BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF043O07

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO46793.1|  hypothetical protein CISIN_1g012238mg                   183   3e-52   Citrus sinensis [apfelsine]
ref|XP_006450331.1|  hypothetical protein CICLE_v10008224mg             184   2e-51   Citrus clementina [clementine]
gb|KDO46791.1|  hypothetical protein CISIN_1g012238mg                   183   3e-51   Citrus sinensis [apfelsine]
ref|XP_009789886.1|  PREDICTED: aspartate aminotransferase, chlor...    182   6e-51   Nicotiana sylvestris
ref|XP_009619135.1|  PREDICTED: aspartate aminotransferase, chlor...    177   2e-49   Nicotiana tomentosiformis
ref|XP_002309659.2|  aspartate aminotransferase 2 family protein        175   3e-48   
ref|XP_011036642.1|  PREDICTED: aspartate aminotransferase, chlor...    175   3e-48   Populus euphratica
ref|XP_006345635.1|  PREDICTED: aspartate aminotransferase, chlor...    175   4e-48   Solanum tuberosum [potatoes]
ref|XP_006495466.1|  PREDICTED: aspartate aminotransferase, chlor...    164   1e-47   Citrus sinensis [apfelsine]
gb|AFP86894.1|  aspartate aminotransferase                              170   4e-47   Ilex paraguariensis [Brazilian-tea]
ref|XP_004244943.1|  PREDICTED: aspartate aminotransferase, chlor...    172   5e-47   Solanum lycopersicum
ref|NP_001274906.1|  aspartate aminotransferase, chloroplastic-like     172   6e-47   Solanum tuberosum [potatoes]
ref|XP_002324896.1|  aspartate aminotransferase 2 family protein        171   9e-47   Populus trichocarpa [western balsam poplar]
ref|XP_011039608.1|  PREDICTED: aspartate aminotransferase, chlor...    170   3e-46   Populus euphratica
gb|ABN48559.1|  chloroplast aspartate aminotransferase                  161   3e-46   Brassica juncea [brown mustard]
ref|XP_011459596.1|  PREDICTED: aspartate aminotransferase, chlor...    167   3e-45   Fragaria vesca subsp. vesca
ref|XP_007223036.1|  hypothetical protein PRUPE_ppa005369mg             166   1e-44   Prunus persica
gb|KDO46792.1|  hypothetical protein CISIN_1g012238mg                   164   1e-44   Citrus sinensis [apfelsine]
gb|KJB55010.1|  hypothetical protein B456_009G060500                    162   2e-44   Gossypium raimondii
gb|AAB68396.1|  aspartate aminotransferase 2 precursor                  165   2e-44   Canavalia lineata
ref|XP_008377672.1|  PREDICTED: aspartate aminotransferase, chlor...    165   2e-44   Malus domestica [apple tree]
ref|XP_002285385.1|  PREDICTED: aspartate aminotransferase, chlor...    164   3e-44   Vitis vinifera
emb|CAN76227.1|  hypothetical protein VITISV_000267                     164   4e-44   Vitis vinifera
ref|XP_004498776.1|  PREDICTED: aspartate aminotransferase P2, mi...    164   4e-44   Cicer arietinum [garbanzo]
ref|XP_008220703.1|  PREDICTED: aspartate aminotransferase, chlor...    164   4e-44   Prunus mume [ume]
ref|XP_002515455.1|  aspartate aminotransferase, putative               164   5e-44   Ricinus communis
ref|XP_010665799.1|  PREDICTED: aspartate aminotransferase, chlor...    164   6e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010089944.1|  Aspartate aminotransferase                         163   1e-43   
ref|XP_010048915.1|  PREDICTED: aspartate aminotransferase, chlor...    163   1e-43   Eucalyptus grandis [rose gum]
ref|XP_010245533.1|  PREDICTED: aspartate aminotransferase, chlor...    163   1e-43   Nelumbo nucifera [Indian lotus]
gb|KJB55006.1|  hypothetical protein B456_009G060500                    162   1e-43   Gossypium raimondii
emb|CAA04697.1|  aspartate aminotransferase 2                           162   1e-43   Canavalia lineata
gb|KCW81335.1|  hypothetical protein EUGRSUZ_C02721                     162   2e-43   Eucalyptus grandis [rose gum]
gb|KHG15177.1|  Aspartate aminotransferase, chloroplastic -like p...    162   2e-43   Gossypium arboreum [tree cotton]
gb|KDP33541.1|  hypothetical protein JCGZ_07112                         162   2e-43   Jatropha curcas
ref|XP_010942150.1|  PREDICTED: aspartate aminotransferase, chlor...    162   2e-43   
gb|AAB46611.1|  aspartate aminotransferase                              162   3e-43   Medicago sativa [alfalfa]
ref|XP_010942149.1|  PREDICTED: aspartate aminotransferase, chlor...    162   3e-43   Elaeis guineensis
gb|KEH39860.1|  aspartate aminotransferase                              161   5e-43   Medicago truncatula
prf||1908424A  Asp aminotransferase                                     161   5e-43
ref|XP_007011759.1|  Aspartate aminotransferase                         161   6e-43   
ref|XP_008445249.1|  PREDICTED: aspartate aminotransferase, chlor...    161   6e-43   Cucumis melo [Oriental melon]
ref|XP_010527116.1|  PREDICTED: aspartate aminotransferase, chlor...    160   8e-43   Tarenaya hassleriana [spider flower]
ref|XP_009138057.1|  PREDICTED: aspartate aminotransferase, chlor...    160   8e-43   Brassica rapa
emb|CDY13467.1|  BnaA03g51850D                                          160   9e-43   Brassica napus [oilseed rape]
emb|CDX72339.1|  BnaC07g43610D                                          160   9e-43   
gb|KHG09550.1|  Aspartate aminotransferase, chloroplastic -like p...    157   9e-43   Gossypium arboreum [tree cotton]
ref|XP_004138711.1|  PREDICTED: aspartate aminotransferase, chlor...    160   1e-42   Cucumis sativus [cucumbers]
ref|XP_006283713.1|  hypothetical protein CARUB_v10004783mg             159   2e-42   Capsella rubella
ref|XP_010437971.1|  PREDICTED: aspartate aminotransferase, chlor...    159   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_002867266.1|  hypothetical protein ARALYDRAFT_491537             159   2e-42   
sp|P26563.1|AATM_LUPAN  RecName: Full=Aspartate aminotransferase ...    159   2e-42   Lupinus angustifolius
ref|XP_009126483.1|  PREDICTED: aspartate aminotransferase, chlor...    159   2e-42   Brassica rapa
emb|CDX75211.1|  BnaA01g04910D                                          159   2e-42   
gb|KJB55007.1|  hypothetical protein B456_009G060500                    159   3e-42   Gossypium raimondii
ref|XP_010432788.1|  PREDICTED: aspartate aminotransferase, chlor...    159   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006848765.1|  hypothetical protein AMTR_s00026p00065580          159   3e-42   Amborella trichopoda
ref|XP_010447459.1|  PREDICTED: aspartate aminotransferase, chlor...    159   4e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006412529.1|  hypothetical protein EUTSA_v10025142mg             158   6e-42   
ref|XP_006412530.1|  hypothetical protein EUTSA_v10025142mg             158   6e-42   
emb|CDP18792.1|  unnamed protein product                                159   7e-42   Coffea canephora [robusta coffee]
ref|XP_008784801.1|  PREDICTED: aspartate aminotransferase, chlor...    157   8e-42   Phoenix dactylifera
ref|XP_010432789.1|  PREDICTED: aspartate aminotransferase, chlor...    157   9e-42   Camelina sativa [gold-of-pleasure]
gb|KJB55009.1|  hypothetical protein B456_009G060500                    157   1e-41   Gossypium raimondii
ref|NP_001149005.1|  aspartate aminotransferase                         157   1e-41   
ref|XP_009407084.1|  PREDICTED: aspartate aminotransferase, chlor...    156   1e-41   
gb|ACR34530.1|  unknown                                                 157   1e-41   Zea mays [maize]
gb|AAM67272.1|  aspartate aminotransferase                              157   2e-41   Arabidopsis thaliana [mouse-ear cress]
prf||2009357A  Asp aminotransferase                                     157   2e-41
ref|NP_194927.1|  aspartate aminotransferase                            156   2e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CAA56932.1|  aspartate aminotransferase                             156   2e-41   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA08106.1|  plastidic aspartate aminotransferase                   156   2e-41   Panicum miliaceum [broom millet]
ref|NP_001031767.1|  aspartate aminotransferase                         156   3e-41   Arabidopsis thaliana [mouse-ear cress]
gb|EPS60991.1|  aspartate aminotransferase                              150   3e-41   Genlisea aurea
ref|XP_008445250.1|  PREDICTED: aspartate aminotransferase, chlor...    155   3e-41   Cucumis melo [Oriental melon]
ref|XP_011082202.1|  PREDICTED: aspartate aminotransferase, chlor...    155   4e-41   
emb|CDJ26231.1|  putative aspartate aminotransferase                    155   4e-41   Brassica oleracea
gb|AAC12674.1|  aspartate aminotransferase                              155   5e-41   Lotus corniculatus
emb|CDX68807.1|  BnaC01g06460D                                          156   6e-41   
ref|NP_001048397.1|  Os02g0797500                                       155   1e-40   
ref|XP_003570308.1|  PREDICTED: aspartate aminotransferase P2, mi...    154   2e-40   Brachypodium distachyon [annual false brome]
gb|KJB65890.1|  hypothetical protein B456_010G117400                    154   2e-40   Gossypium raimondii
gb|AAB26677.2|  aspartate aminotransferase isozyme 5                    154   3e-40   Glycine max [soybeans]
ref|XP_006600243.1|  PREDICTED: aspartate aminotransferase isofor...    154   3e-40   Glycine max [soybeans]
gb|ACU24502.1|  unknown                                                 154   3e-40   Glycine max [soybeans]
ref|NP_001237987.1|  aspartate aminotransferase                         154   3e-40   
gb|AAN76499.1|AF315376_1  aspartate aminotransferase                    154   3e-40   Phaseolus vulgaris [French bean]
gb|ABK24563.1|  unknown                                                 153   4e-40   Picea sitchensis
gb|ACN40845.1|  unknown                                                 153   4e-40   Picea sitchensis
gb|KHN22516.1|  Aspartate aminotransferase P2, mitochondrial            153   4e-40   Glycine soja [wild soybean]
gb|AAO23563.1|  aspartate aminotransferase                              152   5e-40   Oryza sativa [red rice]
gb|ABR16448.1|  unknown                                                 152   6e-40   Picea sitchensis
ref|XP_004954233.1|  PREDICTED: aspartate aminotransferase, chlor...    152   6e-40   Setaria italica
ref|XP_006648055.1|  PREDICTED: aspartate aminotransferase, chlor...    152   7e-40   
gb|KJB65891.1|  hypothetical protein B456_010G117400                    151   2e-39   Gossypium raimondii
dbj|BAJ92741.1|  predicted protein                                      150   5e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96638.1|  predicted protein                                      150   5e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003544600.1|  PREDICTED: aspartate aminotransferase P2, mi...    150   8e-39   Glycine max [soybeans]
ref|NP_001190885.1|  aspartate aminotransferase                         149   8e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002972976.1|  hypothetical protein SELMODRAFT_173087             148   2e-38   
ref|XP_002993397.1|  hypothetical protein SELMODRAFT_236735             147   2e-38   
gb|EYU20220.1|  hypothetical protein MIMGU_mgv1a005965mg                146   2e-37   Erythranthe guttata [common monkey flower]
gb|EMT29046.1|  Aspartate aminotransferase, chloroplastic               145   3e-37   
gb|EMS51671.1|  Aspartate aminotransferase, chloroplastic               145   5e-37   Triticum urartu
gb|EYU20219.1|  hypothetical protein MIMGU_mgv1a005965mg                144   6e-37   Erythranthe guttata [common monkey flower]
ref|XP_001785888.1|  predicted protein                                  133   1e-32   
emb|CAN64661.1|  hypothetical protein VITISV_034785                     130   5e-32   Vitis vinifera
gb|KJB55008.1|  hypothetical protein B456_009G060500                    127   2e-31   Gossypium raimondii
ref|XP_008378725.1|  PREDICTED: aspartate aminotransferase P2, mi...    119   2e-30   Malus domestica [apple tree]
ref|XP_005642879.1|  aspartate aminotransferase                         122   6e-29   Coccomyxa subellipsoidea C-169
ref|XP_005851216.1|  hypothetical protein CHLNCDRAFT_137913             119   5e-28   Chlorella variabilis
ref|XP_001700039.1|  aspartate aminotransferase                         112   2e-25   Chlamydomonas reinhardtii
ref|XP_008784798.1|  PREDICTED: aspartate aminotransferase, chlor...    106   2e-24   
ref|XP_008784799.1|  PREDICTED: aspartate aminotransferase, chlor...    106   2e-24   Phoenix dactylifera
ref|XP_011084852.1|  PREDICTED: aspartate aminotransferase, chlor...    105   3e-24   
ref|XP_002950644.1|  aspartate aminotransferase                         105   4e-23   Volvox carteri f. nagariensis
gb|KIP12008.1|  hypothetical protein PHLGIDRAFT_27620                   104   8e-23   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_010878037.1|  PREDICTED: aspartate aminotransferase, mitoc...    103   1e-22   Esox lucius
ref|XP_005814426.1|  PREDICTED: aspartate aminotransferase, mitoc...    103   3e-22   Xiphophorus maculatus
ref|XP_008292179.1|  PREDICTED: aspartate aminotransferase, mitoc...    103   3e-22   Stegastes partitus
gb|KDQ63696.1|  hypothetical protein JAAARDRAFT_29716                   103   3e-22   Jaapia argillacea MUCL 33604
ref|XP_008033064.1|  hypothetical protein TRAVEDRAFT_109115             102   3e-22   Trametes versicolor FP-101664 SS1
ref|XP_003442303.1|  PREDICTED: aspartate aminotransferase, mitoc...    102   3e-22   Oreochromis niloticus
ref|XP_004543093.1|  PREDICTED: aspartate aminotransferase, mitoc...    102   4e-22   Maylandia zebra
ref|XP_006780104.1|  PREDICTED: aspartate aminotransferase, mitoc...    102   4e-22   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003064597.1|  aspartate amino transferase                        102   4e-22   Micromonas pusilla CCMP1545
gb|ACI34022.1|  Aspartate aminotransferase, mitochondrial precursor     102   4e-22   Salmo salar
ref|XP_007762781.1|  hypothetical protein CONPUDRAFT_78940              102   5e-22   Coniophora puteana RWD-64-598 SS2
ref|XP_003970037.1|  PREDICTED: aspartate aminotransferase, mitoc...    102   5e-22   Takifugu rubripes [tiger puffer]
ref|XP_007359882.1|  PLP-dependent transferase                          101   9e-22   Dichomitus squalens LYAD-421 SS1
gb|KIK71059.1|  hypothetical protein GYMLUDRAFT_33186                   101   9e-22   Gymnopus luxurians FD-317 M1
ref|XP_007549969.1|  PREDICTED: aspartate aminotransferase, mitoc...    101   1e-21   Poecilia formosa
emb|CDO75262.1|  hypothetical protein BN946_scf184967.g15               101   1e-21   Trametes cinnabarina
ref|XP_004067248.1|  PREDICTED: aspartate aminotransferase, mitoc...    100   2e-21   Oryzias latipes [Japanese rice fish]
gb|KIY47045.1|  hypothetical protein FISHEDRAFT_46081                   100   2e-21   Fistulina hepatica ATCC 64428
ref|XP_002501168.1|  aspartate aminotransferase                         100   2e-21   Micromonas commoda
ref|XP_005152326.1|  PREDICTED: aspartate aminotransferase, mitoc...    100   3e-21   Melopsittacus undulatus
gb|KFO71408.1|  hypothetical protein N303_10396                         100   3e-21   Cuculus canorus
ref|XP_010739613.1|  PREDICTED: aspartate aminotransferase, mitoc...    100   4e-21   Larimichthys crocea [croceine croaker]
gb|KDQ30745.1|  hypothetical protein PLEOSDRAFT_1088517               99.8    4e-21   Pleurotus ostreatus PC15
gb|KFP90495.1|  hypothetical protein N311_04899                       99.8    4e-21   Apaloderma vittatum
ref|XP_007318932.1|  hypothetical protein SERLADRAFT_449644           99.8    4e-21   Serpula lacrymans var. lacrymans S7.9
ref|XP_010582297.1|  PREDICTED: aspartate aminotransferase, mitoc...  99.4    6e-21   Haliaeetus leucocephalus
ref|XP_008401656.1|  PREDICTED: aspartate aminotransferase, mitoc...  99.4    7e-21   Poecilia reticulata
ref|XP_007390433.1|  hypothetical protein PHACADRAFT_134034           99.4    7e-21   Phanerochaete carnosa HHB-10118-sp
emb|CCO28282.1|  aspartate aminotransferase                           96.3    7e-21   Rhizoctonia solani AG-1 IB
gb|KFQ35253.1|  hypothetical protein N331_07571                       98.6    8e-21   Merops nubicus
gb|KIM85250.1|  hypothetical protein PILCRDRAFT_5589                  99.0    8e-21   Piloderma croceum F 1598
ref|XP_007339747.1|  hypothetical protein AURDEDRAFT_111475           99.0    9e-21   
gb|KFP55374.1|  hypothetical protein N322_09365                       98.6    9e-21   Cariama cristata
gb|KFP19653.1|  hypothetical protein Z169_06078                       98.6    1e-20   Egretta garzetta
ref|XP_006863643.1|  PREDICTED: aspartate aminotransferase, mitoc...  98.6    1e-20   Chrysochloris asiatica
gb|KFQ16652.1|  hypothetical protein N330_09915                       98.2    1e-20   Leptosomus discolor
gb|KFZ50221.1|  hypothetical protein N321_06413                       98.2    1e-20   Antrostomus carolinensis
gb|KIM66148.1|  hypothetical protein SCLCIDRAFT_1211371               98.6    1e-20   Scleroderma citrinum Foug A
gb|KFP71016.1|  hypothetical protein N310_05849                       98.2    1e-20   Acanthisitta chloris
gb|KFO04448.1|  hypothetical protein N312_06091                       98.2    1e-20   Balearica regulorum gibbericeps
ref|XP_007860389.1|  hypothetical protein GLOTRDRAFT_53242            98.2    1e-20   Gloeophyllum trabeum ATCC 11539
gb|KGL91867.1|  hypothetical protein N301_16701                       98.2    1e-20   Charadrius vociferus
gb|KFO97280.1|  hypothetical protein N300_07039                       98.2    1e-20   Calypte anna
gb|KFV95661.1|  hypothetical protein N327_00168                       97.4    1e-20   Fulmarus glacialis
pdb|7AAT|A  Chain A, X-Ray Structure Refinement And Comparison Of...  97.8    1e-20   Gallus gallus [bantam]
gb|KFQ68668.1|  hypothetical protein N335_07592                       97.8    2e-20   Phaethon lepturus
gb|KFQ63469.1|  hypothetical protein N334_09493                       97.8    2e-20   Pelecanus crispus
pdb|1AKA|A  Chain A, Structural Basis For The Catalytic Activity ...  97.8    2e-20   Gallus gallus [bantam]
gb|KFV53116.1|  hypothetical protein N328_06671                       97.8    2e-20   Gavia stellata
gb|KFO92044.1|  hypothetical protein N320_04667                       97.8    2e-20   Buceros rhinoceros silvestris
gb|KFW71608.1|  hypothetical protein AS28_11098                       97.8    2e-20   Pygoscelis adeliae
gb|KFV00678.1|  hypothetical protein N340_11396                       97.8    2e-20   Tauraco erythrolophus
gb|KFR02997.1|  hypothetical protein Y956_09274                       97.8    2e-20   Nipponia nippon
gb|KFQ42654.1|  hypothetical protein N333_09691                       97.8    2e-20   Nestor notabilis
gb|KIJ21699.1|  aspartate transaminase                                98.2    2e-20   Paxillus involutus ATCC 200175
gb|KFQ73258.1|  hypothetical protein N337_00339                       97.8    2e-20   Phoenicopterus ruber ruber
ref|XP_009541187.1|  hypothetical protein HETIRDRAFT_437828           98.2    2e-20   Heterobasidion irregulare TC 32-1
gb|KFP56730.1|  hypothetical protein N323_06988                       97.8    2e-20   Cathartes aura
gb|KFP38914.1|  hypothetical protein N324_09434                       97.4    2e-20   Chlamydotis macqueenii
gb|KFM02723.1|  hypothetical protein AS27_01862                       97.4    2e-20   Aptenodytes forsteri
ref|XP_009569498.1|  PREDICTED: aspartate aminotransferase, mitoc...  97.4    2e-20   Cuculus canorus
ref|XP_001520484.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    3e-20   
gb|EOA96948.1|  Aspartate aminotransferase, mitochondrial             97.1    3e-20   Anas platyrhynchos [duck]
gb|KFV92257.1|  hypothetical protein N326_05957                       97.1    3e-20   Eurypyga helias
gb|KIK94907.1|  hypothetical protein PAXRUDRAFT_827518                97.4    3e-20   Paxillus rubicundulus Ve08.2h10
gb|KII93192.1|  hypothetical protein PLICRDRAFT_35377                 97.4    3e-20   Plicaturopsis crispa FD-325 SS-3
ref|XP_007298245.1|  hypothetical protein STEHIDRAFT_88821            97.4    3e-20   Stereum hirsutum FP-91666 SS1
ref|XP_009870982.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...  96.7    3e-20   Apaloderma vittatum
gb|KFV54532.1|  hypothetical protein N341_00606                       96.7    4e-20   Tyto alba [Schleiereule]
gb|KFV73576.1|  hypothetical protein N308_13552                       96.7    4e-20   Struthio camelus australis
ref|XP_007852807.1|  aspartate aminotransferase                       97.1    4e-20   
ref|XP_005490808.1|  PREDICTED: aspartate aminotransferase, mitoc...  97.1    4e-20   
gb|KFO63074.1|  hypothetical protein N302_07001                       96.7    4e-20   Corvus brachyrhynchos
gb|KIO08228.1|  hypothetical protein M404DRAFT_997154                 97.1    4e-20   Pisolithus tinctorius Marx 270
ref|XP_003227907.1|  PREDICTED: aspartate aminotransferase, mitoc...  97.1    5e-20   Anolis carolinensis [Carolina anole]
gb|KFV01058.1|  hypothetical protein N339_06116                       96.7    5e-20   Pterocles gutturalis
ref|XP_001176672.2|  PREDICTED: aspartate aminotransferase, mitoc...  97.1    5e-20   
ref|XP_008308463.1|  PREDICTED: aspartate aminotransferase, mitoc...  96.7    6e-20   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008944416.1|  PREDICTED: aspartate aminotransferase, mitoc...  96.3    6e-20   Merops nubicus
gb|KFU92658.1|  hypothetical protein M959_01402                       96.3    6e-20   Chaetura pelagica
gb|KIM48153.1|  hypothetical protein M413DRAFT_439876                 96.7    6e-20   Hebeloma cylindrosporum h7
ref|XP_005229254.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.9    7e-20   
ref|XP_009641563.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.9    7e-20   Egretta garzetta
gb|KFW90670.1|  hypothetical protein N336_10326                       95.9    7e-20   Phalacrocorax carbo [common cormorant]
ref|XP_009697580.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.9    8e-20   Cariama cristata
gb|KIJ68385.1|  hypothetical protein HYDPIDRAFT_173129                96.3    8e-20   Hydnomerulius pinastri MD-312
ref|XP_011399285.1|  Aspartate aminotransferase P2, mitochondrial     95.9    8e-20   Auxenochlorella protothecoides
ref|XP_003209725.2|  PREDICTED: aspartate aminotransferase, mitoc...  95.9    8e-20   
ref|XP_009958443.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.9    8e-20   Leptosomus discolor
ref|XP_008175935.1|  PREDICTED: aspartate aminotransferase, mitoc...  96.3    8e-20   Chrysemys picta bellii
ref|XP_010164289.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.9    9e-20   Antrostomus carolinensis
ref|XP_009583475.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.1    1e-19   Fulmarus glacialis
ref|XP_009078129.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Acanthisitta chloris
gb|EPT04274.1|  hypothetical protein FOMPIDRAFT_1021952               95.9    1e-19   Fomitopsis pinicola FP-58527 SS1
dbj|GAC99339.1|  potential aspartate aminotransferase                 95.9    1e-19   Pseudozyma hubeiensis SY62
gb|EJT99836.1|  aspartate aminotransferase                            95.9    1e-19   Dacryopinax primogenitus
ref|XP_009485645.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Pelecanus crispus
ref|XP_010292847.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Phaethon lepturus
ref|XP_009881551.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Charadrius vociferus
ref|XP_010298153.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Balearica regulorum gibbericeps
ref|XP_008503619.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Calypte anna
ref|XP_010138136.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Buceros rhinoceros silvestris
ref|XP_009468749.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Nipponia nippon
emb|CEL53865.1|  aspartate aminotransferase                           95.9    1e-19   Rhizoctonia solani AG-1 IB
ref|XP_009328640.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Pygoscelis adeliae
ref|XP_009088934.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Serinus canaria [canary]
ref|XP_009924468.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.1    1e-19   Haliaeetus albicilla
ref|XP_009809693.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.1    1e-19   Gavia stellata
ref|XP_009980094.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.1    1e-19   Tauraco erythrolophus
ref|XP_010013669.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.1    1e-19   Nestor notabilis
gb|KIJ27386.1|  hypothetical protein M422DRAFT_37801                  95.5    1e-19   Sphaerobolus stellatus SS14
