLLSASKTVSMDFISSPEVNFFKKIAGRFKRNGPSFVFQFLGKEDVEPTT  252

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S F
Sbjct  253  NQTYGSILSNLTFVKTFASGILVPKSYILPLD-DKQYLIPHTSLVQDAHKEGLKVYVSGF  311

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC++H+ +    QV +
Sbjct  312  ANDNDLAYNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASASIDCFAHIGRNATKQV-D  370

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCT+ AY KA+ DG D+IDC+
Sbjct  371  FLVISKNGASGDYPGCTNLAYEKAIKDGADVIDCS  405



>ref|XP_010675853.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
[Beta vulgaris subsp. vulgaris]
Length=752

 Score =   272 bits (696),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 173/216 (80%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QH LSMR+F++  S+RV+I++ISS +++FL+++A       TK +FRF   D  EPST
Sbjct  177  YRQHKLSMRSFLIGASKRVIISHISSSDISFLQALARPFASSKTKRIFRFFDVDAVEPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQT+GSLL+NL  IKTFA+GILVPK+YIWPVD ++SYL P TSLV DAHK GLEV+ASDF
Sbjct  237  NQTFGSLLKNLTMIKTFAAGILVPKTYIWPVD-ATSYLLPHTSLVADAHKAGLEVFASDF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHM-RKGQKNQVP  538
            A+D  FA++YSY+PVAEYLSFIDNG++SVDG+LSDFPITPS AIDC++H+  K      P
Sbjct  296  ANDNTFAYNYSYNPVAEYLSFIDNGDFSVDGLLSDFPITPSAAIDCFAHLPTKASPAGAP  355

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
              LVIS DGASGD+PGCTD AY +A+ DG D+IDCT
Sbjct  356  --LVISHDGASGDFPGCTDIAYEQAIKDGADVIDCT  389



>emb|CDY36036.1| BnaC03g41620D [Brassica napus]
Length=849

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 168/214 (79%), Gaps = 7/214 (3%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSMR +V+S+S+RV  ++ISSPE++FLKS+       VTKL+FRFL  D+ EP T
Sbjct  288  YRQHNLSMRNYVVSLSKRV--DFISSPEISFLKSMKKD----VTKLIFRFLNQDQIEPFT  341

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY SL +NL+ IKTF+SGILVPKSYIWPV  S  YL+P TSLV +AH+ GL+V+AS+F
Sbjct  342  NQTYSSLSKNLSYIKTFSSGILVPKSYIWPVG-SDLYLKPHTSLVTEAHRQGLQVFASEF  400

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  FA++YSYDP AEYLSFID+GN+SVDG LSDFP+TP  AI C+SH+   +  +   
Sbjct  401  ANDFVFAYNYSYDPTAEYLSFIDSGNFSVDGFLSDFPVTPYRAISCFSHLDTKEDEEPAV  460

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
              +IS DGASGD+PGCTD AY KAV DGVDI+DC
Sbjct  461  VTIISNDGASGDFPGCTDLAYEKAVKDGVDILDC  494



>ref|XP_010415240.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=780

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 168/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F++SVSR V I++ISSPEVNF K I           VF+FLG ++ EP+T
Sbjct  190  YEQHNLSMSSFLVSVSRTVSIDFISSPEVNFFKKITGHFKRNGPSFVFQFLGKEDFEPTT  249

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NLA +KTFAS ILVPKSYI+P+D  + YL P TSLV DAHK GLEVY S F
Sbjct  250  NRTYGSILSNLAFVKTFASKILVPKSYIFPLD-DNQYLLPPTSLVQDAHKAGLEVYVSGF  308

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDPV+EYLSF+DNG++SVDGV+SDFP+T S +IDC+SH+ +    QV +
Sbjct  309  ANDNDLAYNYSYDPVSEYLSFVDNGDFSVDGVISDFPMTASASIDCFSHIDRNATKQV-D  367

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FL+IS +GASGD+PGCT+ AY KA+ DG D+IDC+
Sbjct  368  FLIISKNGASGDFPGCTNLAYEKAIKDGADVIDCS  402



>emb|CDY61647.1| BnaCnng38120D [Brassica napus]
Length=755

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+Q NLSM +F++S SR V I+YISSPEVNF K IA R        VF+FLG ++ EP+T
Sbjct  175  YAQQNLSMSSFLISASRTVSIDYISSPEVNFFKKIAGRFGRNGPSFVFQFLGKEDFEPTT  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TY S+L NL  +KTFASGILVPKSYI P+D +   + P  SLVLDAHK GL+VY S F
Sbjct  235  NRTYDSILSNLTFVKTFASGILVPKSYILPLDDNQYLVLPPKSLVLDAHKAGLQVYVSGF  294

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
             +D   A DYS DPV+EYLSF+DNGN+SVDGVLSDFPIT S +IDC+SH+ +    QV +
Sbjct  295  VNDNDIAHDYSSDPVSEYLSFVDNGNFSVDGVLSDFPITASASIDCFSHLGRNATKQV-D  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASG+YPGCTD AY KA+ DG D+IDC+
Sbjct  354  FLVISKNGASGEYPGCTDMAYDKAIKDGADVIDCS  388



>ref|XP_010235616.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X2 [Brachypodium distachyon]
Length=659

 Score =   270 bits (690),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 169/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSMR+++LS+S++  ++YISSPEV  LKS+  R++ + TKLVFRFL     EPST
Sbjct  86   YSQFNLSMRSYILSLSKQYTVDYISSPEVTILKSLLGRVSKK-TKLVFRFLDEGTAEPST  144

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL  IKTFASGILVPK YI PV  + +YL+P TS+V DAH  GLE+YA+DF
Sbjct  145  NQTYGSMLKNLTFIKTFASGILVPKHYILPV-TADNYLKPHTSVVDDAHTAGLEIYAADF  203

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F+++YSYDP+AEYLSFIDNG +SVDGV++DFP TPS AIDC+ ++    ++    
Sbjct  204  ANDFTFSYNYSYDPLAEYLSFIDNGAFSVDGVVTDFPSTPSTAIDCFHNLNGSNRDHGAP  263

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY KAV+DG D+IDC
Sbjct  264  -LVISHNGASGDYPDCTDLAYQKAVADGADVIDC  296



>ref|NP_001053060.1| Os04g0472300 [Oryza sativa Japonica Group]
 emb|CAE02867.2| OSJNBb0022F23.4 [Oryza sativa Japonica Group]
 dbj|BAF14974.1| Os04g0472300 [Oryza sativa Japonica Group]
 dbj|BAG91894.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61172.1| hypothetical protein OsJ_15144 [Oryza sativa Japonica Group]
Length=740

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 171/214 (80%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSM  ++ SVS+RV+++YISSPEV+FL  ++ +++   T+LVFRFL     EPST
Sbjct  175  YSQFNLSMSNYIFSVSKRVIVDYISSPEVSFLTKVSGKLSNN-TRLVFRFLDESTIEPST  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             QTYGS+L+NL  +KTFASGI+VPK YIWPV    +YL+P TS+V DAHK GLE+YA+DF
Sbjct  234  KQTYGSMLKNLTFVKTFASGIIVPKKYIWPV-SPDNYLEPHTSVVDDAHKAGLEIYAADF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F++++SYDP+AEYLSFIDNG +SVDGVL+DFP+TPS AI C+++++K + +   +
Sbjct  293  ANDFMFSYNHSYDPLAEYLSFIDNGAFSVDGVLTDFPVTPSEAIGCFTNLKKSKTDH-GK  351

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  352  PLIISHNGASGDYPACTDLAYQKAVDDGADVIDC  385



>ref|XP_010474164.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=654

 Score =   269 bits (688),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 163/215 (76%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F++S SR V IN+ISSPEVNF   IA          VF+FL  ++ EP+T
Sbjct  87   YEQHNLSMSSFIVSASRTVSINFISSPEVNFFMKIAGHFKHNGPSFVFQFLAKEDFEPTT  146

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L NL  +KTF+SGILVPKSYI  +D +  YL P TSLV DAHK GLEVY S F
Sbjct  147  NQTYGSILSNLTFVKTFSSGILVPKSYILQLD-NKQYLIPHTSLVQDAHKAGLEVYVSGF  205

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A +YS+DPV+EYLSF+DNG++SVDGV+SDFP+T S +IDC+SH+ +    QV +
Sbjct  206  ANDADIAHNYSFDPVSEYLSFVDNGDFSVDGVVSDFPLTASASIDCFSHIGRNATKQV-D  264

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCT+ AY KA+ DG D+IDC+
Sbjct  265  FLVISKNGASGDYPGCTNLAYEKAIKDGADVIDCS  299



>ref|XP_010474166.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=258

 Score =   258 bits (658),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 161/208 (77%), Gaps = 2/208 (1%)
 Frame = +2

Query  23   MRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSL  202
            M +F++SVSR V I++ISSPEVNF K I  R        VF+FLG ++ EP+TN+TYGS+
Sbjct  1    MSSFLVSVSRTVSIDFISSPEVNFFKKITGRFKRNGPSFVFQFLGKEDFEPTTNRTYGSI  60

Query  203  LQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFA  382
            L NLA +KTFAS ILVPKSYI+P+D    YL P TSLV DAHK GLEVY S FA+D   A
Sbjct  61   LSNLAFVKTFASKILVPKSYIFPLDDKQ-YLLPPTSLVQDAHKAGLEVYVSGFANDNDLA  119

Query  383  FDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFD  562
            ++YSYDPV+EYLSF+DNG++SVDGV+SDFP+T S +IDC+SH+ +    QV +FL+IS +
Sbjct  120  YNYSYDPVSEYLSFVDNGDFSVDGVISDFPMTASASIDCFSHIGRNATKQV-DFLIISKN  178

Query  563  GASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            GASGDYPGCT+ AY KA+ +G D+I C+
Sbjct  179  GASGDYPGCTNLAYEKAIKNGADVIVCS  206



>dbj|BAJ85772.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   271 bits (693),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 168/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ N+SMR ++LSVSRRV+++YISSPE +FL SI+ RI+   TKLVFRFL     EPST
Sbjct  175  YSQFNMSMRKYILSVSRRVIVDYISSPEASFLTSISGRISNN-TKLVFRFLDEATLEPST  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
              TYGS+L+NL  IKTFASGILVPK Y+WPV    +YLQ  TS+V DAHKVGLE+YA+DF
Sbjct  234  KDTYGSMLKNLTFIKTFASGILVPKKYVWPV-SPDNYLQMYTSIVDDAHKVGLEIYAADF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   ++++SYDP+AE LSFIDNG +SVDG+L+DFP+TPS AI C++++ K       +
Sbjct  293  ANDFALSYNHSYDPLAESLSFIDNGAFSVDGILTDFPVTPSEAIGCFANLNKSNTAH-GK  351

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYPGCTD AY KAV DG D+IDC
Sbjct  352  PLIISHNGASGDYPGCTDLAYQKAVDDGADVIDC  385



>dbj|BAJ87963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 168/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ N+SMR ++LSVSRRV+++YISSPE +FL SI+ RI+   TKLVFRFL     EPST
Sbjct  175  YSQFNMSMRKYILSVSRRVIVDYISSPEASFLTSISGRISNN-TKLVFRFLDEATLEPST  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
              TYGS+L+NL  IKTFASGILVPK Y+WPV    +YLQ  TS+V DAHKVGLE+YA+DF
Sbjct  234  KDTYGSMLKNLTFIKTFASGILVPKKYVWPV-SPDNYLQMYTSIVDDAHKVGLEIYAADF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   ++++SYDP+AE LSFIDNG +SVDG+L+DFP+TPS AI C++++ K       +
Sbjct  293  ANDFALSYNHSYDPLAESLSFIDNGAFSVDGILTDFPVTPSEAIGCFANLNKSNTAH-GK  351

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYPGCTD AY KAV DG D+IDC
Sbjct  352  PLIISHNGASGDYPGCTDLAYQKAVDDGADVIDC  385



>ref|XP_008645878.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Zea mays]
 gb|AFW72077.1| hypothetical protein ZEAMMB73_869244 [Zea mays]
Length=750

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 168/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ  LSMR ++LS+S++ + +YISSPEVNFL SI+ R++ + TKLVFRFL     EPST
Sbjct  181  YSQFKLSMRNYILSLSKQFITDYISSPEVNFLTSISGRVSKK-TKLVFRFLDEGSIEPST  239

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL  +KTFASGILVPKSYIWPV    +YL P TS+V DAHK GLE+YA+DF
Sbjct  240  NQTYGSMLKNLTFVKTFASGILVPKSYIWPV-TPDNYLLPYTSVVDDAHKAGLEIYAADF  298

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YS+DP+AEYLSFI N  +SVDGVL+DFPITPS A+ C+S++   + +    
Sbjct  299  ANDFTISYNYSFDPLAEYLSFIGNSAFSVDGVLTDFPITPSEAVGCFSNLNNSKIDHAKP  358

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY KAV+DG D+IDC
Sbjct  359  -LVISHNGASGDYPDCTDQAYEKAVADGADVIDC  391



>ref|NP_001168748.1| uncharacterized protein LOC100382543 precursor [Zea mays]
 gb|ACN30591.1| unknown [Zea mays]
Length=747