gb|KIK28496.1|  hypothetical protein PISMIDRAFT_673506                95.5    1e-19   Pisolithus microcarpus 441
ref|XP_005025720.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   
ref|XP_004317705.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   
ref|XP_005526350.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.5    1e-19   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_010127976.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.1    1e-19   Chlamydotis macqueenii
ref|XP_009289063.1|  PREDICTED: aspartate aminotransferase, mitoc...  95.1    2e-19   
ref|XP_007004780.1|  hypothetical protein TREMEDRAFT_68635            95.1    2e-19   Tremella mesenterica DSM 1558
dbj|BAG63601.1|  unnamed protein product                              92.4    2e-19   Homo sapiens [man]
dbj|BAC56407.1|  similar to aspartate aminotransferase                92.0    2e-19   Bos taurus [bovine]
emb|CCM01943.1|  predicted protein                                    95.1    2e-19   Fibroporia radiculosa
dbj|BAC56411.1|  similar to aspartate aminotransferase                91.3    2e-19   Bos taurus [bovine]
ref|XP_002680594.1|  aspartate aminotransferase                       95.9    2e-19   Naegleria gruberi strain NEG-M
ref|XP_006109334.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    2e-19   
gb|KDQ20317.1|  hypothetical protein BOTBODRAFT_27738                 95.1    2e-19   Botryobasidium botryosum FD-172 SS1
dbj|GAA98712.1|  hypothetical protein E5Q_05400                       95.1    2e-19   Mixia osmundae IAM 14324
ref|XP_010147321.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.7    2e-19   Eurypyga helias
ref|XP_001731601.1|  hypothetical protein MGL_0869                    95.1    2e-19   Malassezia globosa CBS 7966
emb|CDI51517.1|  probable aspartate aminotransferase, mitochondri...  95.1    2e-19   Melanopsichium pennsylvanicum 4
ref|XP_003038704.1|  hypothetical protein SCHCODRAFT_42521            94.7    3e-19   Schizophyllum commune H4-8
gb|EMP28841.1|  Aspartate aminotransferase                            94.4    3e-19   Chelonia mydas [green seaturtle]
ref|XP_008562779.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.3    3e-19   Galeopterus variegatus [Malayan flying lemur]
gb|EDL87267.1|  rCG39016, isoform CRA_b                               92.4    3e-19   Rattus norvegicus [brown rat]
ref|XP_009677969.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.4    3e-19   Struthio camelus australis
ref|XP_006641457.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.7    3e-19   Lepisosteus oculatus
dbj|BAK02685.1|  predicted protein                                    94.7    3e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009967572.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.4    3e-19   Tyto alba [Schleiereule]
gb|KIK43563.1|  hypothetical protein CY34DRAFT_803728                 94.7    3e-19   Suillus luteus UH-Slu-Lm8-n1
gb|EST06526.1|  aspartate aminotransferase                            94.7    3e-19   Kalmanozyma brasiliensis GHG001
ref|XP_010080711.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.0    3e-19   Pterocles gutturalis
ref|XP_008636972.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.0    3e-19   
ref|XP_010394985.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.0    3e-19   
ref|XP_005422803.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.0    4e-19   Geospiza fortis
ref|XP_007256293.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.4    4e-19   Astyanax mexicanus [blind cave fish]
gb|KIL70778.1|  hypothetical protein M378DRAFT_183367                 94.4    4e-19   Amanita muscaria Koide BX008
ref|XP_001828762.2|  aspartate Aminotransferase                       94.4    4e-19   Coprinopsis cinerea okayama7#130
ref|XP_009999988.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.0    4e-19   Chaetura pelagica
ref|XP_005052542.1|  PREDICTED: aspartate aminotransferase, mitoc...  94.0    4e-19   Ficedula albicollis
ref|XP_007879119.1|  hypothetical protein PFL1_03411                  94.4    4e-19   Anthracocystis flocculosa PF-1
emb|CCF47934.1|  probable aspartate aminotransferase, mitochondri...  94.4    4e-19   Ustilago hordei
gb|KIO33848.1|  hypothetical protein M407DRAFT_178303                 94.0    4e-19   Tulasnella calospora MUT 4182
prf||0308236A  aminotransferase,Asp                                   94.0    4e-19
gb|EFB22248.1|  hypothetical protein PANDA_000063                     93.6    5e-19   Ailuropoda melanoleuca
ref|XP_009502368.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.6    5e-19   Phalacrocorax carbo [common cormorant]
ref|XP_011386419.1|  putative aspartate aminotransferase              94.0    5e-19   Ustilago maydis 521
emb|CCX32042.1|  Similar to Aspartate aminotransferase, mitochond...  94.0    6e-19   Pyronema omphalodes CBS 100304
gb|KDR85045.1|  hypothetical protein GALMADRAFT_218131                94.0    6e-19   Galerina marginata CBS 339.88
ref|NP_990854.1|  aspartate aminotransferase, mitochondrial precu...  93.6    6e-19   Gallus gallus [bantam]
gb|KJA29187.1|  hypothetical protein HYPSUDRAFT_32564                 93.6    6e-19   Hypholoma sublateritium FD-334 SS-4
gb|EMS22273.1|  L-aspartate:2-oxoglutarate aminotransferase           93.6    6e-19   Rhodotorula toruloides NP11
ref|XP_006454385.1|  glutamic oxaloacetic transaminase AAT1           93.6    7e-19   Agaricus bisporus var. bisporus H97
ref|NP_001016933.1|  aspartate aminotransferase, mitochondrial pr...  93.6    7e-19   Xenopus tropicalis [western clawed frog]
ref|XP_003282681.2|  PREDICTED: aspartate aminotransferase, mitoc...  92.8    7e-19   
ref|XP_007112903.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.6    7e-19   
prf||1003180A  aminotransferase,Asp                                   93.2    7e-19
ref|XP_006020296.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.6    8e-19   
ref|NP_956283.1|  aspartate aminotransferase 2                        93.6    8e-19   
ref|XP_007265164.1|  glutamic oxaloacetic transaminase AAT1           93.6    8e-19   
gb|ACN40894.1|  unknown                                               94.0    8e-19   
ref|XP_003758636.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.2    9e-19   
ref|XP_007468385.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.6    9e-19   
gb|EGF32845.1|  Aromatic-amino-acid aminotransferase                  92.4    9e-19   
pdb|3HLM|A  Chain A, Crystal Structure Of Mouse Mitochondrial Asp...  92.8    9e-19   
ref|XP_006833326.1|  hypothetical protein AMTR_s00109p00068640        93.6    9e-19   
pdb|3PD6|A  Chain A, Crystal Structure Of Mouse Mitochondrial Asp...  92.8    9e-19   
gb|ABR16105.1|  unknown                                               93.2    1e-18   
ref|XP_004265006.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.2    1e-18   
ref|XP_006863642.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.2    1e-18   
ref|XP_004881984.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.2    1e-18   
ref|XP_006148520.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.2    1e-18   
gb|KIY72818.1|  hypothetical protein CYLTODRAFT_417594                93.2    1e-18   
ref|XP_007477592.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.2    1e-18   
ref|XP_005318543.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    1e-18   
ref|XP_006099282.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.8    1e-18   
gb|KGL84885.1|  hypothetical protein N309_05764                       92.8    1e-18   
ref|XP_005873554.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.8    1e-18   
gb|EPB81442.1|  aspartate aminotransferase                            93.2    1e-18   
ref|NP_001080255.1|  aspartate aminotransferase 2                     93.2    1e-18   
ref|XP_007090444.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.6    1e-18   
ref|XP_008138091.1|  PREDICTED: aspartate aminotransferase, mitoc...  93.2    1e-18   
ref|XP_004583963.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.8    1e-18   
gb|KEP52891.1|  aspartate aminotransferase                            92.8    1e-18   
dbj|BAM85839.1|  mitochondrial aspartate aminotransferase 2           92.8    1e-18   
ref|XP_001457443.1|  hypothetical protein                             92.8    1e-18   
prf||0410468A  aminotransferase,Asp                                   92.4    1e-18
ref|XP_006110233.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.8    1e-18   
ref|XP_005504845.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    1e-18   
ref|XP_005692154.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    1e-18   
gb|AID18683.1|  aspartate aminotransferase                            92.8    2e-18   
gb|EPQ12242.1|  Aspartate aminotransferase, mitochondrial             92.8    2e-18   
ref|XP_002126101.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.8    2e-18   
emb|CBQ68007.1|  probable aspartate aminotransferase, mitochondri...  92.4    2e-18   
ref|XP_003998142.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    2e-18   
emb|CEP19900.1|  hypothetical protein                                 92.4    2e-18   
ref|XP_004690563.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    2e-18   
ref|XP_008700791.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    2e-18   
ref|XP_002912325.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    2e-18   
ref|XP_002954714.1|  aspartate aminotransferase                       92.4    2e-18   
gb|KDN53315.1|  hypothetical protein K437DRAFT_292488                 92.4    2e-18   
gb|KIR44346.1|  aspartate aminotransferase                            92.0    2e-18   
ref|NP_001273953.1|  aspartate aminotransferase, mitochondrial        92.4    2e-18   
ref|XP_007067232.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    2e-18   
ref|XP_004744353.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    2e-18   
ref|XP_004245266.1|  PREDICTED: aspartate aminotransferase, cytop...  92.8    2e-18   
ref|XP_004395809.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    2e-18   
ref|XP_008067406.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    2e-18   
ref|XP_006732870.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    2e-18   
sp|P08907.1|AATM_HORSE  RecName: Full=Aspartate aminotransferase,...  92.0    2e-18   
ref|NP_777231.1|  aspartate aminotransferase, mitochondrial           92.4    2e-18   
ref|XP_005899976.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    2e-18   
ref|XP_002711597.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.4    2e-18   
ref|XP_010860133.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    2e-18   
gb|KIM24154.1|  hypothetical protein M408DRAFT_76285                  92.0    2e-18   
ref|NP_998544.1|  aspartate aminotransferase 2a                       92.0    2e-18   
ref|XP_004431730.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
ref|XP_007945851.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
ref|XP_007112902.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
ref|XP_002761002.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
ref|XP_010329683.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
ref|XP_007198093.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
ref|XP_010594999.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...  92.0    3e-18   
gb|KGB78925.1|  aspartate transaminase                                91.7    3e-18   
ref|XP_772230.1|  hypothetical protein CNBM0360                       91.7    3e-18   
gb|KIR97164.1|  aspartate aminotransferase                            91.7    3e-18   
ref|XP_005345603.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
ref|XP_003509628.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
gb|AFR98265.1|  aspartate aminotransferase                            91.7    3e-18   
dbj|BAE87538.1|  unnamed protein product                              92.0    3e-18   
ref|NP_034455.1|  aspartate aminotransferase, mitochondrial           92.0    3e-18   
gb|KIR50768.1|  aspartate aminotransferase                            91.7    3e-18   
gb|KIR82897.1|  aspartate aminotransferase                            91.7    3e-18   
gb|KIR78943.1|  aspartate aminotransferase                            91.7    3e-18   
ref|XP_003197192.1|  aspartate transaminase                           91.7    3e-18   
gb|EHH31721.1|  Aspartate aminotransferase, mitochondrial             92.0    3e-18   
ref|XP_005981403.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
emb|CDI81837.1|  aspartate aminotransferase, putative                 89.0    3e-18   
ref|XP_010376502.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
ref|XP_006878782.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
ref|XP_004015091.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
gb|AAA37265.1|  mitochondrial aspartate aminotransferase              92.0    3e-18   
ref|XP_007637330.1|  PREDICTED: aspartate aminotransferase, mitoc...  92.0    3e-18   
gb|AAB91426.1|  aspartate aminotransferase precursor                  91.7    3e-18   
ref|XP_005078702.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    3e-18   
gb|EHH60442.1|  Aspartate aminotransferase, mitochondrial             91.7    3e-18   
ref|NP_001270119.1|  aspartate aminotransferase, mitochondrial        91.7    3e-18   
ref|NP_999093.1|  aspartate aminotransferase, mitochondrial precu...  91.7    3e-18   
ref|XP_001103601.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    3e-18   
ref|XP_523381.2|  PREDICTED: aspartate aminotransferase, mitochon...  91.7    3e-18   
ref|XP_003823746.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    3e-18   
ref|XP_568366.1|  aspartate transaminase                              91.7    3e-18   
ref|XP_006977858.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    3e-18   
emb|CAH92240.1|  hypothetical protein                                 91.7    3e-18   
dbj|BAD96991.1|  aspartate aminotransferase 2 precursor variant       91.7    3e-18   
ref|NP_001124888.1|  aspartate aminotransferase, mitochondrial        91.7    4e-18   
ref|NP_002071.2|  aspartate aminotransferase, mitochondrial isofo...  91.7    4e-18   
gb|AAH00525.1|  Glutamic-oxaloacetic transaminase 2, mitochondria...  91.7    4e-18   
gb|ADO27746.1|  mitochondrial aspartate aminotransferase              91.7    4e-18   
ref|XP_007670159.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    4e-18   
gb|EGU12946.1|  Aspartate aminotransferase                            93.6    4e-18   
ref|XP_004057786.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    4e-18   
gb|EPY74624.1|  Aspartate aminotransferase, mitochondrial precurs...  92.0    4e-18   
dbj|GAN02936.1|  aspartate aminotransferase                           91.3    4e-18   
ref|XP_006052520.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    4e-18   
ref|XP_003792641.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    4e-18   
ref|XP_004483033.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    4e-18   
ref|XP_003472097.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.7    4e-18   
ref|NP_037309.1|  aspartate aminotransferase, mitochondrial           91.3    5e-18   
gb|KIK06942.1|  hypothetical protein K443DRAFT_673835                 91.3    5e-18   
ref|XP_001873821.1|  glutamic oxaloacetic transaminase AAT1           91.3    5e-18   
ref|XP_009249048.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.9    5e-18   
gb|EUC63953.1|  aspartate aminotransferase                            91.7    5e-18   
dbj|GAC73835.1|  aspartate aminotransferase                           91.3    5e-18   
gb|AEB54629.1|  aspartate aminotransferase                            89.4    5e-18   
ref|WP_040723285.1|  aromatic amino acid aminotransferase             89.7    6e-18   
ref|XP_011354974.1|  PREDICTED: aspartate aminotransferase, mitoc...  91.3    6e-18   
emb|CDQ57967.1|  unnamed protein product                              91.3    6e-18   
gb|EJT48226.1|  aspartate transaminase                                90.9    6e-18   
gb|ELW66217.1|  Putative sodium-coupled neutral amino acid transp...  93.2    6e-18   
gb|ACI33023.1|  Aspartate aminotransferase, mitochondrial precursor   90.9    6e-18   
ref|XP_006366212.1|  PREDICTED: aspartate aminotransferase, chlor...  91.3    6e-18   
emb|CEG72748.1|  Putative Aspartate aminotransferase                  90.9    6e-18   
gb|ACI33481.1|  Aspartate aminotransferase, mitochondrial precursor   90.9    6e-18   
gb|KIR35408.1|  aspartate aminotransferase, mitochondrial             90.9    6e-18   
dbj|BAF83536.1|  unnamed protein product                              90.9    6e-18   
gb|KGB78963.1|  aspartate aminotransferase                            90.9    6e-18   
gb|KIR84694.1|  aspartate aminotransferase, mitochondrial             90.9    6e-18   
ref|XP_004371581.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.9    7e-18   
ref|XP_003197284.1|  aspartate aminotransferase, mitochondrial pr...  90.9    7e-18   
gb|ELK38479.1|  Aspartate aminotransferase, mitochondrial             90.5    7e-18   
gb|KIR78862.1|  aspartate aminotransferase, mitochondrial             90.9    7e-18   
ref|XP_004663500.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.5    7e-18   
emb|CEI89409.1|  Putative Aspartate aminotransferase                  90.9    7e-18   
ref|XP_008175936.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.5    7e-18   
emb|CDQ68161.1|  unnamed protein product                              90.9    7e-18   
gb|KIR59017.1|  aspartate aminotransferase, mitochondrial             90.9    7e-18   
gb|KIR45953.1|  aspartate aminotransferase, mitochondrial             90.9    7e-18   
ref|XP_004600685.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.9    7e-18   
ref|XP_006214550.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.9    8e-18   
ref|XP_006817148.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.9    8e-18   
ref|XP_001458635.1|  hypothetical protein                             90.9    8e-18   
ref|XP_010983999.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.5    8e-18   
ref|XP_007438961.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.5    9e-18   
ref|XP_010615470.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.5    9e-18   
ref|XP_010965547.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.5    9e-18   
ref|XP_006193091.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate am...  90.9    9e-18   
ref|XP_002284136.1|  PREDICTED: aspartate aminotransferase, cytop...  88.6    9e-18   
ref|XP_010224070.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.1    9e-18   
ref|XP_001495474.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.5    1e-17   
ref|XP_002989786.1|  hypothetical protein SELMODRAFT_184818           90.1    1e-17   
ref|XP_002409595.1|  GOT2 aspartate aminotransferase, putative        90.1    1e-17   
emb|CBI20886.3|  unnamed protein product                              88.6    1e-17   
ref|XP_005388565.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.9    1e-17   
ref|XP_007378607.1|  hypothetical protein PUNSTDRAFT_109873           90.1    1e-17   
ref|NP_001187511.1|  mitochondrial aspartate aminotransferase         90.5    1e-17   
ref|XP_003743821.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.1    1e-17   
gb|ACG59771.1|  chloroplast aspartate aminotransferase                89.4    1e-17   
gb|ELU39839.1|  NAD(P) transhydrogenase                               92.4    1e-17   
ref|XP_007882640.1|  PREDICTED: aspartate aminotransferase, mitoc...  90.1    1e-17   
gb|KIR52756.1|  aspartate aminotransferase, mitochondrial             90.1    1e-17   
gb|ERE79836.1|  putative sodium-coupled neutral amino acid transp...  91.7    2e-17   
gb|EJT52984.1|  aspartate aminotransferase, precursor                 89.7    2e-17   
gb|AEI84595.1|  mitochondrial aspartate transaminase                  89.4    2e-17   
gb|AFR98315.2|  aspartate aminotransferase, mitchondrial              89.7    2e-17   
gb|EKD02362.1|  aspartate aminotransferase                            89.7    2e-17   
ref|XP_006271773.1|  PREDICTED: aspartate aminotransferase, mitoc...  89.7    2e-17   
ref|XP_006909787.1|  PREDICTED: aspartate aminotransferase, mitoc...  89.7    2e-17   
gb|EMS51413.1|  Aspartate aminotransferase, cytoplasmic               88.6    2e-17   
gb|EMT25743.1|  Aspartate aminotransferase, cytoplasmic               88.2    2e-17   
gb|EMD41819.1|  hypothetical protein CERSUDRAFT_128978                89.4    2e-17   
gb|EIE83310.1|  aspartate aminotransferase                            89.4    2e-17   
prf||0709230A  transaminase,Glu oxaloacetic                           89.0    3e-17
emb|CDM84293.1|  unnamed protein product                              87.8    3e-17   
ref|XP_010250350.1|  PREDICTED: aspartate aminotransferase, cytop...  87.8    3e-17   
emb|CAA45023.1|  aspartate aminotransferase                           88.2    3e-17   
ref|XP_568414.1|  aspartate aminotransferase mitochondrial precursor  89.4    3e-17   
ref|XP_006450637.1|  hypothetical protein CICLE_v10008274mg           87.8    3e-17   
ref|XP_002284313.1|  PREDICTED: aspartate aminotransferase, cytop...  87.8    4e-17   
ref|XP_011187384.1|  PREDICTED: aspartate aminotransferase, mitoc...  89.0    4e-17   
gb|AEI84593.1|  mitochondrial aspartate transaminase                  88.2    4e-17   
gb|AEI84591.1|  mitochondrial aspartate transaminase                  88.2    4e-17   
gb|AEI84600.1|  mitochondrial aspartate transaminase                  88.2    4e-17   
gb|AEI84602.1|  mitochondrial aspartate transaminase                  88.2    4e-17   
gb|AEI84598.1|  mitochondrial aspartate transaminase                  88.2    4e-17   
dbj|BAE39800.1|  unnamed protein product                              88.6    4e-17   
emb|CCU98142.1|  unnamed protein product                              88.6    4e-17   
gb|KDO79734.1|  hypothetical protein CISIN_1g0188201mg                87.4    4e-17   
ref|XP_002990136.1|  hypothetical protein SELMODRAFT_235954           88.6    5e-17   
gb|AIT70209.1|  aspartate aminotransferase                            88.6    5e-17   
ref|XP_004350746.1|  aspartate aminotransferase                       88.2    5e-17   
gb|AIT70228.1|  aspartate aminotransferase                            88.2    5e-17   
ref|XP_006450635.1|  hypothetical protein CICLE_v10008274mg           87.8    5e-17   
ref|XP_007004515.1|  hypothetical protein TREMEDRAFT_43904            88.2    5e-17   
emb|CEG81320.1|  Putative Aspartate aminotransferase                  83.6    5e-17   
ref|NP_001044317.1|  Os01g0760600                                     87.0    6e-17   
sp|P37833.1|AATC_ORYSJ  RecName: Full=Aspartate aminotransferase,...  86.7    6e-17   
gb|AEE61384.1|  unknown                                               88.2    7e-17   
emb|CAN70394.1|  hypothetical protein VITISV_020521                   86.7    7e-17   
ref|XP_006644742.1|  PREDICTED: aspartate aminotransferase, cytop...  86.3    8e-17   
ref|XP_006450636.1|  hypothetical protein CICLE_v10008274mg           88.2    8e-17   
ref|XP_009595013.1|  PREDICTED: aspartate aminotransferase, cytop...  88.2    8e-17   
ref|XP_009782665.1|  PREDICTED: aspartate aminotransferase, cytop...  88.2    9e-17   
ref|XP_967224.1|  PREDICTED: aspartate aminotransferase, mitochon...  87.8    9e-17   
ref|NP_001040337.1|  aspartate aminotransferase                       87.8    9e-17   
gb|KDP33689.1|  hypothetical protein JCGZ_07260                       87.4    1e-16   
ref|XP_010890986.1|  PREDICTED: aspartate aminotransferase, mitoc...  87.8    1e-16   
gb|EZP39195.1|  Aspartate aminotransferase AspC                       87.4    1e-16   
gb|KHJ91721.1|  hypothetical protein OESDEN_08403                     83.2    1e-16   
ref|XP_007012061.1|  Aspartate aminotransferase 3                     87.8    1e-16   
ref|XP_001771002.1|  predicted protein                                87.0    1e-16   
ref|XP_006476088.1|  PREDICTED: aspartate aminotransferase 3, chl...  87.4    1e-16   
gb|KHJ75069.1|  hypothetical protein OESDEN_25315                     83.2    1e-16   
ref|XP_006476087.1|  PREDICTED: aspartate aminotransferase 3, chl...  87.4    1e-16   
ref|XP_007407231.1|  hypothetical protein MELLADRAFT_42605            87.4    1e-16   



>gb|KDO46793.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=363

 Score =   183 bits (464),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  363
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  364  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  543
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  544  EYLPIEGLAAFTK  582
            EYLPIEGLAAF K
Sbjct  121  EYLPIEGLAAFNK  133



>ref|XP_006450331.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006450332.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 ref|XP_006483438.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006483439.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|ESR63571.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|ESR63572.1| hypothetical protein CICLE_v10008224mg [Citrus clementina]
 gb|KDO46788.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46789.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
 gb|KDO46790.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=459

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  363
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  364  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  543
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  544  EYLPIEGLAAFTK  582
            EYLPIEGLAAF K
Sbjct  121  EYLPIEGLAAFNK  133



>gb|KDO46791.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=467

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  363
            MAST+ ++ASA+PS SLS+ +KLK K KL      T     TKS GR+ MVA VNVSRFE
Sbjct  1    MASTMLSIASATPSASLSMHEKLKGKVKLGSTTNSTAGFIKTKSFGRVSMVAAVNVSRFE  60

Query  364  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  543
            G++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENK
Sbjct  61   GVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENK  120

Query  544  EYLPIEGLAAFTK  582
            EYLPIEGLAAF K
Sbjct  121  EYLPIEGLAAFNK  133



>ref|XP_009789886.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789887.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
 ref|XP_009789888.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
sylvestris]
Length=462

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 112/136 (82%), Gaps = 3/136 (2%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  354
            M ST+F+LASA+PS S SLQD LK+K KL    Q   FG      KS+GR  M   VNVS
Sbjct  1    MVSTMFSLASATPSASFSLQDNLKSKLKLGTTSQSAFFGKDFVKAKSNGRTTMTVAVNVS  60

Query  355  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  534
            RFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG
Sbjct  61   RFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERG  120