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 168/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSMR +++SVS+RVV+NYISSPEV+FL S+  RI+ + TKLVFRFL     EPST
Sbjct  175  YSQFNLSMRNYIISVSKRVVVNYISSPEVSFLTSLLGRISNK-TKLVFRFLDESSLEPST  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL  + TFASGILVPK YIWP     +YLQ  TS+V DAHK GLE+YA+DF
Sbjct  234  NQTYGSMLKNLTFVSTFASGILVPKGYIWP-HSPDNYLQQYTSVVDDAHKAGLEIYAADF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   ++++SYDP+AEYLSFIDN  +SVDGVL+DFPIT S AI C++++ K   +   +
Sbjct  293  ANDFVVSYNHSYDPLAEYLSFIDNDVFSVDGVLTDFPITASEAIGCFTNLNKSNTDH-GK  351

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYPGCTD AY KAV DG D+IDC
Sbjct  352  PLIISHNGASGDYPGCTDLAYQKAVDDGADVIDC  385



>emb|CDY12605.1| BnaA02g12730D [Brassica napus]
Length=716

 Score =   270 bits (690),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLS+ +F++S SR V I+YISSPE+NF   +  R        VF+FLG +E EP+T
Sbjct  145  YAQHNLSISSFLISASRTVSIDYISSPELNFFSKVKGRFGRNEPSFVFQFLGKEEFEPTT  204

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             +TYGS+L NL  +KTFASGILVPKSYI P+D    YL P T LV DAHK GL++Y S F
Sbjct  205  KRTYGSILSNLTYVKTFASGILVPKSYILPLD-DKQYLLPPTFLVQDAHKAGLQLYVSGF  263

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A++YS+DPV+EYLSF+DNG +SVDGVLSDFPIT S +IDC+SH+ +  + Q+ +
Sbjct  264  ANDVDIAYNYSFDPVSEYLSFVDNGYFSVDGVLSDFPITASASIDCFSHIGRNARKQM-D  322

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVI+ +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  323  FLVITKNGASGDYPGCTDLAYEKAIQDGADVIDCS  357



>ref|XP_010913957.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X2 [Elaeis guineensis]
Length=728

 Score =   270 bits (690),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 164/214 (77%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+++LS+S+RV++NY+SS EV FL SI        TK +FRFL     EPST
Sbjct  152  YTQHNLSMRSYLLSLSKRVILNYVSSAEVVFLSSITRTFKATKTKFIFRFLDKAAIEPST  211

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL +NL  IKTFASGILVPK YIWPV  S  YLQP TS VLDAHK GLEV+AS F
Sbjct  212  NQTYGSLSKNLTFIKTFASGILVPKQYIWPV-TSDLYLQPHTSFVLDAHKEGLEVFASGF  270

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP+AEYLSFIDNG +SVDGVL+DFP T S AI C+SH+ K   ++  +
Sbjct  271  ANDALISYNYSYDPLAEYLSFIDNGIFSVDGVLTDFPKTASEAIGCFSHI-KANYSEHGK  329

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASG YP CTD AY +AV DGVD+IDC
Sbjct  330  PLVISHNGASGIYPDCTDLAYQQAVKDGVDVIDC  363



>ref|XP_009390640.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 [Musa acuminata subsp. malaccensis]
Length=755

 Score =   270 bits (691),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 166/214 (78%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNL+MR +VLS+++R+ +NY+SSPE+ FL+ IA   N   TKL+FRFL     EPST
Sbjct  179  YTQHNLNMRNYVLSLTKRITVNYLSSPELAFLRKIAPSFNNTKTKLIFRFLDKGIKEPST  238

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TY  LL NL  I+TFASGILVPKSYIWPV    +YL P TS+V DAHK GLE+YA+DF
Sbjct  239  NRTYRLLLNNLKLIRTFASGILVPKSYIWPV-TPDNYLLPYTSIVTDAHKAGLEIYAADF  297

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F+++YSYDP+ E LSFIDNG +SVDGV++DFPITPS AI C+S + K + +  P 
Sbjct  298  ANDNLFSYNYSYDPLTECLSFIDNGLFSVDGVVTDFPITPSEAIGCFSRLNKSRVDGKP-  356

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD AY+KAV DG D+IDC
Sbjct  357  -LIISNNGASGDYPDCTDLAYNKAVEDGADVIDC  389



>emb|CAH67272.1| B0806H07.1 [Oryza sativa Indica Group]
 gb|EEC77457.1| hypothetical protein OsI_16271 [Oryza sativa Indica Group]
Length=740

 Score =   270 bits (690),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 171/214 (80%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSM  ++LSVS+RV+++YISSPEV+FL  ++ +++   T+LVFRFL     EPST
Sbjct  175  YSQFNLSMSNYILSVSKRVIVDYISSPEVSFLTKVSGKLSNN-TRLVFRFLDESTIEPST  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             QTYGS+L+N   +KTFASGI+VPK YIWPV    +YL+P TS+V DAHK GLE+YA++F
Sbjct  234  KQTYGSMLKNFTFVKTFASGIIVPKKYIWPV-SPDNYLEPHTSVVDDAHKAGLEIYAANF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F++++SYDP+AEYLSFIDNG +SVDGVL+DFP+TPS AI C+++++K +K    +
Sbjct  293  ANDFMFSYNHSYDPLAEYLSFIDNGAFSVDGVLTDFPVTPSEAIGCFTNLKK-RKTDHGK  351

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  352  PLIISHNGASGDYPACTDLAYQKAVDDGADVIDC  385



>ref|XP_006586115.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Glycine max]
Length=666

 Score =   268 bits (685),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM+ FVLSVSR V ++YISSPE  FL+SI + INPR+TK+VFRFL  DE +PST
Sbjct  181  YAQHNLSMKNFVLSVSRTVNVSYISSPEAGFLRSIKAHINPRITKVVFRFLEKDEVDPST  240

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGSLL+NLASIKTFASGILVPK YIWPVD +  YL P TSLV DAHKVGLEV+ASD 
Sbjct  241  NRTYGSLLKNLASIKTFASGILVPKGYIWPVDPTGLYLLPHTSLVSDAHKVGLEVFASDI  300

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHM  511
             +D+P +++YSYDPVAEYL+FIDNGN+SVDGVLSDFP+TPS AIDC++H+
Sbjct  301  LNDIPISYNYSYDPVAEYLNFIDNGNFSVDGVLSDFPLTPSEAIDCFAHI  350



>ref|XP_010913956.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL4-like 
isoform X1 [Elaeis guineensis]
Length=763

 Score =   270 bits (690),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 164/214 (77%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR+++LS+S+RV++NY+SS EV FL SI        TK +FRFL     EPST
Sbjct  187  YTQHNLSMRSYLLSLSKRVILNYVSSAEVVFLSSITRTFKATKTKFIFRFLDKAAIEPST  246

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL +NL  IKTFASGILVPK YIWPV  S  YLQP TS VLDAHK GLEV+AS F
Sbjct  247  NQTYGSLSKNLTFIKTFASGILVPKQYIWPV-TSDLYLQPHTSFVLDAHKEGLEVFASGF  305

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP+AEYLSFIDNG +SVDGVL+DFP T S AI C+SH+ K   ++  +
Sbjct  306  ANDALISYNYSYDPLAEYLSFIDNGIFSVDGVLTDFPKTASEAIGCFSHI-KANYSEHGK  364

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASG YP CTD AY +AV DGVD+IDC
Sbjct  365  PLVISHNGASGIYPDCTDLAYQQAVKDGVDVIDC  398



>ref|XP_008798764.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X2 [Phoenix dactylifera]
Length=651

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 165/214 (77%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR++VLS+++RV++NY+SS EV FL S+A       TK +FRF+     EPST
Sbjct  77   YTQHNLSMRSYVLSLAKRVILNYVSSAEVVFLSSVARTFKGTKTKFIFRFIDEAAIEPST  136

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YI+PV  S  YLQP TS VLDAHK GLEV+AS F
Sbjct  137  NQTYGSLLKNLTFIKTFASGILVPKQYIYPV-TSDFYLQPHTSFVLDAHKEGLEVFASGF  195

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP+AEYLSF+DNG +SVDGVL+DFP T S AI C+SH++    ++  +
Sbjct  196  ANDAIISYNYSYDPLAEYLSFVDNGIFSVDGVLTDFPKTASEAIGCFSHIQ-ANNSEHGK  254

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASG YP CTD AY +AV DGVD IDC
Sbjct  255  PLVISHNGASGTYPDCTDLAYQQAVKDGVDFIDC  288



>ref|XP_003575252.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3-like 
isoform X1 [Brachypodium distachyon]
Length=749

 Score =   269 bits (688),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 167/214 (78%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ NLSMR+++LS+S++  ++YISSPEV  LKS+  R++ + TKLVFRFL     EPST
Sbjct  176  YSQFNLSMRSYILSLSKQYTVDYISSPEVTILKSLLGRVSKK-TKLVFRFLDEGTAEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL  IKTFASGILVPK YI PV  + +YL+P TS+V DAH  GLE+YA+DF
Sbjct  235  NQTYGSMLKNLTFIKTFASGILVPKHYILPV-TADNYLKPHTSVVDDAHTAGLEIYAADF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F+++YSYDP+AEYLSFIDNG +SVDGV++DFP TPS AIDC+ H   G       
Sbjct  294  ANDFTFSYNYSYDPLAEYLSFIDNGAFSVDGVVTDFPSTPSTAIDCF-HNLNGSNRDHGA  352

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY KAV+DG D+IDC
Sbjct  353  PLVISHNGASGDYPDCTDLAYQKAVADGADVIDC  386



>ref|XP_006300773.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
 gb|EOA33671.1| hypothetical protein CARUB_v10019847mg [Capsella rubella]
Length=766

 Score =   269 bits (688),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM  ++LSVSR   I++ISSPEVNF   IA R        VF+FL  ++ EP+T
Sbjct  192  YAQHNLSMSNYLLSVSRTASIDFISSPEVNFFMKIAGRFGRNGPSFVFQFLRQEDLEPTT  251

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL VY S F
Sbjct  252  NQTYGSILSNLTFVKTFASGILVPKSYILPLDD-QQYLLPYTSLVQDAHKAGLAVYVSGF  310

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            ++D+  A DYS+DPV+EYLSF+DNG++SVDG++SDFPIT S +IDC+SH+ +  +  V +
Sbjct  311  SNDIYIAHDYSFDPVSEYLSFVDNGDFSVDGMVSDFPITASSSIDCFSHIGRNARKHV-D  369

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASG+YPGCTD AY KA+ DG D+IDC+
Sbjct  370  FLVISKNGASGNYPGCTDLAYEKAIKDGADVIDCS  404



>ref|XP_004952935.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like [Setaria italica]
Length=745

 Score =   268 bits (686),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 166/214 (78%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQ  LSMR+++LS+S++ + +YISSPEVNFL SI+ R++ R TKLVFRFL     EPST
Sbjct  178  YSQFKLSMRSYILSLSKQYIADYISSPEVNFLTSISGRVSKR-TKLVFRFLDERSIEPST  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L+NL  +KTFASGILVPK+YIWPV    +YL   TS+  DAHK GLE+YA+DF
Sbjct  237  NQTYGSMLKNLTFVKTFASGILVPKNYIWPV-TPDNYLLSYTSVAADAHKAGLEIYAADF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP+AEYL FIDN  +SVDGVL+DFPITPS A+ C+S++   + +    
Sbjct  296  ANDFTISYNYSYDPLAEYLYFIDNDAFSVDGVLTDFPITPSEAVGCFSNLNNSKTDHAKP  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY KAV DG D+IDC
Sbjct  356  -LVISHNGASGDYPDCTDQAYQKAVDDGADVIDC  388



>ref|NP_176870.2| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
 sp|D7SFH9.1|GPDL2_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase protein 
kinase domain-containing GDPDL2; AltName: Full=Glycerophosphodiester 
phosphodiesterase-like 2; Short=ATGDPDL2; AltName: 
Full=Protein SUPPRESSOR OF NPR1-1 CONSTITUTIVE 4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ADI71282.1| SNC4 [Arabidopsis thaliana]
 gb|AEE34581.1| suppressor of npr1-1 constitutive 4 [Arabidopsis thaliana]
Length=1118

 Score =   273 bits (697),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 167/214 (78%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F+LS SR V I++ISSPEVNF + IA          VF+F+G ++ EP+T
Sbjct  191  YEQHNLSMSSFLLSTSRTVSIDFISSPEVNFFRKIAGGFGNNGPSFVFQFMGKEDFEPTT  250

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL+ +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL++YAS F
Sbjct  251  NRTYGSILSNLSFVKTFASGILVPKSYILPLD-DKQYLLPHTSLVQDAHKAGLKLYASGF  309

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A++YS+DPV+EYLSF+DNGN+SVDG+LSDFP+T S ++DC+SH+ +    QV +
Sbjct  310  ANDVDIAYNYSWDPVSEYLSFVDNGNFSVDGMLSDFPLTASASVDCFSHIGRNATKQV-D  368

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            FLVIS +GASG+YPGCT  AY KA+ DG D+IDC
Sbjct  369  FLVISKNGASGEYPGCTKLAYEKAIKDGSDVIDC  402



>ref|XP_008782908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=767

 Score =   268 bits (686),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 163/214 (76%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSMR+++LS+S+RV+++Y+SSPEV FL SIA       TK +FRFL     EPST
Sbjct  188  YRQHNLSMRSYLLSLSKRVILSYVSSPEVIFLSSIAGTFKRTKTKFIFRFLDEATIEPST  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG+LL+NL  IKTFASGILVPK YIWPV  S  YLQP TS+VLDAHK GLEVYAS F
Sbjct  248  NQTYGALLKNLTFIKTFASGILVPKQYIWPV-TSDLYLQPYTSVVLDAHKEGLEVYASGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F+++YSYDP+AEYLSFIDNG +SVDGVL+DFPIT S AI C+S   K   ++  +
Sbjct  307  ANDAQFSYNYSYDPLAEYLSFIDNGIFSVDGVLTDFPITASEAIGCFSQ-TKANSSEHGK  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             +V S +GASG Y  CTD AY +AV DG D IDC
Sbjct  366  PVVFSHNGASGMYADCTDLAYQQAVKDGADFIDC  399