Query  535  ENKEYLPIEGLAAFTK  582
            +NKEYLPIEGLAAF K
Sbjct  121  DNKEYLPIEGLAAFNK  136



>ref|XP_009619135.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619136.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619137.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
 ref|XP_009619138.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nicotiana 
tomentosiformis]
Length=437

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 114/136 (84%), Gaps = 3/136 (2%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  354
            MAST+F+LASA+PS S SLQD LK+K KL    Q   FG      KS+GR  M  +VNVS
Sbjct  1    MASTMFSLASAAPSASFSLQDNLKSKLKLGTTSQSAFFGKDFAKAKSNGRTTMAVSVNVS  60

Query  355  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  534
            RFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENLML+RG
Sbjct  61   RFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLMLERG  120

Query  535  ENKEYLPIEGLAAFTK  582
            +NKEYLPIEGLAAF K
Sbjct  121  DNKEYLPIEGLAAFNK  136



>ref|XP_002309659.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE93182.2| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 111/140 (79%), Gaps = 7/140 (5%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GN---ATKSHGRMRMVAT  342
            MAST+ +LAS +PS SLS+Q+ LK K +L      TLF    GN     KS GR+ M   
Sbjct  1    MASTMLSLASTTPSASLSMQEILKGKARLGSGSVSTLFNKEKGNPFIKAKSFGRISMTVA  60

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
            VNVSRFEGI+MAPPDPILGVSEAF+ADTD  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADTDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  523  LQRGENKEYLPIEGLAAFTK  582
            L+RGENKEYLPIEGLAAF K
Sbjct  121  LERGENKEYLPIEGLAAFNK  140



>ref|XP_011036642.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
 ref|XP_011036645.1| PREDICTED: aspartate aminotransferase, chloroplastic [Populus 
euphratica]
Length=466

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 110/140 (79%), Gaps = 7/140 (5%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF-------GNATKSHGRMRMVAT  342
            MAST+ +LASA+PS SLS+Q+ LK K +L      TLF        N  KS GR+ M   
Sbjct  1    MASTMISLASATPSASLSVQETLKGKTRLGSGSVSTLFNKEKGNPSNKKKSFGRISMTVA  60

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  523  LQRGENKEYLPIEGLAAFTK  582
            L+RGENKEYLPIEGLAAF K
Sbjct  121  LERGENKEYLPIEGLAAFNK  140



>ref|XP_006345635.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Solanum tuberosum]
Length=469

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 101/141 (72%), Positives = 113/141 (80%), Gaps = 5/141 (4%)
 Frame = +1

Query  172  SPITMASTVFTlasaspsvslslQDKLKAKPKLREYGQCTL----FGNATKSHGRMRMVA  339
            S   MAST+F+LAS +PS S+SLQD LK K KL    Q       F  A KS+GR  M  
Sbjct  4    SSFAMASTMFSLASVTPSASISLQDNLKPKLKLGTSSQRAFPRKDFMKA-KSNGRTTMAV  62

Query  340  TVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENL  519
             VNVSRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL
Sbjct  63   AVNVSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENL  122

Query  520  MLQRGENKEYLPIEGLAAFTK  582
            +L+RGENKEYLPIEGLAAF K
Sbjct  123  ILERGENKEYLPIEGLAAFNK  143



>ref|XP_006495466.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Citrus 
sinensis]
Length=113

 Score =   164 bits (414),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            MVA VNVSRFEG++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKA
Sbjct  1    MVAAVNVSRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKA  60

Query  511  ENLMLQRGENKEYLPIEGLAAFTK  582
            ENLML+RGENKEYLPIEGLAAF K
Sbjct  61   ENLMLERGENKEYLPIEGLAAFNK  84



>gb|AFP86894.1| aspartate aminotransferase, partial [Ilex paraguariensis]
Length=368

 Score =   170 bits (430),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 93/121 (77%), Gaps = 7/121 (6%)
 Frame = +1

Query  241  QDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVATVNVSRFEGISMAPPDPILG  399
            QD LK K KL      +  G         TK+ GR+ M   V VSRFE I+MAPPDPILG
Sbjct  21   QDTLKTKLKLTSSNHTSFLGKGKSVPFTNTKTFGRITMAVAVKVSRFESITMAPPDPILG  80

Query  400  VSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFT  579
            VSEAF+ADT+EMKLNLGVGAYRTEELQPYVL+VVKKAENLML+RGENKEYLPIEGLAAF 
Sbjct  81   VSEAFRADTNEMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFN  140

Query  580  K  582
            K
Sbjct  141  K  141



>ref|XP_004244943.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
 ref|XP_010324870.1| PREDICTED: aspartate aminotransferase, chloroplastic [Solanum 
lycopersicum]
Length=462

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 110/136 (81%), Gaps = 3/136 (2%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN---ATKSHGRMRMVATVNVS  354
            MAST+F+LAS +PS S+SLQD LK K K+    Q    G      KS+GR  M   VNVS
Sbjct  1    MASTMFSLASVTPSASISLQDNLKPKLKIGTSSQRAFPGKDFMKAKSNGRTTMAVAVNVS  60

Query  355  RFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRG  534
            RFEGI+MAP DPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL+L+RG
Sbjct  61   RFEGITMAPADPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLILERG  120

Query  535  ENKEYLPIEGLAAFTK  582
            ENKEYLPIEGLAAF K
Sbjct  121  ENKEYLPIEGLAAFNK  136



>ref|NP_001274906.1| aspartate aminotransferase, chloroplastic-like [Solanum tuberosum]
 gb|ABB55364.1| aspartate aminotransferase-like [Solanum tuberosum]
Length=462

 Score =   172 bits (435),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 112/137 (82%), Gaps = 5/137 (4%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTL----FGNATKSHGRMRMVATVNV  351
            MAST+F+LAS +PS S+SLQD LK K KL    Q       F  A KS+G+  M   VNV
Sbjct  1    MASTMFSLASVTPSASISLQDNLKPKLKLGTSSQRAFPRKDFMKA-KSNGQTTMAVAVNV  59

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTE+LQPYVL+VVKKAENL+L+R
Sbjct  60   SRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEDLQPYVLNVVKKAENLILER  119

Query  532  GENKEYLPIEGLAAFTK  582
            GENKEYLPIEGLAAF K
Sbjct  120  GENKEYLPIEGLAAFNK  136



>ref|XP_002324896.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEF03461.1| aspartate aminotransferase 2 family protein [Populus trichocarpa]
Length=466

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 111/140 (79%), Gaps = 7/140 (5%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GNAT---KSHGRMRMVAT  342
            MAST+ +LASA+PS SLS+Q+ LK K +L      TLF    GN +   KS GR+ M   
Sbjct  1    MASTMISLASATPSASLSVQETLKGKMRLGSSSVSTLFNKEKGNPSIKKKSFGRISMTVA  60

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  523  LQRGENKEYLPIEGLAAFTK  582
            L+RGENKEYL IEGLAAF K
Sbjct  121  LERGENKEYLAIEGLAAFNK  140



>ref|XP_011039608.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
 ref|XP_011039610.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Populus 
euphratica]
Length=466

 Score =   170 bits (430),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 110/140 (79%), Gaps = 7/140 (5%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLF----GN---ATKSHGRMRMVAT  342
            MAST+ +LASA+PS SLS+Q+ LK K +       TLF    GN     KS GR+ M   
Sbjct  1    MASTMLSLASATPSASLSMQEILKGKARPGSGSVSTLFNKEKGNPFIKAKSFGRISMTVA  60

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
            VNVSRFEGI+MAPPDPILGVSEAF+AD D  KLNLGVGAYRTEELQPYVLDVVKKAENLM
Sbjct  61   VNVSRFEGIAMAPPDPILGVSEAFRADIDVKKLNLGVGAYRTEELQPYVLDVVKKAENLM  120

Query  523  LQRGENKEYLPIEGLAAFTK  582
            L+RGENKEYLPIEGLAAF K
Sbjct  121  LERGENKEYLPIEGLAAFNK  140



>gb|ABN48559.1| chloroplast aspartate aminotransferase [Brassica juncea]
Length=135

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 100/134 (75%), Gaps = 6/134 (4%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  363
            MAS++ +L   S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGWTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  364  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  543
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  544  EYLPIEGLAAFTKS  585
            EYLPIEGLAAF K+
Sbjct  115  EYLPIEGLAAFNKA  128



>ref|XP_011459596.1| PREDICTED: aspartate aminotransferase, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=453

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/115 (73%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = +1

Query  241  QDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKA  420
             D  K K KL    +  LF N T+S GR+ MVA V  SRF+G++MAPPDPILGVSEAFKA
Sbjct  15   HDTHKGKIKLGSLERSNLFLN-TQSAGRVSMVAAVKTSRFDGVTMAPPDPILGVSEAFKA  73

Query  421  DTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
             T+ MKLNLGVGAYRTEELQPYVL+VVKKAENLML+RGENKEYLPIEGLAAF K+
Sbjct  74   STNLMKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFNKA  128



>ref|XP_007223036.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
 gb|EMJ24235.1| hypothetical protein PRUPE_ppa005369mg [Prunus persica]
Length=464

 Score =   166 bits (419),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 111/139 (80%), Gaps = 7/139 (5%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKL-REY-----GQCTLFGNATKSHGRMRMVATV  345
            MAST+ +LAS SPS SLS  +  K K KL R +      +  LF   T+S GR+ MVA V
Sbjct  1    MASTMLSLASVSPSASLSTHETPKGKVKLGRSFLSLNKERNNLFAK-TESFGRISMVAAV  59

Query  346  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  525
            NVS+FEG++MAPPDPILGVSEAFKA T++ KLNLGVGAYRTEELQPYVLDVVKKAENLM+
Sbjct  60   NVSKFEGVTMAPPDPILGVSEAFKASTNQSKLNLGVGAYRTEELQPYVLDVVKKAENLMI  119

Query  526  QRGENKEYLPIEGLAAFTK  582
            +RGENKEYLPIEGLAAF K
Sbjct  120  ERGENKEYLPIEGLAAFNK  138



>gb|KDO46792.1| hypothetical protein CISIN_1g012238mg [Citrus sinensis]
Length=410

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            MVA VNVSRFEG++MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYVLDVVKKA
Sbjct  1    MVAAVNVSRFEGVTMAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYVLDVVKKA  60

Query  511  ENLMLQRGENKEYLPIEGLAAFTK  582
            ENLML+RGENKEYLPIEGLAAF K
Sbjct  61   ENLMLERGENKEYLPIEGLAAFNK  84



>gb|KJB55010.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=339

 Score =   162 bits (410),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 106/140 (76%), Gaps = 9/140 (6%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  342
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F          TKS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKTKSFGRISMVVA  58

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
             NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLL  118

Query  523  LQRGENKEYLPIEGLAAFTK  582
            L++GEN+EYLPIEGLAAF K
Sbjct  119  LEKGENREYLPIEGLAAFNK  138



>gb|AAB68396.1| aspartate aminotransferase 2 precursor [Canavalia lineata]
Length=465

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 105/147 (71%), Gaps = 8/147 (5%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  342
            MAS+V + A+ S   S  L   LK KP+L +       GN       +++S GR+ M   
Sbjct  1    MASSVLSGANQSSPSSTVLNTHLKGKPRLGD-NALRFSGNKGGSNAFSSRSRGRISMAVA  59

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
             NVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKAENLM
Sbjct  60   DNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLM  119

Query  523  LQRGENKEYLPIEGLAAFTKSLQSCCL  603
            L+RG+NKEYLPIEGLAAF K+     L
Sbjct  120  LERGQNKEYLPIEGLAAFNKATAELLL  146



>ref|XP_008377672.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Malus 
domestica]
Length=464

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
            T+S GR+ MVA VNVS+FEG++MAPPDPILGVSEAFKA T+E KLNLGVGAYRTE+LQPY
Sbjct  47   TESFGRVSMVAAVNVSKFEGVTMAPPDPILGVSEAFKASTNESKLNLGVGAYRTEDLQPY  106

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VLDVVKKAENLM++RGENKEYLPIEGLAAF K
Sbjct  107  VLDVVKKAENLMIERGENKEYLPIEGLAAFNK  138



>ref|XP_002285385.1| PREDICTED: aspartate aminotransferase, chloroplastic [Vitis vinifera]
 emb|CBI21095.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  45   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  104

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VL+VVKKAENLML+RGENKEYLPIEGLAAF K
Sbjct  105  VLNVVKKAENLMLERGENKEYLPIEGLAAFNK  136



>emb|CAN76227.1| hypothetical protein VITISV_000267 [Vitis vinifera]
Length=462

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  45   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  104

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VL+VVKKAENLML+RGENKEYLPIEGLAAF K
Sbjct  105  VLNVVKKAENLMLKRGENKEYLPIEGLAAFNK  136



>ref|XP_004498776.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
[Cicer arietinum]
Length=467

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/103 (78%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = +1

Query  295  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  474
            F N ++S GR+ M   VNVSRFEGI MAPPDPILGVSEAFKADT  +KLNLGVGAYRTEE
Sbjct  47   FSN-SRSSGRISMAVAVNVSRFEGIPMAPPDPILGVSEAFKADTSNVKLNLGVGAYRTEE  105

Query  475  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            LQPYVL+VVKKAENLML+RGENKEYLPIEGLAAF K+     L
Sbjct  106  LQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLL  148



>ref|XP_008220703.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220704.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
 ref|XP_008220705.1| PREDICTED: aspartate aminotransferase, chloroplastic [Prunus 
mume]
Length=464

 Score =   164 bits (415),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
            T+S GR+ MVA VNVS+FEG+++APPDPILGVSEAFKA T++ KLNLGVGAYRTEELQPY
Sbjct  47   TESFGRISMVAAVNVSKFEGVTLAPPDPILGVSEAFKASTNQSKLNLGVGAYRTEELQPY  106

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VLDVVKKAENLM++RGENKEYLPIEGLAAF K
Sbjct  107  VLDVVKKAENLMIERGENKEYLPIEGLAAFNK  138



>ref|XP_002515455.1| aspartate aminotransferase, putative [Ricinus communis]
 gb|EEF46904.1| aspartate aminotransferase, putative [Ricinus communis]
Length=464

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 104/140 (74%), Gaps = 9/140 (6%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  342
            MAS++F+LA AS S S+   D LK K +L      T F          TKS GR+ M A 
Sbjct  1    MASSMFSLAGASLSPSM--HDTLKEKVRLGSGSIGTWFTKDKVHSFMKTKSSGRISMTAA  58

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
            VN+SRFEGI+MA PDPILGVSEAF+AD D  KLNLGVGAYRTEEL PYVLDVVKKAENLM
Sbjct  59   VNISRFEGITMALPDPILGVSEAFRADNDAKKLNLGVGAYRTEELHPYVLDVVKKAENLM  118

Query  523  LQRGENKEYLPIEGLAAFTK  582
            L+RGENKEYLPIEGLAAF K
Sbjct  119  LERGENKEYLPIEGLAAFNK  138



>ref|XP_010665799.1| PREDICTED: aspartate aminotransferase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=459

 Score =   164 bits (414),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            +S  R+ MVATVN SRF+G+SMAP DPILGVSEAFKADTDE KLNLGVGAYRTEELQPYV
Sbjct  43   QSFSRVSMVATVNASRFDGVSMAPADPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYV  102

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            L+VVKKAENLML+RGENKEYLPIEGLAAF K
Sbjct  103  LNVVKKAENLMLERGENKEYLPIEGLAAFNK  133



>ref|XP_010089944.1| Aspartate aminotransferase [Morus notabilis]
 gb|EXB38640.1| Aspartate aminotransferase [Morus notabilis]
Length=482

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 97/136 (71%), Gaps = 23/136 (17%)
 Frame = +1

Query  241  QDKLKAKPKLREYG------QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGV  402
            Q+ LK K KLR  G      +   F N  KS GR+ MVA VN SRF+GI+MAPPDPILGV
Sbjct  22   QESLKGKLKLRSSGLSFTKEKINPFANG-KSFGRVSMVAAVNASRFDGIAMAPPDPILGV  80

Query  403  SEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE------------  546
            SEAFKADT+ +KLNLGVGAYRTEELQPYVLDVVKKAENLML+RGENKE            
Sbjct  81   SEAFKADTNALKLNLGVGAYRTEELQPYVLDVVKKAENLMLERGENKEVIHVFERVDDLK  140

Query  547  ----YLPIEGLAAFTK  582
                YLPIEGLAAF K
Sbjct  141  LFLNYLPIEGLAAFNK  156



>ref|XP_010048915.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW81333.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
 gb|KCW81334.1| hypothetical protein EUGRSUZ_C02720 [Eucalyptus grandis]
Length=462

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
            TK  GR+ M   VNVSRFEGI+MAPPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPY
Sbjct  45   TKHFGRVSMSVAVNVSRFEGITMAPPDPILGVSEAFKADTDERKLNLGVGAYRTEELQPY  104

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            VL VVK AENLML+RGENKEYLPIEGLA F K+
Sbjct  105  VLKVVKTAENLMLERGENKEYLPIEGLATFNKA  137



>ref|XP_010245533.1| PREDICTED: aspartate aminotransferase, chloroplastic [Nelumbo 
nucifera]
Length=470

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 85/92 (92%), Gaps = 0/92 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
            ++S GR+ M   VNVSRFEG++MAPPDPILGVSEAF+ADT++ KLNLGVGAYRTEELQPY
Sbjct  53   SQSFGRISMTVAVNVSRFEGVTMAPPDPILGVSEAFRADTNDAKLNLGVGAYRTEELQPY  112

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VL+VVKKAENLML+RGENKEYLPIEGLAAF K
Sbjct  113  VLNVVKKAENLMLERGENKEYLPIEGLAAFNK  144



>gb|KJB55006.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=464

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 106/140 (76%), Gaps = 9/140 (6%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  342
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F          TKS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKTKSFGRISMVVA  58

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
             NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLL  118

Query  523  LQRGENKEYLPIEGLAAFTK  582
            L++GEN+EYLPIEGLAAF K
Sbjct  119  LEKGENREYLPIEGLAAFNK  138



>emb|CAA04697.1| aspartate aminotransferase 2 [Canavalia lineata]
Length=465

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 105/147 (71%), Gaps = 8/147 (5%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  342
            MAS+V + A+ S   S  L   LK KP+L +       GN       +++S GR+ M   
Sbjct  1    MASSVLSGANQSSPSSTVLNTHLKGKPRLGD-NALRFSGNKGGSNAFSSRSRGRISMAVA  59

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
             NVSRFEGI MAPPDPILGVSEAF+AD  ++KLNLGVGAYRTEELQPYVL+VVKKAENLM
Sbjct  60   DNVSRFEGIPMAPPDPILGVSEAFRADNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLM  119

Query  523  LQRGENKEYLPIEGLAAFTKSLQSCCL  603
            L+RG+NKEY+PIEGLAAF K+     L
Sbjct  120  LERGQNKEYVPIEGLAAFNKATAELLL  146



>gb|KCW81335.1| hypothetical protein EUGRSUZ_C02721 [Eucalyptus grandis]
Length=461

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            K  GR+ M   VNVSRFEGI++APPDPILGVSEAFKADTDE KLNLGVGAYRTEELQPYV
Sbjct  104  KHFGRVSMTVAVNVSRFEGITIAPPDPILGVSEAFKADTDEKKLNLGVGAYRTEELQPYV  163

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L VV+KAENLML+RGENKEYLPIEGLAAF K+
Sbjct  164  LKVVEKAENLMLERGENKEYLPIEGLAAFNKA  195



>gb|KHG15177.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=464

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 106/140 (76%), Gaps = 9/140 (6%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGN-------ATKSHGRMRMVAT  342
            MAS+VF+LASA+PS SLS  D  K K  LR    C  F           KS GR+ MV  
Sbjct  1    MASSVFSLASATPSASLSSHDIEKGKLNLRNTSLC--FKKEKNNPFMKIKSFGRISMVVA  58

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
             NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL+PYVLDVVKKA+ L+
Sbjct  59   SNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELEPYVLDVVKKADKLL  118

Query  523  LQRGENKEYLPIEGLAAFTK  582
            L++GEN+EYLPIEGLAAF K
Sbjct  119  LEKGENREYLPIEGLAAFNK  138



>gb|KDP33541.1| hypothetical protein JCGZ_07112 [Jatropha curcas]
Length=466

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNA-------TKSHGRMRMVAT  342
            MAS++ +LAS SPS SLS+ + LK K +       T F          TKS GR+ M   
Sbjct  1    MASSMLSLASTSPSASLSVHETLKGKVRHGTGSLTTWFNKEKANRFRNTKSPGRISMAIA  60

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
            VNVSRFEGI+MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEEL PYVL+VVKKAENLM
Sbjct  61   VNVSRFEGITMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEELHPYVLNVVKKAENLM  120

Query  523  LQRGENKEYLPIEGLAAFTK  582
            L+RGE KEYLPIEGLAAF K
Sbjct  121  LERGEYKEYLPIEGLAAFNK  140



>ref|XP_010942150.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Elaeis guineensis]
Length=438

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            K+ GR+RM   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVRMAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            L+VV+KAENLML+RGENKEYLPIEGLAAF K
Sbjct  98   LNVVRKAENLMLERGENKEYLPIEGLAAFNK  128



>gb|AAB46611.1| aspartate aminotransferase [Medicago sativa]
Length=455

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 85/98 (87%), Gaps = 0/98 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT+++KLNLGVGAYRTEELQPYV
Sbjct  39   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTNDVKLNLGVGAYRTEELQPYV  98

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            L+VVKKAENLML+RGENKEYLPIEGLAAF K+     L
Sbjct  99   LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLL  136



>ref|XP_010942149.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Elaeis guineensis]
Length=454

 Score =   162 bits (409),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            K+ GR+RM   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVRMAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            L+VV+KAENLML+RGENKEYLPIEGLAAF K
Sbjct  98   LNVVRKAENLMLERGENKEYLPIEGLAAFNK  128



>gb|KEH39860.1| aspartate aminotransferase [Medicago truncatula]
Length=465

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            L+VVKKAENLML+RGENKEYLPIEGLAAF K+     L
Sbjct  109  LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLL  146



>prf||1908424A Asp aminotransferase
Length=465

 Score =   161 bits (407),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            L+VVKKAENLML+RGENKEYLPIEGLAAF K+     L
Sbjct  109  LNVVKKAENLMLERGENKEYLPIEGLAAFNKATAELLL  146



>ref|XP_007011759.1| Aspartate aminotransferase [Theobroma cacao]
 gb|EOY29378.1| Aspartate aminotransferase [Theobroma cacao]
Length=464

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
            TKS GR+ MV T NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  47   TKSFGRISMVITSNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELQPY  106

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VL+VVKKA+ L+L+RGEN+EYLPIEGLAAF K
Sbjct  107  VLNVVKKADKLLLERGENREYLPIEGLAAFNK  138



>ref|XP_008445249.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X1 [Cucumis melo]
Length=465

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
             KS  R+ MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPY
Sbjct  48   AKSFSRISMVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPY  107

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            VLDVVKK E+LML+RG+NKEYLPIEGLAAF K+
Sbjct  108  VLDVVKKVESLMLERGDNKEYLPIEGLAAFNKA  140



>ref|XP_010527116.1| PREDICTED: aspartate aminotransferase, chloroplastic, partial 
[Tarenaya hassleriana]
Length=431

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 97/133 (73%), Gaps = 6/133 (5%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  363
            MAST F+L SAS        DK     KL   G    F   TKS GR+ M   V  SRF+
Sbjct  1    MASTTFSLVSASVFPREISVDK----QKLGNSGSNAFF--KTKSFGRVTMSIAVKTSRFD  54

Query  364  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  543
            GI+MAP DPILGVSEAFKADT+E+KLNLGVGAYRTEEL PYVL VVKKAENLML+RGENK
Sbjct  55   GITMAPADPILGVSEAFKADTNELKLNLGVGAYRTEELHPYVLSVVKKAENLMLERGENK  114

Query  544  EYLPIEGLAAFTK  582
            EYLPIEGLAAF K
Sbjct  115  EYLPIEGLAAFNK  127



>ref|XP_009138057.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Brassica 
rapa]
Length=453

 Score =   160 bits (405),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 100/134 (75%), Gaps = 6/134 (4%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  363
            MAS++ +L   S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGWTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  364  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  543
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  544  EYLPIEGLAAFTKS  585
            EYLPIEGLAAF K+
Sbjct  115  EYLPIEGLAAFNKA  128



>emb|CDY13467.1| BnaA03g51850D [Brassica napus]
Length=454

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 101/134 (75%), Gaps = 6/134 (4%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  363
            MAS++ +L S S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  364  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  543
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  544  EYLPIEGLAAFTKS  585
            EYLPIEGLAAF K+
Sbjct  115  EYLPIEGLAAFNKA  128



>emb|CDX72339.1| BnaC07g43610D [Brassica napus]
Length=461

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 101/134 (75%), Gaps = 6/134 (4%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLREYGQCTLFGNATKSHGRMRMVATVNVSRFE  363
            MAS++ +L S S       +DKLK  P     G        TKS  R+ M  +V  SRFE
Sbjct  1    MASSMLSLGSTSLLPREINKDKLKLGPS----GSNPFL--RTKSLSRVTMSVSVKPSRFE  54

Query  364  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  543
            GI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NK
Sbjct  55   GITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNK  114

Query  544  EYLPIEGLAAFTKS  585
            EYLPIEGLAAF K+
Sbjct  115  EYLPIEGLAAFNKA  128



>gb|KHG09550.1| Aspartate aminotransferase, chloroplastic -like protein [Gossypium 
arboreum]
Length=332

 Score =   157 bits (398),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 82/91 (90%), Gaps = 0/91 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS GR+ MV   NVSRFEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYV
Sbjct  44   KSFGRVSMVVASNVSRFEGITMAPPDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYV  103

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            LDVVKKA+ L+L++GEN+EYLPIEGLAAF K
Sbjct  104  LDVVKKADKLLLEKGENREYLPIEGLAAFNK  134



>ref|XP_004138711.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004160763.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN62979.1| hypothetical protein Csa_2G382520 [Cucumis sativus]
Length=464

 Score =   160 bits (404),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
             KS  R+ MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPY
Sbjct  47   AKSFSRISMVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPY  106

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            VLDVVKK E LML+RG+NKEYLPIEGLAAF K+
Sbjct  107  VLDVVKKVEALMLERGDNKEYLPIEGLAAFNKA  139



>ref|XP_006283713.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
 gb|EOA16611.1| hypothetical protein CARUB_v10004783mg [Capsella rubella]
Length=453

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMAVAVTPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>ref|XP_010437971.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
 ref|XP_010437972.1| PREDICTED: aspartate aminotransferase, chloroplastic [Camelina 
sativa]
Length=453

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>ref|XP_002867266.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43525.1| hypothetical protein ARALYDRAFT_491537 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>sp|P26563.1|AATM_LUPAN RecName: Full=Aspartate aminotransferase P2, mitochondrial; AltName: 
Full=Transaminase A; Flags: Precursor, partial [Lupinus 
angustifolius]
 emb|CAA42430.1| aspartate aminotransferase [Lupinus angustifolius]
Length=454

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = +1

Query  241  QDKLKAKPKLREYG--QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAF  414
             DKLK       +   Q   F NA KS  R+ MVA VNVSRFEGI MAPPDPILGVSEAF
Sbjct  14   NDKLKVGGNSLRFSKEQSNTFSNA-KSSCRISMVAAVNVSRFEGIPMAPPDPILGVSEAF  72

Query  415  KADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQS  594
            +ADT + KLNLGVGAYRTEELQPYVL VV KAENLML+RG+NKEYL IEGLAAF K+   
Sbjct  73   RADTSDAKLNLGVGAYRTEELQPYVLKVVNKAENLMLERGQNKEYLAIEGLAAFNKATAE  132

Query  595  CCL  603
              L
Sbjct  133  LLL  135



>ref|XP_009126483.1| PREDICTED: aspartate aminotransferase, chloroplastic [Brassica 
rapa]
Length=462

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M  TV  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMSVTVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>emb|CDX75211.1| BnaA01g04910D [Brassica napus]
Length=462

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M  TV  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMSVTVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>gb|KJB55007.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=468

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 107/142 (75%), Gaps = 9/142 (6%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQD--KLKAKPKLREYGQCTLFGN-------ATKSHGRMRMV  336
            MAS+VF+LASA+PS SLS  D  K+ ++ KL        F          TKS GR+ MV
Sbjct  1    MASSVFSLASATPSASLSSHDIEKISSQGKLNLRNTSLCFKKEKNNPFMKTKSFGRISMV  60

Query  337  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  516
               NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ 
Sbjct  61   VASNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADK  120

Query  517  LMLQRGENKEYLPIEGLAAFTK  582
            L+L++GEN+EYLPIEGLAAF K
Sbjct  121  LLLEKGENREYLPIEGLAAFNK  142



>ref|XP_010432788.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=495

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 105/145 (72%), Gaps = 17/145 (12%)
 Frame = +1

Query  169  PSP-ITMASTVFTlasaspsvslslQDKLK-----AKPKLREYGQCTLFGNATKSHGRMR  330
            P+P ++MAS++ +L S S       +DKLK     + P L+            KS  R+ 
Sbjct  37   PNPALSMASSMLSLGSTSLLPREISKDKLKLGTSGSNPFLK-----------AKSFSRVT  85

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  86   MTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYVLNVVKKA  145

Query  511  ENLMLQRGENKEYLPIEGLAAFTKS  585
            ENLML+RG+NKEYLPIEGL AF K+
Sbjct  146  ENLMLERGDNKEYLPIEGLTAFNKA  170



>ref|XP_006848765.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
 gb|ERN10346.1| hypothetical protein AMTR_s00026p00065580 [Amborella trichopoda]
Length=469

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            ++ G + M   VNVSRFEG++MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  53   QNSGGVTMTVAVNVSRFEGVTMAPPDPILGVSEAFKADTNSMKLNLGVGAYRTEELQPYV  112

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF ++
Sbjct  113  LNVVKKAENLMLERGDNKEYLPIEGLAAFNRA  144



>ref|XP_010447459.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Camelina 
sativa]
Length=453

 Score =   159 bits (401),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSISRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>ref|XP_006412529.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412531.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 ref|XP_006412532.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53982.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53984.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53985.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=453

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>ref|XP_006412530.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
 gb|ESQ53983.1| hypothetical protein EUTSA_v10025142mg [Eutrema salsugineum]
Length=462

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 83/92 (90%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>emb|CDP18792.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 91/111 (82%), Gaps = 5/111 (5%)
 Frame = +1

Query  259  KPKLREYGQCTLFGN---ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTD  429
            KPKL    Q ++FG     T+S  R  M   +NVSRFE I+MAPPDPILGVSEAF+ADT+
Sbjct  115  KPKL--LNQASVFGKRFVNTESFTRTTMAVALNVSRFESITMAPPDPILGVSEAFRADTN  172

Query  430  EMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            EMKLNLGVGAYRTE+LQPYVL+VVKKAE LML+RGENKEYLPIEGLA+F K
Sbjct  173  EMKLNLGVGAYRTEDLQPYVLNVVKKAEKLMLERGENKEYLPIEGLASFNK  223



>ref|XP_008784801.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Phoenix 
dactylifera]
Length=454

 Score =   157 bits (398),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            K+ GR+ +   VNVSRFE ++MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  38   KAFGRVSLAVAVNVSRFESVTMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  97

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            L+VV+KAENLML+RGENKEYLPIEGLAAF K
Sbjct  98   LNVVRKAENLMLERGENKEYLPIEGLAAFNK  128



>ref|XP_010432789.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=453

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+EMKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNEMKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGL AF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLTAFNKA  128



>gb|KJB55009.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=496

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
            TKS GR+ MV   NVSRFEGI+MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  79   TKSFGRISMVVASNVSRFEGITMAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPY  138

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VLDVVKKA+ L+L++GEN+EYLPIEGLAAF K
Sbjct  139  VLDVVKKADKLLLEKGENREYLPIEGLAAFNK  170



>ref|NP_001149005.1| aspartate aminotransferase [Zea mays]
 gb|ACG33777.1| aspartate aminotransferase [Zea mays]
Length=459

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +1

Query  298  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  477
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL
Sbjct  39   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSELKLNLGVGAYRTEEL  98

Query  478  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            QPYVL+VVKKAENLML++GENKEYLPIEGLAAF K+     L
Sbjct  99   QPYVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATAELLL  140



>ref|XP_009407084.1| PREDICTED: aspartate aminotransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=425

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +1

Query  322  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  501
            R+ M  +VNVSRFEG++MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEELQPYVL+VV
Sbjct  13   RVSMTVSVNVSRFEGVTMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEELQPYVLNVV  72

Query  502  KKAENLMLQRGENKEYLPIEGLAAFTK  582
            KKAE LML+RGENKEYLPIEGLAAF K
Sbjct  73   KKAEKLMLERGENKEYLPIEGLAAFNK  99



>gb|ACR34530.1| unknown [Zea mays]
 gb|AFW73875.1| glutamate-oxaloacetate transaminase2 [Zea mays]
Length=459

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +1

Query  298  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  477
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEEL
Sbjct  39   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSELKLNLGVGAYRTEEL  98

Query  478  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            QPYVL+VVKKAENLML++GENKEYLPIEGLAAF K+     L
Sbjct  99   QPYVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATAELLL  140



>gb|AAM67272.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>prf||2009357A Asp aminotransferase
Length=463