>ref|XP_009108190.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=758

 Score =   268 bits (685),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            + Q NLSM  F++S SR V INYISSPEVNF   I+ R        VF+FL  ++ EP+T
Sbjct  174  FEQQNLSMSKFLISASRIVSINYISSPEVNFFTKISGRFGRNGPLFVFQFLRKEDIEPTT  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L NL  +KTFASGILVPKSYI P+D     + P  SLV DAHK GL+VY S F
Sbjct  234  NQTYGSILSNLTFVKTFASGILVPKSYILPLDDKQYLVPPPKSLVQDAHKAGLQVYVSGF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  A DYS DPV+EYLSF+DNGN+SVDGVLSDFP+T S +IDC+SH+ +    QV  
Sbjct  294  ANDIDIAHDYSSDPVSEYLSFVDNGNFSVDGVLSDFPLTASSSIDCFSHLGQNAIKQV-N  352

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  353  FLVISKNGASGDYPGCTDLAYDKAIKDGADVIDCS  387



>emb|CDY46667.1| BnaA03g48410D [Brassica napus]
Length=1323

 Score =   273 bits (698),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+Q+NLSM  F++S S+ V I+YISSPEVNF   IA R        VFRFL  +  EP+T
Sbjct  178  YAQNNLSMSNFLISASKNVSIDYISSPEVNFFTKIAGRFGHNGPIFVFRFLEKETFEPTT  237

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N++YGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S F
Sbjct  238  NRSYGSILSNLTFVKTFASGILVPKSYVLPLD-DKQYLLPSTSLVQDAHKAGLEVFVSGF  296

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYSYDPV+EYLSF+DNGN+SVDGVLSDFPIT S +IDC+SH+ +    QV +
Sbjct  297  ANDVDIAHDYSYDPVSEYLSFVDNGNFSVDGVLSDFPITASASIDCFSHLGRNATKQV-D  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG  +IDC+
Sbjct  356  FLVISKNGASGDYPGCTDLAYDKAIRDGAGVIDCS  390



>ref|XP_009137635.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=1321

 Score =   273 bits (697),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+Q+NLSM  F++S S+ V I+YISSPEVNF   IA R        VFRFL  +  EP+T
Sbjct  176  YAQNNLSMSNFLISASKNVSIDYISSPEVNFFTKIAGRFGHNGPIFVFRFLEKETFEPTT  235

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N++YGS+L NL  +KTFASGILVPKSY+ P+D    YL P+TSLV DAHK GLEV+ S F
Sbjct  236  NRSYGSILSNLTFVKTFASGILVPKSYVLPLD-DKQYLLPSTSLVQDAHKAGLEVFVSGF  294

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A DYSYDPV+EYLSF+DNGN+SVDGVLSDFPI+ S +++C+SH+R+    QV +
Sbjct  295  ANDVDIAHDYSYDPVSEYLSFVDNGNFSVDGVLSDFPISASASVECFSHLRRNATKQV-D  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY KA+ DG  +IDC+
Sbjct  354  FLVISKNGASGDYPGCTDLAYDKAIRDGAGVIDCS  388



>ref|XP_010496108.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL1-like 
[Camelina sativa]
Length=764

 Score =   267 bits (683),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 164/216 (76%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F+LS SR V +++ISSPEVNF   IA R        VF+FL  +E EP+T
Sbjct  187  YEQHNLSMSSFLLSTSRTVSMDFISSPEVNFFMKIAGRFKRNGPSFVFQFLRKEEIEPTT  246

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWP-VDKSSSYLQPTTSLVLDAHKVGLEVYASD  358
            NQTYGS+L NL  +KTFASGILVPKSYI   VDK   YL P TSLV DAH  GLEVY S 
Sbjct  247  NQTYGSILSNLTFVKTFASGILVPKSYILRLVDKQ--YLVPHTSLVQDAHIAGLEVYVSG  304

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
            FA+DV  A++YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S ++DC++H+ +    QV 
Sbjct  305  FANDVDLAYNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASASVDCFAHIGRNATKQV-  363

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            +FLVIS DGASGDYP CT+ AY KA+ DG D+IDC+
Sbjct  364  DFLVISKDGASGDYPRCTNLAYEKAIKDGADVIDCS  399



>ref|XP_008798763.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1 isoform X1 [Phoenix dactylifera]
Length=763

 Score =   267 bits (682),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 165/214 (77%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSMR++VLS+++RV++NY+SS EV FL S+A       TK +FRF+     EPST
Sbjct  189  YTQHNLSMRSYVLSLAKRVILNYVSSAEVVFLSSVARTFKGTKTKFIFRFIDEAAIEPST  248

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL+NL  IKTFASGILVPK YI+PV  S  YLQP TS VLDAHK GLEV+AS F
Sbjct  249  NQTYGSLLKNLTFIKTFASGILVPKQYIYPV-TSDFYLQPHTSFVLDAHKEGLEVFASGF  307

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   +++YSYDP+AEYLSF+DNG +SVDGVL+DFP T S AI C+SH++    ++  +
Sbjct  308  ANDAIISYNYSYDPLAEYLSFVDNGIFSVDGVLTDFPKTASEAIGCFSHIQ-ANNSEHGK  366

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASG YP CTD AY +AV DGVD IDC
Sbjct  367  PLVISHNGASGTYPDCTDLAYQQAVKDGVDFIDC  400



>ref|XP_009127510.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=749

 Score =   266 bits (681),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLS+ +F++S SR V I+YISSP++NF   +  R        VF+FLG +E EP+T
Sbjct  178  YAQHNLSISSFLISASRTVSIDYISSPKLNFFSKVKGRFWRNEPSFVFQFLGKEEFEPTT  237

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             +TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL++Y S F
Sbjct  238  KRTYGSILSNLTYVKTFASGILVPKSYILPLD-DKQYLLPPTSLVQDAHKAGLKLYVSGF  296

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A++YS+DPV+EYLSF++NG +SVDGVLSDFPIT S +IDC+SH+ +  + Q+ +
Sbjct  297  ANDVDIAYNYSFDPVSEYLSFVNNGYFSVDGVLSDFPITASTSIDCFSHIGRNARKQM-D  355

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVI+ +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  356  FLVITKNGASGDYPGCTDLAYEKAIQDGADVIDCS  390



>emb|CDY13237.1| BnaC09g24190D [Brassica napus]
Length=759

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 162/217 (75%), Gaps = 4/217 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NLSM  F++S SR V INYISSPEVNF   IA R+       VF+FL  ++ EP+T
Sbjct  174  YEQQNLSMSNFLISASRIVSINYISSPEVNFFTKIAGRLRRNGPIYVFQFLRKEDIEPTT  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYL--QPTTSLVLDAHKVGLEVYAS  355
            N+TYGS+L NL  +KTFASGILVPKSYI P+D    YL   P  SLV DAH+ GL+VY S
Sbjct  234  NRTYGSILSNLTFVKTFASGILVPKSYILPLDD-KQYLVPPPPKSLVQDAHEAGLQVYVS  292

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQV  535
             FA+D+  A DYS DPV+EYLSF+DNGN+SVDGVLSDFP+T S +IDC+SH+ +    QV
Sbjct  293  GFANDIDIAHDYSSDPVSEYLSFVDNGNFSVDGVLSDFPLTASSSIDCFSHLGENAIKQV  352

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             +FLVIS +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  353  -DFLVISKNGASGDYPGCTDLAYDKAIKDGADVIDCS  388



>ref|XP_006300797.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33695.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=704

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NLSM +F+LS S  V I +ISSPEVNF   IA          VF+FL  ++ EP+T
Sbjct  191  YEQQNLSMSSFLLSASTTVSIYFISSPEVNFFMKIAGSFGRNGPSFVFQFLEKEDFEPTT  250

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L NL  +KTFASGILVPKSYI P++    YL P TSLV DAHK GL+VY S F
Sbjct  251  NQTYGSILSNLTFVKTFASGILVPKSYILPLNDKR-YLLPHTSLVQDAHKAGLQVYVSGF  309

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A++YS DPV+EYLSF+DNGN+SVDG+LSDFP+T S +IDC+SH+ +     V +
Sbjct  310  ANDVDIAYNYSSDPVSEYLSFVDNGNFSVDGMLSDFPLTASSSIDCFSHIGRNATKHV-D  368

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY  A+ DG D+IDC+
Sbjct  369  FLVISKNGASGDYPGCTDLAYENAIKDGADVIDCS  403



>gb|AAF98210.1|AC007152_6 Unknown protein [Arabidopsis thaliana]
Length=1111

 Score =   266 bits (679),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 168/226 (74%), Gaps = 13/226 (6%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F+LS SR V I++ISSPEVNF + IA          VF+F+G ++ EP+T
Sbjct  180  YEQHNLSMSSFLLSTSRTVSIDFISSPEVNFFRKIAGGFGNNGPSFVFQFMGKEDFEPTT  239

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+L NL+ +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL++YAS F
Sbjct  240  NRTYGSILSNLSFVKTFASGILVPKSYILPLD-DKQYLLPHTSLVQDAHKAGLKLYASGF  298

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ---  532
            A+DV  A++YS+DPV+EYLSF+DNGN+SVDG+LSDFP+T S ++DC+SH+ +    Q   
Sbjct  299  ANDVDIAYNYSWDPVSEYLSFVDNGNFSVDGMLSDFPLTASASVDCFSHIGRNATKQEQK  358

Query  533  ---VP------EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
               +P      +FLVIS +GASG+YPGCT  AY KA+ DG D+IDC
Sbjct  359  HYHLPMVRASVDFLVISKNGASGEYPGCTKLAYEKAIKDGSDVIDC  404



>ref|XP_009127505.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Brassica rapa]
Length=1313

 Score =   267 bits (682),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 164/215 (76%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM +F++S SR V I+YISSPE+NF + +           VF+FLG ++ EP+T
Sbjct  176  YAQHNLSMSSFLVSASRTVSIDYISSPELNFFQKLTGHFGRNGPSFVFKFLGKEDFEPTT  235

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             +TYGS+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S F
Sbjct  236  KRTYGSILSNLTYVKTFASGILVPKSYILPLD-DKQYLLPPTSLVHDAHKAGLQVYVSGF  294

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            ++D   A++YS+DPV+EYLSF+DNG++SVDGVLSDFPIT S +IDC+SH+ +    QV +
Sbjct  295  SNDADIAYNYSFDPVSEYLSFMDNGDFSVDGVLSDFPITASASIDCFSHIGRNATKQV-D  353

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS  GASGDYPGCT+ AY KA+ DG D+IDC+
Sbjct  354  FLVISKHGASGDYPGCTNLAYDKAIKDGADVIDCS  388



>ref|XP_006300799.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
 gb|EOA33697.1| hypothetical protein CARUB_v10019878mg [Capsella rubella]
Length=701

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NLSM +F+LS S  V I +ISSPEVNF   IA          VF+FL  ++ EP+T
Sbjct  191  YEQQNLSMSSFLLSASTTVSIYFISSPEVNFFMKIAGSFGRNGPSFVFQFLEKEDFEPTT  250

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGS+L NL  +KTFASGILVPKSYI P++    YL P TSLV DAHK GL+VY S F
Sbjct  251  NQTYGSILSNLTFVKTFASGILVPKSYILPLNDKR-YLLPHTSLVQDAHKAGLQVYVSGF  309

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A++YS DPV+EYLSF+DNGN+SVDG+LSDFP+T S +IDC+SH+ +     V +
Sbjct  310  ANDVDIAYNYSSDPVSEYLSFVDNGNFSVDGMLSDFPLTASSSIDCFSHIGRNATKHV-D  368

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCTD AY  A+ DG D+IDC+
Sbjct  369  FLVISKNGASGDYPGCTDLAYENAIKDGADVIDCS  403



>ref|XP_006279181.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12079.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=677

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NLS+ +F+LSVSR V I++ISSPEVNF   I  +        VFRFL  ++ E +T
Sbjct  191  YEQQNLSISSFLLSVSRTVSIDFISSPEVNFFMKIVGQFGRNGPTSVFRFLRKEDFEQTT  250

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY S+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S F
Sbjct  251  NQTYSSILSNLTFVKTFASGILVPKSYILPLD-DKQYLLPHTSLVQDAHKAGLQVYVSGF  309

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A +YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC+SH+ +     V +
Sbjct  310  ANDVDIAHNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASSSIDCFSHIGRNATKHV-D  368

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCT+ AY KA+ DG D+IDC+
Sbjct  369  FLVISKNGASGDYPGCTNLAYEKAIKDGADVIDCS  403



>ref|XP_004500131.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Cicer arietinum]
Length=704

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 164/215 (76%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRR-VVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  178
            Y  HNLS++ F+LS+S + V INYISS  V+FL+ + S  + R + L+FRFL   + EP+
Sbjct  172  YKHHNLSVKKFLLSLSTKGVSINYISSTNVDFLRRVRSNSSLRKSILIFRFLEKHKIEPT  231

Query  179  TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  358
            TNQTYG+LL+NL  I+ FASGILVPK YIWPVD S  YLQ  TS+V DAHK GL+V+ S+
Sbjct  232  TNQTYGALLKNLTLIRKFASGILVPKGYIWPVD-SELYLQQHTSIVSDAHKKGLKVFVSE  290