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            +S GR+ M    NVSRFEGI MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQPYV
Sbjct  49   RSSGRICMAVATNVSRFEGIPMAPPDPILGVSEAFKADTSDVKLNLGVGAYRTEELQPYV  108

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            L+VVKKAENLML+RGENKEYL IEGLAAF K+     L
Sbjct  109  LNVVKKAENLMLERGENKEYLFIEGLAAFNKATAELLL  146



>ref|NP_194927.1| aspartate aminotransferase [Arabidopsis thaliana]
 ref|NP_849483.1| aspartate aminotransferase [Arabidopsis thaliana]
 sp|P46248.2|AAT5_ARATH RecName: Full=Aspartate aminotransferase, chloroplastic; AltName: 
Full=Transaminase A; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16590.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAB79917.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAK96851.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AAM10068.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19775.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85987.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85988.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>emb|CAA56932.1| aspartate aminotransferase [Arabidopsis thaliana]
 emb|CAA62972.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=453

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>dbj|BAA08106.1| plastidic aspartate aminotransferase [Panicum miliaceum]
Length=457

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 96/124 (77%), Gaps = 7/124 (6%)
 Frame = +1

Query  250  LKAKPKLREYGQ------CTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEA  411
            + A+ K+  +G+      C + G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEA
Sbjct  16   IAARSKVLGWGKNQGRNGCRV-GITRKNFGRVLMALAVDVSRFEGVPMAPPDPILGVSEA  74

Query  412  FKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQ  591
            FKAD +++KLNLGVGAYRTEELQPYVL+VVKKAENLML++GENKEYLPIEGLAAF K+  
Sbjct  75   FKADKNDLKLNLGVGAYRTEELQPYVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATA  134

Query  592  SCCL  603
               L
Sbjct  135  ELLL  138



>ref|NP_001031767.1| aspartate aminotransferase [Arabidopsis thaliana]
 dbj|BAH19688.1| AT4G31990 [Arabidopsis thaliana]
 gb|AEE85989.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=462

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/92 (82%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            KS  R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYV
Sbjct  37   KSFSRVTMTVAVKPSRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>gb|EPS60991.1| aspartate aminotransferase, partial [Genlisea aurea]
Length=200

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            +S  R  MV    VSRF  +S+APPDPILGVSEAFKADT ++KLNLGVGAYRTE+LQPYV
Sbjct  19   RSFNRASMVIASGVSRFNEVSLAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEDLQPYV  78

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RGENKEYLPIEGLAAF K+
Sbjct  79   LNVVKKAENLMLERGENKEYLPIEGLAAFNKA  110



>ref|XP_008445250.1| PREDICTED: aspartate aminotransferase, chloroplastic isoform 
X2 [Cucumis melo]
Length=410

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/85 (87%), Positives = 80/85 (94%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            MVA+VNVSRFEGI+MAPPDPILGVSEAFKADT   KLNLGVGAYRTEELQPYVLDVVKK 
Sbjct  1    MVASVNVSRFEGITMAPPDPILGVSEAFKADTHGNKLNLGVGAYRTEELQPYVLDVVKKV  60

Query  511  ENLMLQRGENKEYLPIEGLAAFTKS  585
            E+LML+RG+NKEYLPIEGLAAF K+
Sbjct  61   ESLMLERGDNKEYLPIEGLAAFNKA  85



>ref|XP_011082202.1| PREDICTED: aspartate aminotransferase, chloroplastic [Sesamum 
indicum]
Length=451

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 85/103 (83%), Gaps = 3/103 (3%)
 Frame = +1

Query  283  QCTLFGN---ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGV  453
            Q TLFG      KS  R  + + V VSRF  I+MAPPDPILGVSEAF+ADT EMKLNLGV
Sbjct  23   QSTLFGKDYIRAKSFTRKSVTSAVEVSRFGDITMAPPDPILGVSEAFRADTHEMKLNLGV  82

Query  454  GAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            GAYRTE+LQPYVL+VVKKAENLML+RGENKEYLPIEGLAAF K
Sbjct  83   GAYRTEDLQPYVLNVVKKAENLMLERGENKEYLPIEGLAAFNK  125



>emb|CDJ26231.1| putative aspartate aminotransferase [Brassica oleracea]
Length=453

 Score =   155 bits (393),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            K   R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  37   KCFSRVTMSVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  96

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  97   LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  128



>gb|AAC12674.1| aspartate aminotransferase [Lotus corniculatus]
Length=457

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +1

Query  319  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  498
            GR+ M   VN SRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+V
Sbjct  44   GRISMAVAVNASRFEGIPMAPPDPILGVSEAFKADKCDLKLNLGVGAYRTEELQPYVLNV  103

Query  499  VKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            VKKAENLML RGENKEYLPIEG AAF K+     L
Sbjct  104  VKKAENLMLNRGENKEYLPIEGWAAFNKATAELLL  138



>emb|CDX68807.1| BnaC01g06460D [Brassica napus]
Length=513

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  KSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYV  489
            K   R+ M   V  SRFEGI+MAPPDPILGVSEAFKADT+E+KLNLGVGAYRTEELQPYV
Sbjct  88   KCFSRVTMSVAVKPSRFEGITMAPPDPILGVSEAFKADTNELKLNLGVGAYRTEELQPYV  147

Query  490  LDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            L+VVKKAENLML+RG+NKEYLPIEGLAAF K+
Sbjct  148  LNVVKKAENLMLERGDNKEYLPIEGLAAFNKA  179



>ref|NP_001048397.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAD19094.1| putative aspartate transaminase [Oryza sativa Japonica Group]
 dbj|BAF10311.1| Os02g0797500 [Oryza sativa Japonica Group]
 dbj|BAG97085.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74177.1| hypothetical protein OsI_09291 [Oryza sativa Indica Group]
 gb|EEE57981.1| hypothetical protein OsJ_08730 [Oryza sativa Japonica Group]
Length=458

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 86/100 (86%), Gaps = 1/100 (1%)
 Frame = +1

Query  286  CTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYR  465
            C L G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD +++KLNLGVGAYR
Sbjct  35   CRL-GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADQNDLKLNLGVGAYR  93

Query  466  TEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            TEELQPYVL+VVKKAE LML++GENKEYLPIEGLAAF K+
Sbjct  94   TEELQPYVLNVVKKAETLMLEKGENKEYLPIEGLAAFNKA  133



>ref|XP_003570308.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Brachypodium 
distachyon]
Length=455

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +1

Query  298  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  477
            G A K+ GR+ M   V+ SRFEG+ MAPPDPILGVSEAF+ADT+++KLNLGVGAYRTEEL
Sbjct  35   GIARKNFGRVVMALAVDTSRFEGVPMAPPDPILGVSEAFRADTNDLKLNLGVGAYRTEEL  94

Query  478  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            QP VL+VVKKAENLML++GENKEYLPIEGLAAF K+     L
Sbjct  95   QPSVLNVVKKAENLMLEKGENKEYLPIEGLAAFNKATADLLL  136



>gb|KJB65890.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/92 (79%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
             KS GR+ MV   NVS FEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  43   AKSFGRVSMVVASNVSHFEGITMAPPDPILGVSEAFKADDHELKLNLGVGAYRTEELQPY  102

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VLDVVKKA+ L+L++GEN EYLPIEGLAAF K
Sbjct  103  VLDVVKKADKLLLEKGENLEYLPIEGLAAFNK  134



>gb|AAB26677.2| aspartate aminotransferase isozyme 5 (chloroplast) [Glycine max]
Length=463

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  511  ENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            ENLML+RG+NKEYLPIEGLAAF K+     L
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLL  144



>ref|XP_006600243.1| PREDICTED: aspartate aminotransferase isoform X1 [Glycine max]
Length=463

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  511  ENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            ENLML+RG+NKEYLPIEGLAAF K+     L
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLL  144



>gb|ACU24502.1| unknown [Glycine max]
Length=463

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  511  ENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            ENLML+RG+NKEYLPIEGLAAF K+     L
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLL  144



>ref|NP_001237987.1| aspartate aminotransferase [Glycine max]
 gb|AAA33942.1| aspartate aminotransferase [Glycine max]
Length=463

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  511  ENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            ENLML+RG+NKEYLPIEGLAAF K+     L
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLL  144



>gb|AAN76499.1|AF315376_1 aspartate aminotransferase [Phaseolus vulgaris]
Length=461

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 92/120 (77%), Gaps = 6/120 (5%)
 Frame = +1

Query  253  KAKPKLREYGQCTLFGNA---TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKAD  423
            K KPK+   G    F  +    +S GR+  VA VN SRFEGI MAPPDPILGVSEAFKAD
Sbjct  26   KGKPKIG--GNALRFNKSFPNARSSGRVMAVA-VNGSRFEGIPMAPPDPILGVSEAFKAD  82

Query  424  TDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            T ++KLNLGVGAYRTEELQPYVL+VVKKAENLML+RG+NKEYL IEGLAAF K+     L
Sbjct  83   TSDVKLNLGVGAYRTEELQPYVLNVVKKAENLMLERGDNKEYLSIEGLAAFNKATAELLL  142



>gb|ABK24563.1| unknown [Picea sitchensis]
Length=464

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  501
            R+ M    +VSRFEG++MAPPDPILGVSEAFKADT+++KLNLGVGAYRTE+LQPYVL+VV
Sbjct  52   RINMALATDVSRFEGVTMAPPDPILGVSEAFKADTNDLKLNLGVGAYRTEDLQPYVLNVV  111

Query  502  KKAENLMLQRGENKEYLPIEGLAAFTKS  585
            KKAEN+ML++GENKEYLPIEGLAAF K+
Sbjct  112  KKAENMMLEKGENKEYLPIEGLAAFNKA  139



>gb|ACN40845.1| unknown [Picea sitchensis]
Length=453

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  501
            R+ M    +VSRFEG++MAPPDPILGVSEAFKADT+++KLNLGVGAYRTE+LQPYVL+VV
Sbjct  41   RINMALATDVSRFEGVTMAPPDPILGVSEAFKADTNDLKLNLGVGAYRTEDLQPYVLNVV  100

Query  502  KKAENLMLQRGENKEYLPIEGLAAFTKS  585
            KKAEN+ML++GENKEYLPIEGLAAF K+
Sbjct  101  KKAENMMLEKGENKEYLPIEGLAAFNKA  128



>gb|KHN22516.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M   VNVSRFEGI MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEELQPYVL+VVKKA
Sbjct  54   MAVAVNVSRFEGIPMAPPDPILGVSEAFKADNSDVKLNLGVGAYRTEELQPYVLNVVKKA  113

Query  511  ENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            ENLML+RG+NKEYLPIEGLAAF K+     L
Sbjct  114  ENLMLERGDNKEYLPIEGLAAFNKATAELLL  144



>gb|AAO23563.1| aspartate aminotransferase [Oryza sativa]
Length=414

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +1

Query  319  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  498
            GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD +++KLNLGVGAYRTEELQPYVL+V
Sbjct  1    GRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADQNDLKLNLGVGAYRTEELQPYVLNV  60

Query  499  VKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            VKKAE LML++GENKEYLPIEGLAAF K+
Sbjct  61   VKKAETLMLEKGENKEYLPIEGLAAFNKA  89



>gb|ABR16448.1| unknown [Picea sitchensis]
Length=410

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/85 (81%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M    NVSRFEG+ MAPPDPILGVSEAFKADTD++KLNLGVGAYRTE+L+PYVL+VVKKA
Sbjct  1    MAVATNVSRFEGVKMAPPDPILGVSEAFKADTDDLKLNLGVGAYRTEDLRPYVLNVVKKA  60

Query  511  ENLMLQRGENKEYLPIEGLAAFTKS  585
            EN+ML++GENKEYLPIEGLAAF K+
Sbjct  61   ENMMLEKGENKEYLPIEGLAAFIKA  85



>ref|XP_004954233.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Setaria 
italica]
Length=458

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = +1

Query  298  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  477
            G   K+ GR+ M   V+VSRFEG+ MAPPDPILGVSEAFKAD  ++KLNLGVGAYRTEEL
Sbjct  38   GITRKNFGRVMMALAVDVSRFEGVPMAPPDPILGVSEAFKADKSDLKLNLGVGAYRTEEL  97

Query  478  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            QPYVL+VVKKAENLML++GE KEYLPIEGLAAF K+     L
Sbjct  98   QPYVLNVVKKAENLMLEKGEYKEYLPIEGLAAFNKATAELLL  139



>ref|XP_006648055.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Oryza 
brachyantha]
Length=422

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 73/96 (76%), Positives = 83/96 (86%), Gaps = 0/96 (0%)
 Frame = +1

Query  298  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  477
            G   K+ GR+ M   V+VSRFE + MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  2    GITRKNFGRVMMALAVDVSRFEIVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  61

Query  478  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            QPYVL+VVKKAE LML++GENKEYLPIEGLAAF K+
Sbjct  62   QPYVLNVVKKAETLMLEKGENKEYLPIEGLAAFNKA  97



>gb|KJB65891.1| hypothetical protein B456_010G117400 [Gossypium raimondii]
Length=460

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/92 (78%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
             KS GR+ MV   NVS FEGI+MAPPDPILGVSEAFKAD  E+KLNLGVGAYRTEELQPY
Sbjct  43   AKSFGRVSMVVASNVSHFEGITMAPPDPILGVSEAFKADDHELKLNLGVGAYRTEELQPY  102

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VLDVVKK   L+L++GEN EYLPIEGLAAF K
Sbjct  103  VLDVVKKVNKLLLEKGENLEYLPIEGLAAFNK  134



>dbj|BAJ92741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  298  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  477
            G A K+ G + M  TV+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  37   GIARKNTGHIAMALTVHASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  96

Query  478  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            QP VL+VVKKAE LML++GENKEYLPIEG AAF K+     L
Sbjct  97   QPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKATADLLL  138



>dbj|BAJ96638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=457

 Score =   150 bits (379),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  298  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  477
            G A K+ G + M  TV+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEEL
Sbjct  37   GIARKNTGHIAMALTVHASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEEL  96

Query  478  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            QP VL+VVKKAE LML++GENKEYLPIEG AAF K+     L
Sbjct  97   QPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKATADLLL  138



>ref|XP_003544600.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X1 [Glycine max]
 ref|XP_006596081.1| PREDICTED: aspartate aminotransferase P2, mitochondrial-like 
isoform X2 [Glycine max]
 gb|KHN04158.1| Aspartate aminotransferase P2, mitochondrial [Glycine soja]
Length=463

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 106/144 (74%), Gaps = 4/144 (3%)
 Frame = +1

Query  184  MASTVFTlasaspsvslslQDKLKAKPKLRE----YGQCTLFGNATKSHGRMRMVATVNV  351
            MAS+V + AS S S S SL    K KP +R+    + +     ++++S GR+ M   VNV
Sbjct  1    MASSVLSAASHSVSPSCSLSTTHKGKPMIRDNTLGFHRGPNSFSSSRSRGRISMAVAVNV  60

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            SRFEGI MAPPDPILGVSEAFK D  ++KLNLGVGAYRTEELQPYVL+VVKKAENLML+R
Sbjct  61   SRFEGIPMAPPDPILGVSEAFKVDNSDVKLNLGVGAYRTEELQPYVLNVVKKAENLMLER  120

Query  532  GENKEYLPIEGLAAFTKSLQSCCL  603
            G+NKEYLPIEG AAF K+     L
Sbjct  121  GDNKEYLPIEGSAAFNKATAELLL  144



>ref|NP_001190885.1| aspartate aminotransferase [Arabidopsis thaliana]
 gb|AEE85990.1| aspartate aminotransferase [Arabidopsis thaliana]
Length=448

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/78 (90%), Positives = 76/78 (97%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            SRFEGI+MAPPDPILGVSEAFKADT+ MKLNLGVGAYRTEELQPYVL+VVKKAENLML+R
Sbjct  46   SRFEGITMAPPDPILGVSEAFKADTNGMKLNLGVGAYRTEELQPYVLNVVKKAENLMLER  105

Query  532  GENKEYLPIEGLAAFTKS  585
            G+NKEYLPIEGLAAF K+
Sbjct  106  GDNKEYLPIEGLAAFNKA  123



>ref|XP_002972976.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
 gb|EFJ26197.1| hypothetical protein SELMODRAFT_173087 [Selaginella moellendorffii]
Length=410

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M   V+VSRFE +SMAPPDPILGVSEAFKADTD  KLNLGVGAYRTE+LQPYVL VV KA
Sbjct  1    MAVAVDVSRFENVSMAPPDPILGVSEAFKADTDATKLNLGVGAYRTEDLQPYVLKVVNKA  60

Query  511  ENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            E LML+RGENKEYLPIEGLAAF K+     L
Sbjct  61   EQLMLERGENKEYLPIEGLAAFNKATAELLL  91



>ref|XP_002993397.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
 gb|EFJ05582.1| hypothetical protein SELMODRAFT_236735 [Selaginella moellendorffii]
Length=410

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M   V+VSRFE +SMAPPDPILGVSEAFKADTD  KLNLGVGAYRTE+LQPYVL VV KA
Sbjct  1    MAVAVDVSRFENVSMAPPDPILGVSEAFKADTDATKLNLGVGAYRTEDLQPYVLKVVNKA  60

Query  511  ENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            E LML+RGENKEYLPIEGLAAF K+     L
Sbjct  61   EQLMLERGENKEYLPIEGLAAFNKATAELLL  91



>gb|EYU20220.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=462

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = +1

Query  283  QCTLFGN---ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGV  453
            Q T  GN    +KS  R  M   V  S+F  I+MAPPDPILGVSEAF+ADT+EMKLNLGV
Sbjct  34   QMTFLGNDHINSKSFFRTSMSVAVENSKFTDITMAPPDPILGVSEAFRADTNEMKLNLGV  93

Query  454  GAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            GAYRTE+LQPYVL+VVKKAE LML+  ENKEYLPIEGLAAF K+
Sbjct  94   GAYRTEDLQPYVLNVVKKAETLMLEWAENKEYLPIEGLAAFNKA  137



>gb|EMT29046.1| Aspartate aminotransferase, chloroplastic [Aegilops tauschii]
Length=483

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  319  GRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  498
            G + M   V+ SRFEG+ MAPPDPILGVSEAFKADT ++KLNLGVGAYRTEELQP VL+V
Sbjct  70   GHITMALAVDASRFEGVPMAPPDPILGVSEAFKADTSDLKLNLGVGAYRTEELQPAVLNV  129

Query  499  VKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            VKKAE LML++GENKEYLPIEG AAF K+
Sbjct  130  VKKAEKLMLEKGENKEYLPIEGFAAFNKA  158



>gb|EMS51671.1| Aspartate aminotransferase, chloroplastic [Triticum urartu]
Length=468

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 89/126 (71%), Gaps = 8/126 (6%)
 Frame = +1

Query  247  KLKAKPKLREYGQCTLFGNATKSHGRMR-------MVATVNVSRFEGISMAPPDPILGVS  405
            +L+  P +R +   ++F     S  R R       M   V+ SRFEG+ MAPPDPILGVS
Sbjct  25   RLRMTP-IRTFPSNSIFQRPFSSASRDRVNTSHITMAVAVDASRFEGVPMAPPDPILGVS  83

Query  406  EAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            EAFKADT ++KLNLGVGAYRTEELQP VL+VVKKAE LML++GENKEYLPIEG AAF K+
Sbjct  84   EAFKADTSDLKLNLGVGAYRTEELQPAVLNVVKKAEKLMLEKGENKEYLPIEGFAAFNKA  143

Query  586  LQSCCL  603
                 L
Sbjct  144  TADLLL  149



>gb|EYU20219.1| hypothetical protein MIMGU_mgv1a005965mg [Erythranthe guttata]
Length=463

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 82/105 (78%), Gaps = 4/105 (4%)
 Frame = +1

Query  283  QCTLFGN----ATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLG  450
            Q T  GN    + +S  R  M   V  S+F  I+MAPPDPILGVSEAF+ADT+EMKLNLG
Sbjct  34   QMTFLGNDHINSKQSFFRTSMSVAVENSKFTDITMAPPDPILGVSEAFRADTNEMKLNLG  93

Query  451  VGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            VGAYRTE+LQPYVL+VVKKAE LML+  ENKEYLPIEGLAAF K+
Sbjct  94   VGAYRTEDLQPYVLNVVKKAETLMLEWAENKEYLPIEGLAAFNKA  138



>ref|XP_001785888.1| predicted protein [Physcomitrella patens]
 gb|EDQ49297.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M    +VSRFE ++MAP DPILGVSEAFK D  E KLNLGVGAYRTE+LQPYVL+VVKKA
Sbjct  52   MSVATDVSRFESVTMAPADPILGVSEAFKKDNSEKKLNLGVGAYRTEDLQPYVLEVVKKA  111

Query  511  ENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            E  ML+ G+NKEYLPIEGLAAF K+     L
Sbjct  112  EKKMLEGGDNKEYLPIEGLAAFNKATAELLL  142



>emb|CAN64661.1| hypothetical protein VITISV_034785 [Vitis vinifera]
Length=420

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 70/92 (76%), Gaps = 13/92 (14%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
            TKS GR+ M   VN SRFEG++MAPPDPILGVSEAF+AD  EMKLNLGVGAYRTEELQPY
Sbjct  23   TKSFGRINMAIAVNTSRFEGVTMAPPDPILGVSEAFRADNSEMKLNLGVGAYRTEELQPY  82

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VL+VVKK             YLPIEGLAAF K
Sbjct  83   VLNVVKK-------------YLPIEGLAAFNK  101



>gb|KJB55008.1| hypothetical protein B456_009G060500 [Gossypium raimondii]
Length=396

 Score =   127 bits (319),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/70 (84%), Positives = 65/70 (93%), Gaps = 0/70 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            MAP DPILGVSEAFKAD  E+KLNLGVGAYRTEELQPYVLDVVKKA+ L+L++GEN+EYL
Sbjct  1    MAPSDPILGVSEAFKADNHELKLNLGVGAYRTEELQPYVLDVVKKADKLLLEKGENREYL  60

Query  553  PIEGLAAFTK  582
            PIEGLAAF K
Sbjct  61   PIEGLAAFNK  70


 Score = 35.8 bits (81),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  570  CLHKVTAELLFGADNEVIXTKRVA  641
              +KVTA+LLFGADN VI  +RVA
Sbjct  67   AFNKVTADLLFGADNPVIKQQRVA  90



>ref|XP_008378725.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Malus 
domestica]
 ref|XP_008378741.1| PREDICTED: aspartate aminotransferase P2, mitochondrial [Malus 
domestica]
Length=126

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
            T+S GR+ MVA VNVS+FEG++MAPPDPILGVSEAFK+ T+E KL+LGVGAYRTEELQPY
Sbjct  47   TESFGRVSMVAAVNVSKFEGVTMAPPDPILGVSEAFKSSTNESKLDLGVGAYRTEELQPY  106

Query  487  VLDVVKKAENL  519
            VLDVVKK  +L
Sbjct  107  VLDVVKKVRSL  117



>ref|XP_005642879.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE18335.1| aspartate aminotransferase [Coccomyxa subellipsoidea C-169]
Length=453

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +1

Query  334  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  513
            V T   SR   + + PPDPILGVSEAFK DT+++KLNLGVGAYRTEEL+PYVL+VVKKAE
Sbjct  47   VDTKKQSRLAFVDLQPPDPILGVSEAFKRDTNDLKLNLGVGAYRTEELKPYVLNVVKKAE  106

Query  514  NLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             +ML+  ENKEYLPI+GL AF K+     L
Sbjct  107  KIMLESEENKEYLPIQGLEAFNKATAELLL  136



>ref|XP_005851216.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
 gb|EFN59114.1| hypothetical protein CHLNCDRAFT_137913 [Chlorella variabilis]
Length=441

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 64/78 (82%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            SR + +  APPDPILGVSEAFK DT   KLNLGVGAYRTEELQPYVL VV+KAE  ML +
Sbjct  41   SRLDAVEQAPPDPILGVSEAFKKDTSPDKLNLGVGAYRTEELQPYVLKVVRKAEERMLAK  100

Query  532  GENKEYLPIEGLAAFTKS  585
             ENKEYLPIEGLA+F ++
Sbjct  101  DENKEYLPIEGLASFRQA  118



>ref|XP_001700039.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
 gb|EDP07735.1| aspartate aminotransferase [Chlamydomonas reinhardtii]
Length=428

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 62/78 (79%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            SRF  ++ APPDPILGVSEAFKA TD  KLNLGVGAYR E+L+P VL VVKKAE+ +  R
Sbjct  28   SRFADVAQAPPDPILGVSEAFKASTDPNKLNLGVGAYRDEQLKPVVLSVVKKAESKIFSR  87

Query  532  GENKEYLPIEGLAAFTKS  585
             ENKEYL IEGL AF K+
Sbjct  88   NENKEYLTIEGLDAFRKA  105



>ref|XP_008784798.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X1 [Phoenix dactylifera]
Length=492

 Score =   106 bits (264),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
             K+ G    V   N SRFEG++  PPDP   + EAF+ADT + K+NL V AYR E LQP+
Sbjct  37   AKAFGPNSTVVASNGSRFEGVTAGPPDPYYELLEAFEADTSDTKVNLWVRAYRVE-LQPF  95

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VL+VVKKAE LML++GE+KEYLP++GLA F K
Sbjct  96   VLNVVKKAEKLMLEKGEDKEYLPMDGLAEFNK  127


 Score = 33.1 bits (74),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  573  LHKVTAELLFGADNEVIXTKRVA  641
             +KVTAELLFGA+N V+   RVA
Sbjct  125  FNKVTAELLFGANNPVVQEGRVA  147



>ref|XP_008784799.1| PREDICTED: aspartate aminotransferase, chloroplastic-like isoform 
X2 [Phoenix dactylifera]
Length=453

 Score =   106 bits (264),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 67/92 (73%), Gaps = 1/92 (1%)
 Frame = +1

Query  307  TKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPY  486
             K+ G    V   N SRFEG++  PPDP   + EAF+ADT + K+NL V AYR E LQP+
Sbjct  37   AKAFGPNSTVVASNGSRFEGVTAGPPDPYYELLEAFEADTSDTKVNLWVRAYRVE-LQPF  95

Query  487  VLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            VL+VVKKAE LML++GE+KEYLP++GLA F K
Sbjct  96   VLNVVKKAEKLMLEKGEDKEYLPMDGLAEFNK  127


 Score = 33.1 bits (74),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  573  LHKVTAELLFGADNEVIXTKRVA  641
             +KVTAELLFGA+N V+   RVA
Sbjct  125  FNKVTAELLFGANNPVVQEGRVA  147



>ref|XP_011084852.1| PREDICTED: aspartate aminotransferase, chloroplastic-like [Sesamum 
indicum]
Length=406

 Score =   105 bits (262),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 51/73 (70%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +1

Query  367  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  546
            I M   +P + +S+AF AD  EMKL+LG+GAYRTE+LQPYVL+VVKKAE LML+R ENKE
Sbjct  9    IGMGAEEPSVELSKAFGADRYEMKLDLGLGAYRTEDLQPYVLNVVKKAEKLMLERCENKE  68

Query  547  YLPIEGLAAFTKS  585
            YLPIEGLAAF K+
Sbjct  69   YLPIEGLAAFNKA  81


 Score = 33.5 bits (75),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  573  LHKVTAELLFGADNEVIXTKRVA  641
             +K TAELLFGAD+ VI  +RVA
Sbjct  78   FNKATAELLFGADSPVIQQQRVA  100



>ref|XP_002950644.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
 gb|EFJ48390.1| aspartate aminotransferase [Volvox carteri f. nagariensis]
Length=438

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 63/89 (71%), Gaps = 1/89 (1%)
 Frame = +1

Query  322  RMRMVATVN-VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDV  498
            R R+   V  +SRF  ++ APPDPILGVSEAF+A T   KLNLGVGAYR E+L+P VL V
Sbjct  27   RSRLALQVRCMSRFADVAQAPPDPILGVSEAFRASTSPSKLNLGVGAYRDEDLKPVVLSV  86

Query  499  VKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            VKKAE  +  R ENKEYL IEG   F K+
Sbjct  87   VKKAEAKIFSRNENKEYLSIEGFEPFRKA  115



>gb|KIP12008.1| hypothetical protein PHLGIDRAFT_27620 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=425

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAEN++  
Sbjct  22   LSTWSAVPAGPPDPILGVSEAFKADKDPRKINLGVGAYRDEHGKPYVLNSVKKAENIIAS  81

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GLA FTK+
Sbjct  82   SNPDKEYLPITGLADFTKA  100



>ref|XP_010878037.1| PREDICTED: aspartate aminotransferase, mitochondrial [Esox lucius]
Length=428

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = +1

Query  334  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  513
            V+T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +P+VLD V+KAE
Sbjct  23   VSTRNSSWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPFVLDCVRKAE  82

Query  514  NLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             L+  +  +KEYL I GL  FTKS     L
Sbjct  83   ALISSKQLDKEYLAIGGLGDFTKSCAQLAL  112



>ref|XP_005814426.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Xiphophorus 
maculatus]
Length=428

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 69/103 (67%), Gaps = 3/103 (3%)
 Frame = +1

Query  295  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  474
             GN + + G +   ++ N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPALGAL---SSRNSSWWAGVQMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDQ  69

Query  475  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             +P+VL  V+KAE LM  +  +KEYLPI GL  FTK+     L
Sbjct  70   GKPFVLSCVRKAEALMASKQLDKEYLPIGGLGEFTKACAQLAL  112



>ref|XP_008292179.1| PREDICTED: aspartate aminotransferase, mitochondrial [Stegastes 
partitus]
Length=428

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = +1

Query  295  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  474
             GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQ  69

Query  475  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             +P+VL  V+KAE L+  +  +KEYLPI GL  FTK+     L
Sbjct  70   GKPFVLSCVRKAEALIAAKQLDKEYLPIGGLGDFTKACAQLAL  112



>gb|KDQ63696.1| hypothetical protein JAAARDRAFT_29716 [Jaapia argillacea MUCL 
33604]
Length=429

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +1

Query  325  MRMVATVN-VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  501
            +RM AT   VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR ++ +PYVL  V
Sbjct  16   LRMSATAAPVSTWSAVPAGPPDPILGVSEAFKADKDSKKINLGVGAYRDDKGKPYVLSSV  75

Query  502  KKAENLMLQRGENKEYLPIEGLAAFTKS  585
            KKAE L+     +KEYLPI GL  FTK+
Sbjct  76   KKAEELLASSHPDKEYLPITGLPEFTKN  103



>ref|XP_008033064.1| hypothetical protein TRAVEDRAFT_109115 [Trametes versicolor FP-101664 
SS1]
 gb|EIW64721.1| hypothetical protein TRAVEDRAFT_109115 [Trametes versicolor FP-101664 
SS1]
Length=425

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +1

Query  340  TVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENL  519
            T ++S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE +
Sbjct  19   TGSLSAWSAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEEI  78

Query  520  MLQRGENKEYLPIEGLAAFTKS  585
            ++Q+  +KEYLPI GL  FT++
Sbjct  79   LVQQNPDKEYLPITGLPEFTQA  100



>ref|XP_003442303.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Oreochromis 
niloticus]
Length=428

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +1

Query  295  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  474
             GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDDQ  69

Query  475  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             +P+VL  V+KAE ++  +  +KEYLPI GLA F+K+     L
Sbjct  70   GKPFVLSCVRKAEAIIAAKQLDKEYLPIGGLAEFSKACAQLAL  112



>ref|XP_004543093.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Maylandia 
zebra]
 ref|XP_005741732.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Pundamilia 
nyererei]
 ref|XP_005915269.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Haplochromis 
burtoni]
Length=428

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +1

Query  295  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  474
             GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDDQ  69

Query  475  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             +P+VL  V+KAE ++  +  +KEYLPI GLA F+K+     L
Sbjct  70   GKPFVLSCVRKAEAIIAAKQLDKEYLPIGGLAEFSKACAQLAL  112



>ref|XP_006780104.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Neolamprologus 
brichardi]
Length=428

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = +1

Query  295  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  474
             GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKKDTNPKKMNLGVGAYRDDQ  69

Query  475  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             +P+VL  V+KAE ++  +  +KEYLPI GLA F+K+     L
Sbjct  70   GKPFVLSCVRKAEAIIAAKQLDKEYLPIGGLAEFSKACAQLAL  112



>ref|XP_003064597.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
 gb|EEH51502.1| aspartate amino transferase [Micromonas pusilla CCMP1545]
Length=413

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 58/71 (82%), Gaps = 0/71 (0%)
 Frame = +1

Query  364  GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENK  543
            G+  +PPDPILGVS AF+A  D  KLNLGVGAYRTEELQPYVL+VV++AE  M+  G +K
Sbjct  14   GVEPSPPDPILGVSVAFRACDDPNKLNLGVGAYRTEELQPYVLEVVREAERRMIAAGHDK  73

Query  544  EYLPIEGLAAF  576
            EYLP++GLA F
Sbjct  74   EYLPMQGLAEF  84



>gb|ACI34022.1| Aspartate aminotransferase, mitochondrial precursor [Salmo salar]
Length=428

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 3/92 (3%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            +++T N S + G+ M PPDPILGVSEAFK DT   K+NLGVGAYR +  +P+VLD V+KA
Sbjct  22   VLSTRNSSWWGGVQMGPPDPILGVSEAFKRDTSPKKMNLGVGAYRDDHGKPFVLDCVRKA  81