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
              +DV F++++SYDP+AE LSFIDNGN+SVDGVLSDFP+TPS AI+C S + K  K QV 
Sbjct  291  IVNDVSFSYNFSYDPMAECLSFIDNGNFSVDGVLSDFPVTPSAAINCLSGLGKKAKKQV-  349

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            E LVI+  GASGDYP CTD AY KA SDG D++DC
Sbjct  350  ETLVITKYGASGDYPACTDLAYKKAKSDGADVLDC  384



>emb|CDY58867.1| BnaC09g52640D [Brassica napus]
Length=722

 Score =   260 bits (665),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/213 (62%), Positives = 158/213 (74%), Gaps = 8/213 (4%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM  F+LSVS+ V+I+Y+SSPE+ F + I SR      K VFRFL  DE E ST
Sbjct  151  YAQHNLSMSRFLLSVSKTVIIDYLSSPELKFFRDIGSRFGKTGPKFVFRFLEKDEVEVST  210

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSL+ NL  I  FASG+LVPKSYIWPVD+   YL P T+ V DAHK GL+VYAS F
Sbjct  211  NQTYGSLMTNLTFINMFASGVLVPKSYIWPVDE-DQYLLPHTTFVQDAHKEGLQVYASGF  269

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D   A++YSYDP+AEYLSF+DNGN+SVDGV+SDFP+T S A+      RKG       
Sbjct  270  ANDFDLAYNYSYDPLAEYLSFMDNGNFSVDGVVSDFPLTASSAVVLLLQ-RKGI------  322

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIID  640
            F VIS +GASGDYPGC+D AYSKA+ DG DIID
Sbjct  323  FFVISKNGASGDYPGCSDLAYSKAIEDGADIID  355



>ref|XP_008799657.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Phoenix dactylifera]
Length=760

 Score =   259 bits (663),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 161/215 (75%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H L    FVL+ S +VV +YISSP + FLKS++ ++    TKL+FRFL  D  EPST
Sbjct  181  YKEHKLDPAKFVLTASEKVVFDYISSPGIGFLKSLSGKLGKAKTKLIFRFLDADAVEPST  240

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY S+L+NL++IK+FASGILVPKSYIWPV+K + YL+P+T+LV DAH +GLEVYAS+F
Sbjct  241  NQTYSSILKNLSTIKSFASGILVPKSYIWPVNKDN-YLEPSTTLVTDAHNLGLEVYASNF  299

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D P +++YS+DP AEYL F DN N+SVDGV +DFP T S AI C +H +     +   
Sbjct  300  ANDQPASYNYSFDPTAEYLQFTDNPNFSVDGVFTDFPSTASAAIACLAHNKDNAAAKKKR  359

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG + GCTD AY +AV DG DIIDC+
Sbjct  360  PLIITRNGASGVFAGCTDLAYQQAVKDGADIIDCS  394



>ref|XP_010511611.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
protein kinase domain-containing GDPDL2-like [Camelina 
sativa]
Length=1150

 Score =   263 bits (673),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 164/226 (73%), Gaps = 12/226 (5%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F+L  SR V +++ISSPEVNF K IA R        VF+FLG ++ EP+T
Sbjct  212  YKQHNLSMSSFILXASRTVSMDFISSPEVNFFKKIAGRFKRNGPSFVFQFLGKEDFEPTT  271

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG +L NL  +KT+ASGILVPKSYI+ +D    YL P TSLV DAHK GLEVY S F
Sbjct  272  NQTYGFILSNLTFVKTYASGILVPKSYIFQLD-DKQYLIPHTSLVQDAHKAGLEVYVSGF  330

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHM----------  511
            A+DV  A++YSYDPV+EYLSF+DNG++SVDGVLSDFP+T S +IDC+S++          
Sbjct  331  ANDVDIAYNYSYDPVSEYLSFVDNGDFSVDGVLSDFPLTASASIDCFSYIGRNPTKPLIN  390

Query  512  -RKGQKNQVPEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             R    +   EFLVIS DGASGDYP CT+ AY KA+ DG D+IDC+
Sbjct  391  QRTNPVHASVEFLVISKDGASGDYPRCTNLAYVKAIKDGADVIDCS  436



>ref|XP_006279182.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
 gb|EOA12080.1| hypothetical protein CARUB_v10007932mg [Capsella rubella]
Length=760

 Score =   259 bits (662),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 161/215 (75%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NLS+ +F+LSVSR V I++ISSPEVNF   I  +        VFRFL  ++ E +T
Sbjct  191  YEQQNLSISSFLLSVSRTVSIDFISSPEVNFFMKIVGQFGRNGPTSVFRFLRKEDFEQTT  250

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY S+L NL  +KTFASGILVPKSYI P+D    YL P TSLV DAHK GL+VY S F
Sbjct  251  NQTYSSILSNLTFVKTFASGILVPKSYILPLDDKQ-YLLPHTSLVQDAHKAGLQVYVSGF  309

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A +YS+DPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC+SH+ +     V +
Sbjct  310  ANDVDIAHNYSFDPVSEYLSFVDNGDFSVDGMLSDFPLTASSSIDCFSHIGRNATKHV-D  368

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            FLVIS +GASGDYPGCT+ AY KA+ DG D+IDC+
Sbjct  369  FLVISKNGASGDYPGCTNLAYEKAIKDGADVIDCS  403



>ref|XP_006660255.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Oryza brachyantha]
Length=785

 Score =   258 bits (660),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QH L+M  ++LS+S+   + YISSPE+ FL+SI  R+N R TKLVFRF     ++PS+
Sbjct  196  YRQHGLNMTKYILSISKNAAVKYISSPELGFLRSILGRVN-RKTKLVFRFPDAASSDPSS  254

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL NL  IKT ASGI+VPK YIWPV  +++Y+QP+ S+V DAH  GLE+YASDF
Sbjct  255  NQTYGSLLSNLTFIKTVASGIIVPKEYIWPVAPNNNYIQPSKSIVGDAHNAGLEIYASDF  314

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDPV EYL F+ NGN+SVDGVL++ P+T + AI C++++    K     
Sbjct  315  ANDRIIPYNYSYDPVEEYLHFVGNGNFSVDGVLTEHPVTAAMAIGCFTNLNVSSKTDHGN  374

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+IS +GASGDYP CTD AY KAV DG D+IDCT
Sbjct  375  PLIISHNGASGDYPDCTDLAYQKAVDDGADVIDCT  409



>ref|XP_010928375.1| PREDICTED: LOW QUALITY PROTEIN: glycerophosphodiester phosphodiesterase 
GDPDL7-like [Elaeis guineensis]
Length=768

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H L    F+L+ S  VV +YISSPE+ FLKS+  ++    TKL+FRFL  D  EPST
Sbjct  189  YKEHKLDPAKFILTASENVVFDYISSPEIGFLKSLNGKLGKAKTKLIFRFLAADAVEPST  248

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY  +L+NLA+IK+FASGILVPKSY+WP +K   YL+P+T+LV DAH +GLEVYA +F
Sbjct  249  NQTYSLILKNLATIKSFASGILVPKSYVWPANKDK-YLEPSTTLVTDAHNLGLEVYAFNF  307

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D P +++YS+DP AEYL FIDN N+SVDGV +DFP T S AI C +H +     Q   
Sbjct  308  ANDQPASYNYSFDPTAEYLQFIDNPNFSVDGVFTDFPSTASAAIACLAHNKDNAAAQKKR  367

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG + GCTD AY +AV DG DIIDC+
Sbjct  368  PLIITRNGASGVFAGCTDLAYQQAVKDGADIIDCS  402



>ref|XP_010496109.1| PREDICTED: glycerophosphodiester phosphodiesterase protein kinase 
domain-containing GDPDL2-like [Camelina sativa]
Length=1128

 Score =   261 bits (668),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 168/229 (73%), Gaps = 18/229 (8%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QHNLSM +F++SVSR V I++ISSPEVNF K I  R        VF+FLG ++ EP+T
Sbjct  193  YEQHNLSMSSFLVSVSRTVSIDFISSPEVNFFKKITGRFKLNGPSFVFQFLGKEDFEPTT  252

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPV-DKSSSYLQPTTSLVLDAHKVGLEVYASD  358
            N+TYGS+L NL  +KTFAS ILVPKSYI+P+ DK   YL P TSLV DAHK GLEVY S 
Sbjct  253  NRTYGSILSNLTFVKTFASKILVPKSYIFPLGDK--QYLLPPTSLVQDAHKAGLEVYVSG  310

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
            FA+DV  A++YSYDPV+EYLSF+DNG++SVDG+LSDFP+T S +IDC+S++  G+    P
Sbjct  311  FANDVDLAYNYSYDPVSEYLSFVDNGDFSVDGMLSDFPLTASASIDCFSYI--GRNPTKP  368

Query  539  -------------EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
                         +FLVIS DGASGDYP CT+ AY KA+ DG D+IDC+
Sbjct  369  LINQGTDPVHASVDFLVISKDGASGDYPRCTNLAYEKAIKDGADVIDCS  417



>ref|XP_002888566.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64825.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=1089

 Score =   261 bits (666),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 162/214 (76%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q N SM +F+LS +R V I++ISSPEV F + IA R        VF+FLG ++ EP+T
Sbjct  172  YEQQNYSMSSFLLSAARTVSIDFISSPEVGFFRKIAGRYGRNGPSFVFQFLGKEDFEPTT  231

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TYGS+  NL  +KTFASGILVPKSYI  +D    YL P TSLV DAHK GL++YAS F
Sbjct  232  NRTYGSIFNNLTYVKTFASGILVPKSYILQLD-DKHYLLPPTSLVQDAHKAGLKLYASGF  290

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV  A++YS+DPV+EYLSF+DNG +SVDGVLSDFP+T S ++DC+SH+ +    QV +
Sbjct  291  ANDVDIAYNYSWDPVSEYLSFVDNGVFSVDGVLSDFPLTASASVDCFSHVGRNATKQV-D  349

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            FLVIS +GASGDYPGCT+ AY KA+ DG ++IDC
Sbjct  350  FLVISKNGASGDYPGCTNLAYEKAIRDGAEVIDC  383



>ref|XP_010109457.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
 gb|EXC22605.1| putative glycerophosphoryl diester phosphodiesterase 3 [Morus 
notabilis]
Length=749

 Score =   257 bits (656),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 162/215 (75%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+Q+ LS   ++   ++ ++INY+SSPE+ FLK++  ++N   TKL+F+FLG ++ EP+T
Sbjct  172  YNQNKLSPAAYIEQSAKHMIINYLSSPEIGFLKTMGGKVNKLKTKLIFQFLGPEQVEPTT  231

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ Y S+LQNL ++K+FASGILVPK YIWPV  SS YL   TSLV DAHK GLEVYAS F
Sbjct  232  NQKYSSILQNLTTVKSFASGILVPKEYIWPV-SSSGYLGKPTSLVADAHKQGLEVYASGF  290

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            ++DVP +++YSYDP AEY+ ++DN  +SVDGVL+DFP T S AI C++H + G K +   
Sbjct  291  SNDVPTSYNYSYDPTAEYIQYVDNSQFSVDGVLTDFPPTASEAIACFAHNKNGDKPRKGS  350

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+IS +GASG YPG TD AY +AV DG DIIDC+
Sbjct  351  ALIISNNGASGIYPGSTDLAYQQAVDDGADIIDCS  385



>ref|XP_006856834.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
 gb|ERN18301.1| hypothetical protein AMTR_s00055p00174750 [Amborella trichopoda]
Length=763

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 165/214 (77%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            + QHNLSMR++V+SVSR++V++YISSP+V FL SI +R     TKLVFRFL  D  EP T
Sbjct  182  FRQHNLSMRSYVISVSRQMVVDYISSPDVAFLSSIGARFKGSKTKLVFRFLEVDAVEPLT  241

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQ+YGSLL+NL  +KTFASGILVPK YIWP + S +YL+P +++V DAHK GLE YA  F
Sbjct  242  NQSYGSLLKNLTFVKTFASGILVPKDYIWPTN-SDNYLEPHSAVVRDAHKEGLEAYAYGF  300

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            ++DVP + +YSYDP+AE L++IDNG +SVDGVL+DFP+T S A+ C+SH+     ++  +
Sbjct  301  SNDVPLSHNYSYDPLAECLNYIDNGEFSVDGVLTDFPVTASEAVGCFSHVNPNTSDK-GK  359

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASG Y   TD AY +AVSDG D+IDC
Sbjct  360  PLVISHNGASGIYADSTDLAYRQAVSDGADVIDC  393



>ref|XP_010485211.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=431

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 156/215 (73%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSAAEYLRSLRFRG-INVISSPEIGFLKSIGMDAGRAKTKLIFEFKDPEAIEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V DAHK GLEVYAS F
Sbjct  237  NKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YS+DP AEYL F+DNG +SVDG+++DFP T S AI C+SH +KG   +V  
Sbjct  296  ANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGIITDFPPTASQAITCFSH-QKGNLPKVGN  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVI+ +GASGDYPGCTD AY KAV+DG D+IDC+
Sbjct  355  ALVITHNGASGDYPGCTDLAYEKAVNDGADVIDCS  389



>ref|XP_009399679.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=772

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 161/214 (75%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y Q NL MR ++L +S+  + +Y+SSPEV FL SI  R     TKL+FRFLG D  EPST
Sbjct  195  YRQLNLDMRRYLLYLSKHDIPSYVSSPEVGFLSSIVGRFRTSKTKLIFRFLGEDTIEPST  254

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N TYGSLL+NL  +KTFASGIL+PK YIWPV  SS YL+  TS+V+DAH+ GLEV+AS+F
Sbjct  255  NVTYGSLLKNLTFVKTFASGILIPKYYIWPV-TSSGYLESYTSVVMDAHREGLEVFASEF  313

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D  F+++YSYDP+AE LSFIDNG +SVDGV++DFPIT S AI CYSH+     +   +
Sbjct  314  ANDALFSYNYSYDPLAEVLSFIDNGIFSVDGVVTDFPITASEAIGCYSHINMSNSDH-GK  372

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASG YP CTD +Y +A++DG D IDC
Sbjct  373  PLIISHNGASGVYPDCTDLSYQQAITDGADYIDC  406



>ref|XP_008811210.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
3 isoform X2 [Phoenix dactylifera]
Length=600

 Score =   252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 158/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H L    F+L+   ++  +YISSPE++FLKS+  ++    TKL+FRF   +E EPST
Sbjct  193  YKEHKLDPAKFILTALEKMDFDYISSPEIDFLKSLNGKLGQAKTKLIFRFQDEEEVEPST  252

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY S+L+NLA+IK+FASGILVPKSYIWPV K   YL+  T+LV DAHK+GLEV+A +F
Sbjct  253  NQTYSSILKNLATIKSFASGILVPKSYIWPVSKDM-YLESATTLVTDAHKLGLEVHAYNF  311

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D P +++YS+DP AEYL FID+ N+SVDGVL+DFP T S A+ C +H +    +    
Sbjct  312  ANDQPVSYNYSFDPTAEYLQFIDHSNFSVDGVLTDFPSTASAAVACLAHNKDSAASNKKR  371

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG + GCTD AY +AV DG DIIDC+
Sbjct  372  SLIITRNGASGVFAGCTDLAYQQAVKDGADIIDCS  406



>gb|AES70468.2| glycerophosphoryl diester phosphodiesterase family protein [Medicago 
truncatula]
Length=717

 Score =   253 bits (647),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 163/215 (76%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVS-RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  178
            Y  HNLS+  ++ S+S  +V I+YISSP  NFL+ +  + + + T  VFRFL   + EP+
Sbjct  176  YKHHNLSVEKYLHSLSAEKVTISYISSPNANFLQRVRKKSSLKKTVTVFRFLDQYKIEPT  235

Query  179  TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  358
            +N+TYG+LL++L  I+TFASGILVPKSYIW VD S  YL   TSLV DAHK GL+V+ SD
Sbjct  236  SNKTYGALLKHLKFIRTFASGILVPKSYIWSVD-SELYLHQHTSLVSDAHKHGLKVFVSD  294

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
              +DVPF++++SYDP+AE LSFIDNGN+SVDGVLSDFP+TPS AI+C++ + +  K QV 
Sbjct  295  IVNDVPFSYNFSYDPMAEVLSFIDNGNFSVDGVLSDFPVTPSAAINCFAGIGRNAKKQV-  353

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            E L+I+  GASGDYP CTD AY KA SDG D+IDC
Sbjct  354  ETLIITKYGASGDYPACTDLAYKKAKSDGADVIDC  388



>ref|XP_007146557.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
 gb|ESW18551.1| hypothetical protein PHAVU_006G050600g [Phaseolus vulgaris]
Length=667

 Score =   252 bits (644),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 141/170 (83%), Gaps = 0/170 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QHNLSM+ F+  V   V ++YISSPE  FLKSI + INP++TKLVFRFLG +E +PST
Sbjct  182  YTQHNLSMKNFIRFVYTTVNVSYISSPEAGFLKSIKTDINPKITKLVFRFLGKEEVDPST  241

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             QTYGSLLQNL  IKTFASGILVPK YIWPVD +S YLQP TSLV DAHKVGLEV+AS F
Sbjct  242  KQTYGSLLQNLTFIKTFASGILVPKDYIWPVDPTSHYLQPHTSLVSDAHKVGLEVFASTF  301

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHM  511
             +D+P +++YSYDP  E+LSFI+NGN+SVDGVLSDFP+T S AIDC+ HM
Sbjct  302  QNDIPISYNYSYDPFFEHLSFIENGNFSVDGVLSDFPLTSSAAIDCFVHM  351



>ref|XP_010443532.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=546

 Score =   249 bits (636),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 156/215 (73%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSAAEYLRSLQFRG-INVISSPEIGFLKSIGMDAGRAKTKLIFEFKDPEAIEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V DAHK GLEVYAS F
Sbjct  237  NKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YS+DP AEYL F+DNG +SVDG+++DFP T S AI C+SH +KG   +V  
Sbjct  296  ANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGIITDFPPTASQAITCFSH-QKGNLPKVGN  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVIS +GASGDYPGCTD AY KAV+DG D+IDC+
Sbjct  355  ALVISHNGASGDYPGCTDLAYEKAVNDGADVIDCS  389



>ref|XP_003600217.1| Glycerophosphodiesterase-like protein [Medicago truncatula]
Length=740

 Score =   253 bits (647),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 163/215 (76%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVS-RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  178
            Y  HNLS+  ++ S+S  +V I+YISSP  NFL+ +  + + + T  VFRFL   + EP+
Sbjct  199  YKHHNLSVEKYLHSLSAEKVTISYISSPNANFLQRVRKKSSLKKTVTVFRFLDQYKIEPT  258

Query  179  TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  358
            +N+TYG+LL++L  I+TFASGILVPKSYIW VD S  YL   TSLV DAHK GL+V+ SD
Sbjct  259  SNKTYGALLKHLKFIRTFASGILVPKSYIWSVD-SELYLHQHTSLVSDAHKHGLKVFVSD  317

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
              +DVPF++++SYDP+AE LSFIDNGN+SVDGVLSDFP+TPS AI+C++ + +  K QV 
Sbjct  318  IVNDVPFSYNFSYDPMAEVLSFIDNGNFSVDGVLSDFPVTPSAAINCFAGIGRNAKKQV-  376

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            E L+I+  GASGDYP CTD AY KA SDG D+IDC
Sbjct  377  ETLIITKYGASGDYPACTDLAYKKAKSDGADVIDC  411



>ref|XP_009385529.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Musa acuminata subsp. malaccensis]
Length=622

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 160/215 (74%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            + +H   + T++ + S ++VI+YISSPE+ FLKS++ ++    TKL+FRFL  D+ EPS 
Sbjct  43   FKEHKQDVATYITTASEQMVIDYISSPEIAFLKSLSGKLRSGKTKLIFRFLEVDDVEPSA  102

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             QTY +LL +L++IK+FASGILVPKSYIWPV+K   YL+P TSLV DAH +GLEVYAS+F
Sbjct  103  KQTYKALLTDLSTIKSFASGILVPKSYIWPVNKDQ-YLEPHTSLVTDAHNLGLEVYASNF  161

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +++YS+DP AEYL FIDN N+SVDGVL+DFP T S A+ C +H +         
Sbjct  162  ANDMPASYNYSFDPTAEYLQFIDNSNFSVDGVLTDFPSTASEAVACLAHNKNNTLPTEGR  221

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG + GCTD AY +A  DG DI+DC+
Sbjct  222  PLIITHNGASGVFAGCTDLAYQQAAEDGADILDCS  256



>ref|XP_009120321.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Brassica rapa]
Length=755

 Score =   253 bits (645),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 157/215 (73%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  I +ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSPAEYLRSLGFRG-ITFISSPEIGFLKSIGRDAVMSKTKLIFEFKDPEAMEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  +LQNLA+IK FASG+LVPK YIWP+D ++ YL+P T+LV DAHK GLEVYAS F
Sbjct  237  NKKYSEILQNLAAIKAFASGVLVPKGYIWPID-TAKYLKPATTLVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +F+YSYDP AEYL F+DNG +SVDGV++DFP T S AI C+SH +KG   +   
Sbjct  296  ANDMPASFNYSYDPSAEYLQFVDNGQFSVDGVVTDFPPTASQAISCFSH-QKGNLPKAGH  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVI+ +GASGDYPGCTD AY KAV DG D+IDC+
Sbjct  355  ALVITHNGASGDYPGCTDLAYQKAVEDGADVIDCS  389



>ref|XP_003553031.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=722

 Score =   252 bits (643),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 162/215 (75%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  178
            + Q NLS+  F+ S+ ++ V +NYISSP+V+FL+ + S  +   T  +FRFL   + EP+
Sbjct  177  FKQQNLSVENFLQSLPAKSVPVNYISSPDVDFLRRVKSSFSSGPTGFIFRFLEQSKLEPT  236

Query  179  TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  358
            TNQTYG LL+NL  IKTFASGILVPK YIWPVD S  YLQP T LV DAH+ GL+V+ SD
Sbjct  237  TNQTYGELLKNLMLIKTFASGILVPKGYIWPVD-SGLYLQPHTPLVTDAHREGLQVFVSD  295

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
              +DVPF++++SYDP+AE LSFID  ++SVDGVLSDFP+TPS AI+C+S + K  K QV 
Sbjct  296  LTNDVPFSYNFSYDPLAECLSFIDGDDFSVDGVLSDFPVTPSAAINCFSGLGKNAKKQV-  354

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            + LVI+  GASGD P CTD AY++A SDG D++DC
Sbjct  355  DTLVITKYGASGDNPACTDLAYNQAKSDGADVLDC  389



>ref|XP_010446175.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6-like, 
partial [Camelina sativa]
Length=630

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 156/215 (73%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  54   YMEHKLSAAEYLRSLRLRG-INVISSPEIGFLKSIGMDAGRAKTKLIFEFKDPEAIEPTT  112

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V DAHK GLEVYAS F
Sbjct  113  NKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFVADAHKAGLEVYASGF  171

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YS+DP AEYL F+DNG +SVDG+++DFP T S AI C+SH +KG   +V  
Sbjct  172  ANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGIITDFPPTASQAITCFSH-QKGNLPKVGN  230

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVIS +GASGDYPGCTD AY KAV+DG D+IDC+
Sbjct  231  ALVISHNGASGDYPGCTDLAYEKAVNDGADVIDCS  265



>emb|CDY43885.1| BnaC09g33580D [Brassica napus]
Length=751

 Score =   251 bits (642),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 156/215 (73%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  I +ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSPAEYLRSLGFRG-ITFISSPEIGFLKSIGRDAVMSKTKLIFEFKDPEAMEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  +LQNLA+IK FASG+LVPK YIWP+D S+ YL+P T+LV DAHK GLEVYAS F
Sbjct  237  NKKYSEILQNLAAIKAFASGVLVPKGYIWPID-SAKYLKPATTLVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +F+YSYDP AEYL F+DNG +SVDG ++DFP T S AI C+SH +KG   +   
Sbjct  296  ANDMPASFNYSYDPSAEYLQFVDNGQFSVDGFITDFPPTASQAITCFSH-QKGNLPKAGH  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVI+ +GASGDYPGCTD AY KAV DG D+IDC+
Sbjct  355  ALVITHNGASGDYPGCTDLAYQKAVEDGADVIDCS  389



>ref|XP_008811209.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 isoform X1 [Phoenix dactylifera]
Length=768

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 158/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H L    F+L+   ++  +YISSPE++FLKS+  ++    TKL+FRF   +E EPST
Sbjct  193  YKEHKLDPAKFILTALEKMDFDYISSPEIDFLKSLNGKLGQAKTKLIFRFQDEEEVEPST  252

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY S+L+NLA+IK+FASGILVPKSYIWPV K   YL+  T+LV DAHK+GLEV+A +F
Sbjct  253  NQTYSSILKNLATIKSFASGILVPKSYIWPVSKDM-YLESATTLVTDAHKLGLEVHAYNF  311

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D P +++YS+DP AEYL FID+ N+SVDGVL+DFP T S A+ C +H +    +    
Sbjct  312  ANDQPVSYNYSFDPTAEYLQFIDHSNFSVDGVLTDFPSTASAAVACLAHNKDSAASNKKR  371

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG + GCTD AY +AV DG DIIDC+
Sbjct  372  SLIITRNGASGVFAGCTDLAYQQAVKDGADIIDCS  406



>ref|XP_003530776.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2-like [Glycine max]
Length=727

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 161/215 (75%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  178
            + Q NLS+  F+ S+  R V +NYISSP+V+FL+ + S  +   T  +FR L   + EP+
Sbjct  177  FKQQNLSVENFLQSLPGRSVPVNYISSPDVDFLRRVKSSFSSGPTSFIFRILEQSKIEPT  236

Query  179  TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  358
            TNQTYG LL+NLA IKTF+SGILVPK YIWPVD S  YLQP T LV DAH+ GL+V+ SD
Sbjct  237  TNQTYGELLKNLALIKTFSSGILVPKGYIWPVD-SDHYLQPHTPLVTDAHREGLQVFVSD  295

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
              +DVPF++++SYDP+AE LSFID  ++SVDGVLSDFP+TPS AI+C+S + +  K QV 
Sbjct  296  LTNDVPFSYNFSYDPLAECLSFIDGDDFSVDGVLSDFPVTPSAAINCFSGLGENAKRQV-  354

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            + LVI+  GASGD P CTD AY++A SDG D++DC
Sbjct  355  DTLVITKYGASGDNPACTDLAYNQAKSDGADVLDC  389



>ref|NP_001062173.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAD09276.1| putative glycerophosphoryl diester phosphodiesterase 2 precursor 
[Oryza sativa Japonica Group]
 dbj|BAF24087.1| Os08g0503200 [Oryza sativa Japonica Group]
 dbj|BAG89421.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89557.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83836.1| hypothetical protein OsI_29787 [Oryza sativa Indica Group]
 gb|EEE68959.1| hypothetical protein OsJ_27854 [Oryza sativa Japonica Group]
Length=778

 Score =   251 bits (641),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QH L+M  ++LS+ +   + YISSPE+ FL+SI+ R+N R TKLVFRFL    ++PS+
Sbjct  192  YRQHGLNMTKYILSIPKGGSVQYISSPELGFLQSISGRVN-RKTKLVFRFLDATSSDPSS  250

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL NL  IKT ASGI+VPK YIWPV  +++Y+QP  S+V DAH  GLE+YASDF
Sbjct  251  NQTYGSLLSNLTFIKTVASGIMVPKEYIWPV-TTNNYIQPAKSIVRDAHSAGLEIYASDF  309

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDP+ EYL F+ + N+SVDGVLS+FP+T + AI C++++    K     
Sbjct  310  ANDRIIPYNYSYDPLEEYLHFVGSDNFSVDGVLSEFPLTAAAAIGCFTNLNVSSKTDHGS  369

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+IS +GASGDYP CTD AY KAV DG D+IDC+
Sbjct  370  PLIISHNGASGDYPDCTDLAYQKAVDDGADVIDCS  404



>gb|KHM99502.1| Putative glycerophosphoryl diester phosphodiesterase 2 [Glycine 
soja]
Length=727

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/215 (58%), Positives = 161/215 (75%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSV-SRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  178
            + Q NLS+  F+ S+  R V +NYISSP+V+FL+ + S  +   T  +FR L   + EP+
Sbjct  177  FKQQNLSVENFLQSLPGRSVPVNYISSPDVDFLRRVKSSFSSGPTSFIFRILEQSKIEPT  236

Query  179  TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  358
            TNQTYG LL+NLA IKTF+SGILVPK YIWPVD S  YLQP T LV DAH+ GL+V+ SD
Sbjct  237  TNQTYGELLKNLALIKTFSSGILVPKGYIWPVD-SDHYLQPHTPLVTDAHREGLQVFVSD  295

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
              +DVPF++++SYDP+AE LSFID  ++SVDGVLSDFP+TPS AI+C+S + +  K QV 
Sbjct  296  LTNDVPFSYNFSYDPLAECLSFIDGDDFSVDGVLSDFPVTPSAAINCFSGLGENAKRQV-  354

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            + LVI+  GASGD P CTD AY++A SDG D++DC
Sbjct  355  DTLVITKYGASGDNPACTDLAYNQAKSDGADVLDC  389



>ref|XP_007146552.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
 gb|ESW18546.1| hypothetical protein PHAVU_006G050300g [Phaseolus vulgaris]
Length=714

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 160/215 (74%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLS-VSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPS  178
            + Q NLS+ TF+ S V++ V ++YISSP+V FLK + S  +   T L+FR L   + EP+
Sbjct  181  FKQQNLSVETFLRSLVAKNVTVSYISSPDVGFLKRVKSIFSHGTTSLIFRVLEQSKIEPT  240

Query  179  TNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASD  358
            TNQ+YG LL+NLA IK FASGILVPK YIWPVD SS YLQP TSLV DAHK  L+V+ SD
Sbjct  241  TNQSYGKLLKNLAQIKAFASGILVPKGYIWPVD-SSLYLQPHTSLVSDAHKEKLQVFVSD  299

Query  359  FASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVP  538
              +DVPF++++SYDPVAE LSF + G++SVDGVLSDFP+TPS AI+C+S   K    QV 
Sbjct  300  HINDVPFSYNFSYDPVAECLSFFNVGDFSVDGVLSDFPVTPSVAINCFSGQGKNGTKQV-  358

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
            + LVI+  GASGD P CTD AY KA SDG D++DC
Sbjct  359  DTLVITKYGASGDNPACTDLAYKKAKSDGADVLDC  393



>ref|XP_010687738.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687740.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010687741.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Beta vulgaris subsp. vulgaris]
Length=751

 Score =   250 bits (639),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 150/199 (75%), Gaps = 1/199 (1%)
 Frame = +2

Query  50   RRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSLLQNLASIKT  229
            R   INYISSPE+ FLKSIA++++   TKLV RFL  +  EP+T Q YG +L+NLA+IK 
Sbjct  190  RFAGINYISSPEIGFLKSIAAKVDKVRTKLVLRFLEPEAVEPTTKQAYGEILKNLAAIKP  249

Query  230  FASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFAFDYSYDPVA  409
            +ASGILVPK+YIWP++K   YL P T+LV DAHK GLEVYAS FA+D P +F+YSYDP A
Sbjct  250  YASGILVPKTYIWPINKEM-YLMPPTTLVNDAHKEGLEVYASGFANDSPGSFNYSYDPTA  308

Query  410  EYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFDGASGDYPGC  589
            EYL FIDNG +SVDGVL+DF  T S AI C +H +   + Q    L+IS +GASGDY GC
Sbjct  309  EYLQFIDNGQFSVDGVLTDFAPTASEAIACLAHNKNASRPQKGHPLIISHNGASGDYTGC  368

Query  590  TDXAYSKAVSDGVDIIDCT  646
            TD AY KAV+DG D+IDC+
Sbjct  369  TDLAYDKAVTDGADVIDCS  387



>ref|XP_004973845.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X2 [Setaria italica]
Length=679

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 162/214 (76%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H L+MR ++LS+ +RV ++YISSPE+ FL++I+  ++ R TKLVF FL     + S 
Sbjct  189  YKEHGLNMRNYILSIQKRVSVDYISSPELGFLQNISGTVH-RKTKLVFSFLDKSLLDHSI  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL NL  IK+ ASGI+VPK+YIWPV K + YLQP+TS+V +AH  GLE+YASDF
Sbjct  248  NQTYGSLLSNLTLIKSIASGIMVPKTYIWPVTKDN-YLQPSTSIVAEAHNAGLEIYASDF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDP+AEYL+FI +G +SVDGVLS+ PIT S AI C++++   +     E
Sbjct  307  ANDRIIPYNYSYDPLAEYLNFISDGGFSVDGVLSEHPITASEAIGCFANLNSSETGH-GE  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY+ A++DG D+IDC
Sbjct  366  PLVISHNGASGDYPDCTDLAYNSAINDGADVIDC  399



>dbj|BAJ93663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=768

 Score =   249 bits (637),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 160/214 (75%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+QH L+MR +++S+ + V + YISSPE+ FLKSI+ R+  R TKLVFRF  N  ++PS 
Sbjct  191  YTQHGLNMRRYIVSILKSVSVKYISSPELGFLKSISKRVGSR-TKLVFRFPDNFMSDPSI  249

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY  L +NL  IKT ASGI+VPKSYIWPV  + +YLQP TS V DAH  GLE+YASDF
Sbjct  250  NQTYSLLSKNLTFIKTIASGIMVPKSYIWPV-TNDNYLQPPTSFVQDAHSAGLEIYASDF  308

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDP+ EYLSFI +G +SVDGVL+D+PIT S AI C++H+ + + +   +
Sbjct  309  ANDRIIPYNYSYDPLQEYLSFISDGGFSVDGVLTDYPITASEAIGCFTHLNESKADH-GK  367

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD AY  A+ DG D+IDC
Sbjct  368  PLIISHNGASGDYPDCTDLAYLNAIKDGADVIDC  401



>ref|XP_010453288.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Camelina sativa]
Length=753

 Score =   249 bits (636),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/215 (57%), Positives = 156/215 (73%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSAAEYLRSLQFRG-INVISSPEIGFLKSIGMDAGRAKTKLIFEFKEPEAIEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V DAHK GLEVYAS F
Sbjct  237  NKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YS+DP AEYL F+DNG +SVDG+++DFP T S AI C+SH +KG   ++  
Sbjct  296  ANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGIITDFPPTASQAISCFSH-QKGNLPKIGN  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVI+ +GASGDYPGCTD AY KAVSDG D+IDC+
Sbjct  355  ALVITHNGASGDYPGCTDLAYEKAVSDGADVIDCS  389



>ref|XP_004973844.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
1-like isoform X1 [Setaria italica]
Length=768

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 162/214 (76%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H L+MR ++LS+ +RV ++YISSPE+ FL++I+  ++ R TKLVF FL     + S 
Sbjct  189  YKEHGLNMRNYILSIQKRVSVDYISSPELGFLQNISGTVH-RKTKLVFSFLDKSLLDHSI  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYGSLL NL  IK+ ASGI+VPK+YIWPV K + YLQP+TS+V +AH  GLE+YASDF
Sbjct  248  NQTYGSLLSNLTLIKSIASGIMVPKTYIWPVTKDN-YLQPSTSIVAEAHNAGLEIYASDF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDP+AEYL+FI +G +SVDGVLS+ PIT S AI C++++   +     E
Sbjct  307  ANDRIIPYNYSYDPLAEYLNFISDGGFSVDGVLSEHPITASEAIGCFANLNSSETGH-GE  365

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY+ A++DG D+IDC
Sbjct  366  PLVISHNGASGDYPDCTDLAYNSAINDGADVIDC  399



>ref|XP_007020655.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
 gb|EOY12180.1| SHV3-like 2, putative isoform 4, partial [Theobroma cacao]
Length=559

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 141/166 (85%), Gaps = 3/166 (2%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVI--NYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEP  175
            Y+QHNLSMR FV+S++R V +  +YISSPEV FL+SIA+R     TKLVFRFL  D  EP
Sbjct  149  YAQHNLSMRNFVISLTRNVTVTVDYISSPEVAFLRSIAARFQRSTTKLVFRFLELDTVEP  208

Query  176  STNQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYAS  355
            STN TYGSLL+NL  +KTFASGI+VPKSY+WPVD S+ YLQP+TS+VLDAHK GLEV+AS
Sbjct  209  STNLTYGSLLKNLTFVKTFASGIIVPKSYVWPVD-SNLYLQPSTSVVLDAHKEGLEVFAS  267

Query  356  DFASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAI  493
            DF +DVPF+F+YSYDPVAEYL F+DNG +SVDGV+SDFPITPS AI
Sbjct  268  DFTNDVPFSFNYSYDPVAEYLQFVDNGKFSVDGVISDFPITPSAAI  313



>ref|XP_006401135.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
 gb|ESQ42588.1| hypothetical protein EUTSA_v10012762mg [Eutrema salsugineum]
Length=753

 Score =   247 bits (631),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 155/215 (72%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN+ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSTAEYLRSLGLRG-INFISSPEIGFLKSIGMDAGRAKTKLIFEFKDPEAIEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  L QNLA+IK FASGILVPK YIWP+D S+ Y++P +++V DAHK GLE+YAS F
Sbjct  237  NKKYSELQQNLAAIKAFASGILVPKDYIWPID-SAKYIKPASTIVADAHKAGLEIYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YSYDP  EYL F+DNG +SVDGV++DFP T S AI C+SH +KG   +   
Sbjct  296  ANDMITSFNYSYDPSTEYLQFVDNGQFSVDGVITDFPPTASQAITCFSH-QKGNLPKAGH  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVI+ +GASGDYPGCTD AY KAV DG D+IDC+
Sbjct  355  ALVITHNGASGDYPGCTDLAYQKAVDDGADVIDCS  389



>ref|XP_002866246.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42505.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   246 bits (627),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 153/215 (71%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSAAEYLRSLRFRG-INVISSPEIGFLKSIGMDAGRAKTKLIFEFKEPEAIEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  L QNLA+IK FASG+LVPK YIWP+D S+ YL+P T+ V DAHK GLEVYAS F
Sbjct  237  NKKYSELQQNLAAIKAFASGVLVPKDYIWPLD-SAKYLKPATTFVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YSYDP  EYL F+DNG +SVDGV++DFP T S AI C+SH +KG   +   
Sbjct  296  ANDMRTSFNYSYDPSTEYLQFVDNGEFSVDGVITDFPPTASQAITCFSH-QKGNLPKAGH  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVI+ +GASGDYPGCTD AY KA+ DG D+IDC+
Sbjct  355  ALVITHNGASGDYPGCTDLAYQKAIDDGADVIDCS  389



>ref|XP_007201937.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
 gb|EMJ03136.1| hypothetical protein PRUPE_ppa001673mg [Prunus persica]
Length=782

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 159/215 (74%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQH +SM +FV  V R   +NYISSPE+ FLK++++++N   TKL+F+FL  +ETEP+T
Sbjct  188  YSQHKISMASFVEKVIRFPSMNYISSPEIGFLKTVSAKVNKGRTKLIFQFLDPEETEPTT  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             Q Y +L++NL  IK+ A+GILVPK YIWPV+K++ YL+  T+LV +AHK GLEV+AS F
Sbjct  248  KQKYSALVKNLEMIKSVAAGILVPKEYIWPVNKNN-YLEAATTLVTEAHKQGLEVHASGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+   ++YS+DP AEYL F+D  N+SVDGVL+DFP T S  I C++      K +   
Sbjct  307  ANDIVLPYNYSFDPTAEYLQFVDQPNFSVDGVLTDFPPTASETIACFAQNNNSTKPKKGL  366

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG YPGCTD AY +AV DG DIIDC+
Sbjct  367  PLIITRNGASGTYPGCTDLAYKQAVDDGADIIDCS  401



>gb|EMT33222.1| Putative glycerophosphoryl diester phosphodiesterase 1 [Aegilops 
tauschii]
Length=772

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 158/214 (74%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QH L+MR++++S+ + V + YISSPE+ FLKSI+ R   R TKLVFRF  N  ++PST
Sbjct  193  YKQHGLNMRSYIVSILKSVPVKYISSPELGFLKSISKRAG-RRTKLVFRFPDNFLSDPST  251

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY SL +NL  IKT ASGI+VPK YIWPV  + +YLQP TS V DAH  GLE+YASDF
Sbjct  252  NQTYSSLSKNLTFIKTIASGIMVPKIYIWPV-TNDNYLQPPTSFVQDAHSAGLEIYASDF  310

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDP+ EYLSFI +G +SVDGVL+D+PIT S AI C++ +   + +   +
Sbjct  311  ANDRIIPYNYSYDPLQEYLSFISDGGFSVDGVLTDYPITASEAIGCFADLNASKADH-GK  369

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD AY  A+ DG D+IDC
Sbjct  370  PLIISHNGASGDYPDCTDLAYQNAIKDGADVIDC  403



>ref|XP_010483370.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Camelina 
sativa]
Length=753

 Score =   245 bits (625),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 155/215 (72%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  I+ ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSAAEYLRSLQFRG-ISVISSPEIGFLKSIGMDAGRAKTKLIFEFKNPEAIEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V DAHK GLEVYAS F
Sbjct  237  NKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YS+DP AEYL F+DNG +SVDG+++DFP T S AI C+SH +KG   +V  
Sbjct  296  ANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGIITDFPPTASQAITCFSH-QKGNLPKVGN  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LV + +GASGDYPGCTD AY KAV+DG D+IDC+
Sbjct  355  ALVTTHNGASGDYPGCTDLAYEKAVNDGADVIDCS  389



>ref|XP_010943202.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Elaeis guineensis]
Length=770

 Score =   244 bits (624),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H L    F+L+ S ++  +YISSPE+ FLKS+  +     TKL+FRFL  D  EPST
Sbjct  191  YKEHKLDPAKFILTASEKMDFDYISSPEIGFLKSLNGKFGKAKTKLIFRFLDADAVEPST  250

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY S+L++L +IK+FASGILVPKSYIWPV+K   YL+  T+LV DAH +GLEV+A +F
Sbjct  251  NQTYSSILKSLTAIKSFASGILVPKSYIWPVNKDK-YLESATTLVTDAHNLGLEVHAYNF  309

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D P +++YS+DP AEYL FID+ ++SVDGVL+DFP T S A+ C +H +    +    
Sbjct  310  ANDQPASYNYSFDPTAEYLQFIDHSDFSVDGVLTDFPSTASTAVACLAHNKDNAASNKKR  369

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG + GCTD AY +AV DG DIIDC+
Sbjct  370  PLIITRNGASGVFAGCTDLAYQQAVEDGADIIDCS  404



>ref|XP_002866252.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH42511.1| glycerophosphoryl diester phosphodiesterase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=754

 Score =   244 bits (623),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 154/215 (72%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSAAEYLRSLRFRG-INVISSPEIGFLKSIGMDAGRAKTKLIFEFKEPEAIEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  L QNLA+IK FASG+LVPK YIWP+D S++YL+P T+ V DAHK GLEVYAS F
Sbjct  237  NKKYSELQQNLAAIKAFASGVLVPKDYIWPLD-SANYLKPATTFVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YSYDP AEYL F+DNG +SVDGV++DFP T S +I C SH +KG   +   
Sbjct  296  ANDMRTSFNYSYDPSAEYLQFVDNGQFSVDGVITDFPPTASQSITCLSH-QKGNLPKAGH  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVI+ +GASGDYPGCTD AY KAV +G D+IDC+
Sbjct  355  ALVITHNGASGDYPGCTDLAYQKAVDEGADVIDCS  389



>ref|NP_200625.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
 sp|Q9LVN0.1|GPDL7_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL7; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
7; Short=ATGDPDL7; AltName: Full=Glycerophosphodiesterase-like 
6; AltName: Full=Protein SHV3-LIKE 5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAA96908.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97007.1| glycerophosphodiester phosphodiesterase like 7 [Arabidopsis thaliana]
Length=750

 Score =   244 bits (622),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 153/215 (71%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSPAEYLRSLQFRG-INVISSPEIGFLKSIGMDAGRAKTKLIFEFKDPEAVEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  + QNLA+IK FASG+LVPK YIWP+D S+ YL+P T+ V DAHK GLEVYAS F
Sbjct  237  NKKYSEIQQNLAAIKAFASGVLVPKDYIWPID-SAKYLKPATTFVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YSYDP AEYL F+DNG +SVDGV++DFP T S +I C+SH + G   +   
Sbjct  296  ANDLRTSFNYSYDPSAEYLQFVDNGQFSVDGVITDFPPTASQSITCFSH-QNGNLPKAGH  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVI+ +GASGDYPGCTD AY KAV DG D+IDC+
Sbjct  355  ALVITHNGASGDYPGCTDLAYQKAVDDGADVIDCS  389



>ref|NP_200613.2| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
 sp|Q9FGT9.1|GPDL6_ARATH RecName: Full=Glycerophosphodiester phosphodiesterase GDPDL6; 
AltName: Full=Glycerophosphodiester phosphodiesterase-like 
6; Short=ATGDPDL6; AltName: Full=Glycerophosphodiesterase-like 
5; AltName: Full=Protein SHV3-LIKE 4; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10996.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL66999.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AAN71947.1| putative aluminium tolerance associated protein [Arabidopsis 
thaliana]
 gb|AED96991.1| glycerophosphodiester phosphodiesterase like 6 [Arabidopsis thaliana]
Length=753

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 153/215 (71%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSPAEYLRSLRFRG-INVISSPEIGFLKSIGMDAGRAKTKLIFEFKDPEAVEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  + QNLA+IK FASG+LVPK YIWP+D S+ YL+P T+ V DAHK GLEVYAS F
Sbjct  237  NKKYSEIQQNLAAIKAFASGVLVPKDYIWPID-SAKYLKPATTFVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YSYDP AEYL F+DNG +SVDGV++DFP T S +I C+SH + G   +   
Sbjct  296  ANDLRTSFNYSYDPSAEYLQFVDNGQFSVDGVITDFPPTASQSITCFSH-QNGNLPKAGH  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVI+ +GASGDYPGCTD AY KA+ DG DIIDC+
Sbjct  355  ALVITHNGASGDYPGCTDLAYQKAIDDGADIIDCS  389



>ref|XP_006282081.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
 gb|EOA14979.1| hypothetical protein CARUB_v10028327mg [Capsella rubella]
Length=752

 Score =   243 bits (621),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 156/218 (72%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  176  YMEHKLSAADYLRSLRFRG-INVISSPEIGFLKSIGMDAGRAKTKLIFEFKDPEAIEPTT  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  L QNLA+IK FASG+LVPK YIWP+D ++ YL+P T+ V DAHK GLEVYAS F
Sbjct  235  NKKYSELQQNLAAIKAFASGVLVPKDYIWPLD-TAKYLKPATTFVADAHKAGLEVYASGF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YS+DP AEYL F+DNG +SVDG+++DFP T S AI C SH    QK+ +P+
Sbjct  294  ANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGIITDFPPTASQAITCLSH----QKDNLPK  349

Query  542  ---FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
                LVI+ +GASGDYPGCTD AY KAV+DG D+IDC+
Sbjct  350  AGHALVITHNGASGDYPGCTDMAYEKAVNDGADVIDCS  387



>ref|XP_010453117.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL6 [Camelina 
sativa]
Length=754

 Score =   243 bits (620),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 155/218 (71%), Gaps = 9/218 (4%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  IN ISSPE+ FLKSI        TKL+F F      EP+T
Sbjct  178  YMEHKLSAAEYLRSLRFRG-INVISSPEIGFLKSIGMDAGRAKTKLIFEFKDPQAIEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             + Y  L QNLA+IK FASG+LVPK YIWPVD ++ YL+P T+ V DAHK GLEVYAS F
Sbjct  237  KKKYSELQQNLAAIKAFASGVLVPKDYIWPVD-TAKYLKPATTFVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YS+DP AEYL F+DNG +SVDG+++DFP T S AI C+SH    QK+ +P+
Sbjct  296  ANDMRTSFNYSFDPSAEYLQFVDNGQFSVDGIITDFPPTASQAITCFSH----QKDNIPK  351

Query  542  ---FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
                LVI+ +GASGDYPGCTD AY KA++DG D+IDC+
Sbjct  352  AGHALVITHNGASGDYPGCTDLAYEKAINDGADVIDCS  389



>gb|EMS66577.1| putative glycerophosphoryl diester phosphodiesterase 1 [Triticum 
urartu]
Length=1368

 Score =   248 bits (632),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/214 (57%), Positives = 161/214 (75%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQH L+MR +++S+ + V + YISSPE+ FLKSI+ R+  R TKLVFRF  N  ++PST
Sbjct  192  YSQHGLNMRRYIVSILKSVSVKYISSPEIGFLKSISKRVRGR-TKLVFRFPDNFLSDPST  250

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTY SL +NL  IKT ASGI+VPKSYIW V  + +YL P TS V DAH+ GLE+YASDF
Sbjct  251  NQTYSSLSKNLTFIKTIASGIMVPKSYIWQV-TNDNYLLPPTSFVQDAHRAGLEIYASDF  309

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDP+ EYLSFI +G +SVDGVL+D+PIT S AI C++++ + + +   +
Sbjct  310  ANDRIIPYNYSYDPLQEYLSFISDGGFSVDGVLTDYPITASEAIGCFANLNESKADH-GK  368

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             L+IS +GASGDYP CTD AY  A+ DG D+IDC
Sbjct  369  PLIISHNGASGDYPDCTDLAYQNAIKDGADVIDC  402



>ref|XP_008384576.1| PREDICTED: LOW QUALITY PROTEIN: probable glycerophosphoryl diester 
phosphodiesterase 2 [Malus domestica]
Length=770

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y++H +SM +FV   ++   I YISSPE+ FLK+I  ++N   TKL+F+FL  +ETEP+T
Sbjct  184  YNEHKISMASFVEKAAKFAPIPYISSPEIGFLKAIGGKVNKMRTKLIFQFLDPEETEPTT  243

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             Q Y +L++ L  IK+ A+GILVPK YIWPV+K++ Y++  T+LV DAHK GLEV+AS F
Sbjct  244  KQKYSALVKQLGMIKSVAAGILVPKEYIWPVNKNN-YVEKATTLVNDAHKEGLEVHASGF  302

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV   ++YS+DP AEYL F+DN  +SVDGVL+DFP T S AI C++  +   K +   
Sbjct  303  ANDVILPYNYSFDPTAEYLQFVDNSQFSVDGVLTDFPPTASEAIACFTQNKNETKPKTGF  362

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG YPGCTD AY +AV DG DIIDC+
Sbjct  363  PLIITRNGASGIYPGCTDLAYKQAVEDGADIIDCS  397



>ref|XP_008343908.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
 ref|XP_008343909.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Malus domestica]
Length=781

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 157/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y++H +SM +FV   ++   I YISSPE+ FLK+I  ++N   TKL+F+FL  +ETEP+T
Sbjct  184  YNEHKISMASFVEKAAKFAPIPYISSPEIGFLKAIGGKVNKMRTKLIFQFLDPEETEPTT  243

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             Q Y +L++ L  IK+ A+GILVPK YIWPV+K++ Y++  T+LV DAHK GLEV+AS F
Sbjct  244  KQKYSALVKQLGMIKSVAAGILVPKEYIWPVNKNN-YVEKATTLVNDAHKEGLEVHASGF  302

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV   ++YS+DP AEYL F+DN  +SVDGVL+DFP T S AI C++  +   K +   
Sbjct  303  ANDVILPYNYSFDPTAEYLQFVDNSQFSVDGVLTDFPPTASEAIACFTQNKNETKPKTGF  362

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG YPGCTD AY +AV DG DIIDC+
Sbjct  363  PLIITRNGASGIYPGCTDLAYKQAVEDGADIIDCS  397



>ref|XP_008242952.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Prunus mume]
Length=782

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 158/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            YSQH +SM +FV  V R   +NYISSPE+ FLK++++++N   TKL+F+FL  +ETEP+T
Sbjct  188  YSQHKISMASFVEKVIRFPSMNYISSPEIGFLKTVSAKVNKGRTKLIFQFLDPEETEPTT  247

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             Q Y +L++NL  IK+ A+GILVPK YIWPV+K++ YL+  T+LV +AHK GLEV+AS F
Sbjct  248  KQKYSALVKNLEMIKSVAAGILVPKEYIWPVNKNN-YLEAATTLVTEAHKQGLEVHASGF  306

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+   ++YS+DP AEYL F+D  N+SVDGVL+DFP T S  I C++      K +   
Sbjct  307  ANDIVLPYNYSFDPTAEYLQFVDQPNFSVDGVLTDFPPTASETIACFAQNNNATKPKKGL  366

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG YPG TD AY +AV DG DIIDC+
Sbjct  367  PLIITRNGASGTYPGSTDLAYKQAVDDGADIIDCS  401



>ref|XP_008440682.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Cucumis melo]
Length=760

 Score =   241 bits (615),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 156/217 (72%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y++H+LS+ +++    R + IN++SS E+  LK I+  +N   TKL+FRFL  +E EP+T
Sbjct  174  YAEHDLSVISYLQKALRLMRINFVSSSEIGILKGISGSVNKARTKLIFRFLEANEIEPTT  233

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             +TYG+L   L  IKTFASGIL+ K YIWP+ +   Y+QP T++V+DAHK+GLEVYAS F
Sbjct  234  KKTYGALAHELPMIKTFASGILIRKEYIWPIGQDK-YVQPATNIVIDAHKLGLEVYASGF  292

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQ--V  535
            A+D    ++YSYDP+ EYL F DNG+++VDGVLSDFP   S AI CYS  R   K Q  +
Sbjct  293  ANDAIVGYNYSYDPIREYLQFFDNGHFAVDGVLSDFPPAASQAIACYSSFRNNGKPQPGL  352

Query  536  PEFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             + LVIS +GASGD+PG TD AY KA+ +G D+IDC+
Sbjct  353  EQALVISSNGASGDFPGSTDLAYQKAIEEGADVIDCS  389



>ref|XP_003572357.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL3 [Brachypodium 
distachyon]
Length=777

 Score =   241 bits (615),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 119/215 (55%), Positives = 161/215 (75%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H L+MR+++LS+ +R+ + YISSPE+ FL+SI+ R+  + TKLVFRF     T+PST
Sbjct  198  YREHGLNMRSYILSILKRMSVKYISSPELGFLQSISGRVGGK-TKLVFRFPETPLTDPST  256

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TY S+L NLA IK  ASGI+VPKSYIWPV  + +YL P TS+V +AH  GLE+YASDF
Sbjct  257  NKTYRSMLSNLALIKATASGIMVPKSYIWPV-TNDNYLLPPTSIVRNAHNAGLEIYASDF  315

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDP+ EYLSFI +G++SVDGVL+++PIT S AI C++ +     +   +
Sbjct  316  ANDRIIPYNYSYDPLQEYLSFISDGDFSVDGVLTEYPITASEAIGCFTTLNASTADH-GK  374

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+IS +GASGDYP CTD AY  A+ DG D+IDCT
Sbjct  375  PLIISHNGASGDYPDCTDLAYQYAIKDGADMIDCT  409



>ref|XP_002461022.1| hypothetical protein SORBIDRAFT_02g039350 [Sorghum bicolor]
 gb|EER97543.1| hypothetical protein SORBIDRAFT_02g039350 [Sorghum bicolor]
Length=573

 Score =   237 bits (604),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 154/207 (74%), Gaps = 3/207 (1%)
 Frame = +2

Query  23   MRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPSTNQTYGSL  202
            MR ++ S+ +RV ++YISSPE+ FLK+I+ R+  R TKLVFRFL     + S NQTYGSL
Sbjct  1    MRNYIFSIKKRVSMDYISSPELGFLKNISGRVG-RKTKLVFRFLDKALLDHSINQTYGSL  59

Query  203  LQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDFASDVPFA  382
              NL  IK+ ASGI+VPKSYIWPV K + YL P+TS+V +AH  GLE+YASDFA+D    
Sbjct  60   SSNLTFIKSIASGIIVPKSYIWPVTKDN-YLLPSTSIVTEAHNAGLEIYASDFANDRIIP  118

Query  383  FDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPEFLVISFD  562
            ++YSYDP+AEYL+F+++G +SVDGVLS+ PIT S AI C++ +   + +   E LVIS +
Sbjct  119  YNYSYDPLAEYLNFVNDGGFSVDGVLSEHPITASEAIGCFTKLNSNKTDH-GEPLVISHN  177

Query  563  GASGDYPGCTDXAYSKAVSDGVDIIDC  643
            GASGDYP CTD AY  A+ +G DIIDC
Sbjct  178  GASGDYPDCTDLAYHSAIDNGADIIDC  204



>ref|XP_010656583.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7 [Vitis 
vinifera]
Length=750

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+ + LS+ +++   +R + I+YISSPE+ FLK++   IN   TKL+FRFL  D  EP+T
Sbjct  170  YAANKLSVSSYIQKTTRFMGISYISSPEIGFLKNMNKIINKAKTKLIFRFLDADAVEPTT  229

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             Q Y S+L++L+SIK+ ASGILVPK YIWP+ K    L P+ S+V DAHK GLEVYAS F
Sbjct  230  KQPYSSILKDLSSIKSIASGILVPKEYIWPLSKDQYLLTPS-SVVADAHKQGLEVYASGF  288

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +++YSYDP AEYL F+DN ++SVDGVL+DFP T S AI C +H +   +    +
Sbjct  289  ANDMPGSYNYSYDPTAEYLQFVDNSDFSVDGVLTDFPPTASEAIACLAHNKNATRPSKGK  348

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVIS +GASG YPG TD AY +AV DG DIIDC+
Sbjct  349  ILVISHNGASGVYPGSTDLAYQQAVDDGADIIDCS  383



>ref|XP_006829998.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
 gb|ERM97414.1| hypothetical protein AMTR_s00252p00015420 [Amborella trichopoda]
Length=756

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/216 (55%), Positives = 161/216 (75%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+Q+ L M ++V+S+S+  ++ ++SSPEV  LK+I  ++    TKL+F+FL  ++ EPST
Sbjct  175  YTQNKLDMASYVISLSKTSILEFVSSPEVGLLKNINGKLKGGKTKLIFQFLKPEDIEPST  234

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             +TY SLL+NL+SIK FASG+LVPK+YIW V+ S  YL+  T+LV DAHKVGLEVYAS F
Sbjct  235  KKTYASLLENLSSIKAFASGVLVPKNYIWAVN-SDLYLKSPTTLVKDAHKVGLEVYASGF  293

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRK-GQKNQVP  538
            A+D P +++YSYDPVAEYL FID  ++SVDGVL+DFP T S A+ C +   K    + + 
Sbjct  294  ANDFPASYNYSYDPVAEYLQFIDKSDFSVDGVLTDFPSTASEAVGCLARSEKSATPSALE  353

Query  539  EFLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
            + L+I+ +GASG Y GCTD AY +AV DG DIIDC+
Sbjct  354  KPLIITHNGASGVYAGCTDLAYKQAVKDGADIIDCS  389



>emb|CBI18678.3| unnamed protein product [Vitis vinifera]
Length=756

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y+ + LS+ +++   +R + I+YISSPE+ FLK++   IN   TKL+FRFL  D  EP+T
Sbjct  170  YAANKLSVSSYIQKTTRFMGISYISSPEIGFLKNMNKIINKAKTKLIFRFLDADAVEPTT  229

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             Q Y S+L++L+SIK+ ASGILVPK YIWP+ K    L P+ S+V DAHK GLEVYAS F
Sbjct  230  KQPYSSILKDLSSIKSIASGILVPKEYIWPLSKDQYLLTPS-SVVADAHKQGLEVYASGF  288

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +++YSYDP AEYL F+DN ++SVDGVL+DFP T S AI C +H +   +    +
Sbjct  289  ANDMPGSYNYSYDPTAEYLQFVDNSDFSVDGVLTDFPPTASEAIACLAHNKNATRPSKGK  348

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVIS +GASG YPG TD AY +AV DG DIIDC+
Sbjct  349  ILVISHNGASGVYPGSTDLAYQQAVDDGADIIDCS  383



>ref|XP_002445920.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
 gb|EES15415.1| hypothetical protein SORBIDRAFT_07g028050 [Sorghum bicolor]
Length=885

 Score =   242 bits (617),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 158/214 (74%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y QH L M  ++ S+ + V ++YISSPE+ FLK+I++R+  R TKLV+ FL  +  + S 
Sbjct  301  YKQHGLDMSRYIFSIRKLVSMDYISSPELGFLKNISARVG-RKTKLVYSFLDKNLLDHSM  359

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            NQTYG L  NL  IK+ ASGI+VPK YIWPV  S +YL+P+TS+V DAHK GLE+YASDF
Sbjct  360  NQTYGLLSTNLTFIKSIASGIMVPKDYIWPV-TSDNYLRPSTSIVTDAHKAGLEIYASDF  418

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D    ++YSYDP+AEYL+FI +G +SVDGVLSD+PIT S AI C++++   + +   E
Sbjct  419  ANDRIIPYNYSYDPLAEYLNFISDGGFSVDGVLSDYPITASEAIGCFANLNSSKTDHA-E  477

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDC  643
             LVIS +GASGDYP CTD AY  A+ DG D+IDC
Sbjct  478  PLVISHNGASGDYPDCTDLAYHSAIDDGADVIDC  511



>ref|XP_010536984.1| PREDICTED: glycerophosphodiester phosphodiesterase GDPDL7-like 
[Tarenaya hassleriana]
Length=745

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 151/215 (70%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ S+  R  I ++SSPE+ FLKSI        TKL+F     D  E +T
Sbjct  173  YMEHKLSAAEYLKSLRLRG-IGFVSSPEIGFLKSIGMDAAKSKTKLIFELREPDMIEATT  231

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N TY  LL NLA+IK FASGIL+PK YIW +D +  YL+P+T+LV DAHK GLEVYAS F
Sbjct  232  NTTYNELLTNLATIKQFASGILIPKGYIWALDPNK-YLKPSTNLVADAHKAGLEVYASGF  290

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+P +++YSYDP  EYL F+DNG + VDGV+SDFP T S AI C++H +KG   +   
Sbjct  291  ANDIPTSYNYSYDPSIEYLQFVDNGQFCVDGVISDFPPTASQAISCFAH-QKGHLPKAGH  349

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             ++I+ +GASGDYPGCTD AY KAV DG DIIDC+
Sbjct  350  AMIITHNGASGDYPGCTDMAYQKAVEDGADIIDCS  384



>emb|CDY11831.1| BnaC03g12570D [Brassica napus]
Length=566

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/215 (54%), Positives = 154/215 (72%), Gaps = 3/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H LS   ++ ++  R  I +ISSPE+ FLKSI        TKL+F F   +  EP+T
Sbjct  178  YMEHKLSAAEYLKTLRFRG-ITFISSPEIAFLKSIGMDAGMSKTKLIFEFKDPEAIEPTT  236

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+ Y  +L +LA+IK FASG+LVPK YIWP+D S++YL+P ++ V DAHK GLEVYAS F
Sbjct  237  NKKYSEILLDLAAIKAFASGVLVPKDYIWPLD-SANYLKPASTFVADAHKAGLEVYASGF  295

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+D+  +F+YSYDP AEYL F+DNG +SVDG ++DFP T S AI C SH ++G   +   
Sbjct  296  ANDLRTSFNYSYDPSAEYLQFVDNGQFSVDGFITDFPPTASQAISCLSH-QQGNLPKANH  354

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             LVI+ +GASGDYPGCTD AY KAV+DG D+IDC+
Sbjct  355  ALVITHNGASGDYPGCTDMAYQKAVNDGADVIDCS  389



>ref|XP_009366150.1| PREDICTED: probable glycerophosphoryl diester phosphodiesterase 
2 [Pyrus x bretschneideri]
Length=777

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 156/215 (73%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y++H +SM +FV   ++   I YISSPE+ FLK+I  ++N   TKL+F+FL  +ETEP+T
Sbjct  184  YNEHKISMASFVEKAAKFAPIPYISSPEIRFLKAIGGKVNKMRTKLIFQFLDPEETEPTT  243

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
             Q Y +L++ L  IK+ A+GILVPK YIWPV+K++ Y++  T+LV DAHK GLEV+AS F
Sbjct  244  KQKYSALVKQLGMIKSVAAGILVPKEYIWPVNKNN-YVEKATTLVNDAHKEGLEVHASGF  302

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            A+DV   ++YS+DP AEYL F+DN  +SVDG+L+DFP T S AI C+   + G K +   
Sbjct  303  ANDVILPYNYSFDPTAEYLQFVDNSQFSVDGLLTDFPPTASEAIACFVQNKNGTKPKTGF  362

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+I+ +GASG YPG TD AY +AV DG DIIDC+
Sbjct  363  PLIITRNGASGIYPGSTDLAYKQAVEDGADIIDCS  397



>dbj|BAD28342.1| glycerophosphoryl diester phosphodiesterase 2 precursor-like 
[Oryza sativa Japonica Group]
Length=664

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 155/215 (72%), Gaps = 2/215 (1%)
 Frame = +2

Query  2    YSQHNLSMRTFVLSVSRRVVINYISSPEVNFLKSIASRINPRVTKLVFRFLGNDETEPST  181
            Y +H L+M  ++LS+ +   + YISSPE+ FL+S++  IN R   LVF FL    ++PST
Sbjct  203  YREHGLNMTNYILSIQKLGSVKYISSPELGFLQSLSGGIN-REVNLVFCFLDKALSDPST  261

Query  182  NQTYGSLLQNLASIKTFASGILVPKSYIWPVDKSSSYLQPTTSLVLDAHKVGLEVYASDF  361
            N+TY  +L NL  IKT ASGI+VPK+YIWPV  S +Y+Q  T +V +AH  GLE+YASDF
Sbjct  262  NKTYNYMLSNLTFIKTIASGIMVPKNYIWPV-TSDNYIQLHTQIVQEAHNAGLEIYASDF  320

Query  362  ASDVPFAFDYSYDPVAEYLSFIDNGNYSVDGVLSDFPITPSGAIDCYSHMRKGQKNQVPE  541
            ++D  F ++YSYDP+ EYLSF+ +G +SVDGVL+DFP+T S AIDC+S++   +K     
Sbjct  321  SNDGIFPYNYSYDPLGEYLSFVSDGGFSVDGVLTDFPLTASEAIDCFSNLNTSRKTDHGN  380

Query  542  FLVISFDGASGDYPGCTDXAYSKAVSDGVDIIDCT  646
             L+IS +G SGDYPGCTD AY  AV DG D+IDC+
Sbjct  381  PLIISHNGGSGDYPGCTDLAYENAVRDGADVIDCS  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000