Query  511  ENLMLQRGENKEYLPIEGLAAFTKSLQSCCLV  606
            E L+  +  +KEYL I GL  FTK   SC L+
Sbjct  82   EALISSKQLDKEYLAIGGLGDFTK---SCALL  110



>ref|XP_007762781.1| hypothetical protein CONPUDRAFT_78940 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW86661.1| hypothetical protein CONPUDRAFT_78940 [Coniophora puteana RWD-64-598 
SS2]
Length=410

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILG++EAFKADTD  K+NLGVGAYR E  +PYVL+ VKKAE ++  
Sbjct  6    LSTWSAVPAGPPDPILGITEAFKADTDSRKINLGVGAYRDENGKPYVLNAVKKAEEIITA  65

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GLA+FTK+
Sbjct  66   AKLDKEYLPITGLASFTKN  84



>ref|XP_003970037.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Takifugu 
rubripes]
Length=428

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = +1

Query  295  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  474
             GN + S G   + AT N S + G+ M PPDPILGV+EAFK D++  K+NLGVGAYR ++
Sbjct  13   LGNISPSMG---VFATRNSSWWGGVQMGPPDPILGVTEAFKRDSNPKKMNLGVGAYRDDQ  69

Query  475  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             +P+VL  V+KAE L+  +  +KEYLPI GL  F+K+  +  L
Sbjct  70   GKPFVLSCVRKAEALIAAKQLDKEYLPIGGLGEFSKACATLAL  112



>ref|XP_007359882.1| PLP-dependent transferase [Dichomitus squalens LYAD-421 SS1]
 gb|EJF66648.1| PLP-dependent transferase [Dichomitus squalens LYAD-421 SS1]
Length=425

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  525
            ++S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE +++
Sbjct  21   SLSVWSAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEEILV  80

Query  526  QRGENKEYLPIEGLAAFTKS  585
            Q+  +KEYLPI GL  FT S
Sbjct  81   QQNPDKEYLPITGLPEFTAS  100



>gb|KIK71059.1| hypothetical protein GYMLUDRAFT_33186 [Gymnopus luxurians FD-317 
M1]
Length=423

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 60/87 (69%), Gaps = 0/87 (0%)
 Frame = +1

Query  325  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  504
            + + A   +S F  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PY+L+ VK
Sbjct  11   INLTAKRAISAFAAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYILNSVK  70

Query  505  KAENLMLQRGENKEYLPIEGLAAFTKS  585
            KAE L+     +KEYLPI G A FTK+
Sbjct  71   KAEELVANSKPDKEYLPITGFAEFTKN  97



>ref|XP_007549969.1| PREDICTED: aspartate aminotransferase, mitochondrial [Poecilia 
formosa]
Length=428

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +1

Query  334  VATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAE  513
            +++ N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +P+VL  V+KAE
Sbjct  23   LSSRNSSWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPFVLSCVRKAE  82

Query  514  NLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             LM  +  +KEYLPI G   FTK+     L
Sbjct  83   ALMASKQLDKEYLPIGGFGEFTKACAQLAL  112



>emb|CDO75262.1| hypothetical protein BN946_scf184967.g15 [Trametes cinnabarina]
Length=425

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  525
            ++S +  +   PPDPILGV+EA+KAD D  K+NLGVGAYR E  +PYVL+ VKKAE L++
Sbjct  21   SLSVWSAVPAGPPDPILGVTEAWKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEELLV  80

Query  526  QRGENKEYLPIEGLAAFTKS  585
            Q+  +KEYLPI GL  FT++
Sbjct  81   QQNPDKEYLPITGLPEFTQA  100



>ref|XP_004067248.1| PREDICTED: aspartate aminotransferase, mitochondrial [Oryzias 
latipes]
Length=428

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = +1

Query  295  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  474
             GN + S G   +++T N S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQ  69

Query  475  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             +P+VL  V+KAE+L+  +  +KEYL I GL  FTK+     L
Sbjct  70   GKPFVLSCVRKAESLIAAKQLDKEYLAIGGLGEFTKACAQLAL  112



>gb|KIY47045.1| hypothetical protein FISHEDRAFT_46081 [Fistulina hepatica ATCC 
64428]
Length=411

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  MVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKA  510
            M AT ++S +  +   PPDPILGVSEAFKAD D +K+NLGVGAYR E  +PY+L  V+KA
Sbjct  1    MNATRSISAWSAVVAGPPDPILGVSEAFKADKDPLKINLGVGAYRDEHGKPYILKSVQKA  60

Query  511  ENLMLQRGENKEYLPIEGLAAFTKS  585
            E ++     +KEYLPI GL  FTK+
Sbjct  61   EQIIEVSRPDKEYLPITGLPEFTKN  85



>ref|XP_002501168.1| aspartate aminotransferase [Micromonas sp. RCC299]
 gb|ACO62426.1| aspartate aminotransferase [Micromonas sp. RCC299]
Length=410

 Score =   100 bits (248),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 64/93 (69%), Gaps = 0/93 (0%)
 Frame = +1

Query  325  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  504
            M   A    S   G+  AP DPILGVS AF+  T+  KLNLGVGAYRTE+L+PYVLDVV+
Sbjct  1    MSTRAAAGPSFLSGVEQAPADPILGVSVAFRESTNPNKLNLGVGAYRTEDLKPYVLDVVR  60

Query  505  KAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            +AE  M++   +KEYLP++GLA F ++ +   L
Sbjct  61   QAEKRMIEADYDKEYLPMQGLAEFNEATRKLLL  93



>ref|XP_005152326.1| PREDICTED: aspartate aminotransferase, mitochondrial [Melopsittacus 
undulatus]
Length=423

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  501
            R+   AT   S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V
Sbjct  14   RLVAAATRASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLNCV  73

Query  502  KKAENLMLQRGENKEYLPIEGLAAFTKS  585
            +KAE ++  +  +KEYLPI GLA FT++
Sbjct  74   RKAEAMIASKKMDKEYLPIGGLADFTRA  101



>gb|KFO71408.1| hypothetical protein N303_10396, partial [Cuculus canorus]
Length=401

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMMASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>ref|XP_010739613.1| PREDICTED: aspartate aminotransferase, mitochondrial [Larimichthys 
crocea]
Length=428

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 69/103 (67%), Gaps = 3/103 (3%)
 Frame = +1

Query  295  FGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEE  474
             GN + S G   +++T N S + G+ M PPDPILGVSEAFK D++  K+NLGVGAYR ++
Sbjct  13   LGNISPSLG---VLSTRNSSWWGGVQMGPPDPILGVSEAFKRDSNPKKMNLGVGAYRDDQ  69

Query  475  LQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
             +P+VL  V+KAE ++  +  +KEYL I GLA F KS     L
Sbjct  70   GKPFVLSCVRKAEAIIADKQLDKEYLAIGGLAEFNKSCAQLAL  112



>gb|KDQ30745.1| hypothetical protein PLEOSDRAFT_1088517 [Pleurotus ostreatus 
PC15]
Length=426

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            VS +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL  VKKAE ++  
Sbjct  22   VSTWSAVPAGPPDPILGVTEAFKADKDSRKINLGVGAYRDEHGKPYVLTSVKKAEQILTA  81

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GL  FTK+
Sbjct  82   SNPDKEYLPITGLPEFTKA  100



>gb|KFP90495.1| hypothetical protein N311_04899, partial [Apaloderma vittatum]
Length=405

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAIMASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>ref|XP_007318932.1| hypothetical protein SERLADRAFT_449644 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN99351.1| hypothetical protein SERLA73DRAFT_108809 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO24913.1| hypothetical protein SERLADRAFT_449644 [Serpula lacrymans var. 
lacrymans S7.9]
Length=425

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  +  
Sbjct  21   LSTWSAVPAGPPDPILGITEAFKADKDARKINLGVGAYRDENGKPYVLNAVKKAEEFLTA  80

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GLA FTK+
Sbjct  81   AKNDKEYLPITGLADFTKN  99



>ref|XP_010582297.1| PREDICTED: aspartate aminotransferase, mitochondrial [Haliaeetus 
leucocephalus]
Length=421

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +1

Query  328  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  507
            R  A    S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+K
Sbjct  14   RFAAARASSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRK  73

Query  508  AENLMLQRGENKEYLPIEGLAAFTKS  585
            AE ++  +  +KEYLPI GLA FT++
Sbjct  74   AEAMIASKKMDKEYLPIGGLADFTRA  99



>ref|XP_008401656.1| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Poecilia reticulata]
Length=427

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S + G+ M PPDPILGV+EAFK DT+  K+NLGVGAYR ++ +P+VL  V+KAE LM  +
Sbjct  28   SWWAGVQMGPPDPILGVTEAFKRDTNPKKMNLGVGAYRDDQGKPFVLSCVRKAEALMTSK  87

Query  532  GENKEYLPIEGLAAFTKSLQSCCL  603
              +KEYLPI G   FTK+     L
Sbjct  88   QLDKEYLPIGGFGEFTKACAQLAL  111



>ref|XP_007390433.1| hypothetical protein PHACADRAFT_134034 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM60996.1| hypothetical protein PHACADRAFT_134034 [Phanerochaete carnosa 
HHB-10118-sp]
Length=425

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE ++  
Sbjct  22   LSTWSAVPAGPPDPILGVTEAFKADKDSRKINLGVGAYRDENGKPYVLNSVKKAEQIIES  81

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GLA FTK+
Sbjct  82   GQPDKEYLPITGLAEFTKA  100



>emb|CCO28282.1| aspartate aminotransferase [Rhizoctonia solani AG-1 IB]
Length=179

 Score = 96.3 bits (238),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  328  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  507
            R+     VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR +  +PY+L  V+ 
Sbjct  16   RLSLRAGVSTWANVPAGPPDPILGVSEAFKADKDSRKINLGVGAYRDDSGKPYILPSVQA  75

Query  508  AENLMLQRGENKEYLPIEGLAAFTK  582
            AE+ +     +KEYLPI GLA FTK
Sbjct  76   AEDKIAASKADKEYLPITGLADFTK  100



>gb|KFQ35253.1| hypothetical protein N331_07571, partial [Merops nubicus]
Length=401

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE L+  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEALIASK  61

Query  532  GENKEYLPIEGLAAFTKSLQSCCL  603
              +KEYLPI GLA FT++     L
Sbjct  62   KMDKEYLPIAGLADFTRAAAELAL  85



>gb|KIM85250.1| hypothetical protein PILCRDRAFT_5589 [Piloderma croceum F 1598]
Length=423

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE+L+  
Sbjct  19   LSTWSAVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAESLLTA  78

Query  529  RGENKEYLPIEGLAAFTK  582
               +KEYLPI GL  FTK
Sbjct  79   TSPDKEYLPITGLPEFTK  96



>ref|XP_007339747.1| hypothetical protein AURDEDRAFT_111475 [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD51900.1| hypothetical protein AURDEDRAFT_111475 [Auricularia delicata 
TFB-10046 SS5]
Length=423

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +1

Query  328  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  507
            R V   ++S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL  VKK
Sbjct  12   RAVGLRSISAWSAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYVLPSVKK  71

Query  508  AENLMLQRGENKEYLPIEGLAAFTK  582
            AE L+     +KEYLPI G A FTK
Sbjct  72   AEELIAASKADKEYLPITGNADFTK  96



>gb|KFP55374.1| hypothetical protein N322_09365, partial [Cariama cristata]
Length=401

 Score = 98.6 bits (244),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>gb|KFP19653.1| hypothetical protein Z169_06078, partial [Egretta garzetta]
Length=401

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>ref|XP_006863643.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X2 [Chrysochloris asiatica]
Length=415

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +1

Query  328  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  507
            R+++ +  +   G++M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+K
Sbjct  8    RLLSGITAAFHPGLAMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRK  67

Query  508  AENLMLQRGENKEYLPIEGLAAFTKS  585
            AE  +  +  +KEYLPI GLA F KS
Sbjct  68   AEAQIAAKNMDKEYLPIGGLAEFCKS  93



>gb|KFQ16652.1| hypothetical protein N330_09915, partial [Leptosomus discolor]
Length=401

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>gb|KFZ50221.1| hypothetical protein N321_06413, partial [Caprimulgus carolinensis]
Length=401

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>gb|KIM66148.1| hypothetical protein SCLCIDRAFT_1211371 [Scleroderma citrinum 
Foug A]
Length=424

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +1

Query  298  GNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEEL  477
            G A +S    R VA+V  S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  
Sbjct  5    GAARRSPALFRNVASV--STWSAVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDENG  62

Query  478  QPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
            +PYVL+ VKKAE  M     +KEYL I GLA+FT++
Sbjct  63   KPYVLNAVKKAEEKMAAAQLDKEYLGITGLASFTQN  98



>gb|KFP71016.1| hypothetical protein N310_05849, partial [Acanthisitta chloris]
Length=401

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KFO04448.1| hypothetical protein N312_06091, partial [Balearica regulorum 
gibbericeps]
Length=401

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>ref|XP_007860389.1| hypothetical protein GLOTRDRAFT_53242 [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ60769.1| hypothetical protein GLOTRDRAFT_53242 [Gloeophyllum trabeum ATCC 
11539]
Length=426

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            VS +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR ++ +PYVL+ VKKAE ++  
Sbjct  22   VSTWSTVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDDKGKPYVLNCVKKAEEILTT  81

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GL  FTK+
Sbjct  82   SNPDKEYLPIAGLPEFTKN  100



>gb|KGL91867.1| hypothetical protein N301_16701, partial [Charadrius vociferus]
Length=401

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KFO97280.1| hypothetical protein N300_07039, partial [Calypte anna]
Length=401

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KFV95661.1| hypothetical protein N327_00168, partial [Fulmarus glacialis]
Length=310

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|7AAT|B Chain B, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|8AAT|A Chain A, X-ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|8AAT|B Chain B, X-ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|9AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|9AAT|B Chain B, X-Ray Structure Refinement And Comparison Of Three Forms 
Of Mitochondrial Aspartate Aminotransferase
 pdb|1TAR|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAR|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAS|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAS|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAT|A Chain A, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1TAT|B Chain B, Crystalline Mitochondrial Aspartate Aminotransferase 
Exists In Only Two Conformations
 pdb|1OXO|A Chain A, Aspartate Aminotransferase, H-Asp Complex, Open Conformation
 pdb|1OXO|B Chain B, Aspartate Aminotransferase, H-Asp Complex, Open Conformation
 pdb|1IVR|A Chain A, Structure Of Aspartate Aminotransferase
 pdb|1AMA|A Chain A, Domain Closure In Mitochondrial Aspartate Aminotransferase
 pdb|1MAP|A Chain A, Crystal Structures Of True Enzymatic Reaction Intermediates: 
Aspartate And Glutamate Ketimines In Aspartate Aminotransferase
 pdb|1MAQ|A Chain A, Crystal Structures Of True Enzymatic Reaction Intermediates: 
Aspartate And Glutamate Ketimines In Aspartate Aminotransferase
 pdb|1OXP|A Chain A, Aspartate Aminotransferase, H-Asp Complex, Closed Conformation
Length=401

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>gb|KFQ68668.1| hypothetical protein N335_07592, partial [Phaethon lepturus]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KFQ63469.1| hypothetical protein N334_09493, partial [Pelecanus crispus]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAVIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKA|B Chain B, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKB|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding 
Lysine Residue
 pdb|1AKC|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate 
Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate- 
Binding Lysine Residue
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>gb|KFV53116.1| hypothetical protein N328_06671, partial [Gavia stellata]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KFO92044.1| hypothetical protein N320_04667, partial [Buceros rhinoceros 
silvestris]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIVGLADFTRA  79



>gb|KFW71608.1| hypothetical protein AS28_11098, partial [Pygoscelis adeliae]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KFV00678.1| hypothetical protein N340_11396, partial [Tauraco erythrolophus]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KFR02997.1| hypothetical protein Y956_09274, partial [Nipponia nippon]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KFQ42654.1| hypothetical protein N333_09691, partial [Nestor notabilis]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIVGLADFTRA  79



>gb|KIJ21699.1| aspartate transaminase [Paxillus involutus ATCC 200175]
Length=424

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGITEAFKADKDPRKINLGVGAYRDESGKPYVLNAVKKAEEKMAS  79

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GLA+FT++
Sbjct  80   AKLDKEYLPITGLASFTQN  98



>gb|KFQ73258.1| hypothetical protein N337_00339, partial [Phoenicopterus ruber 
ruber]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIVGLADFTRA  79



>ref|XP_009541187.1| hypothetical protein HETIRDRAFT_437828 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW87264.1| hypothetical protein HETIRDRAFT_437828 [Heterobasidion irregulare 
TC 32-1]
Length=425

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 0/81 (0%)
 Frame = +1

Query  343  VNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLM  522
             +VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR    +PYVL  VKKAE  +
Sbjct  19   ASVSTWSHVPAGPPDPILGVSEAFKADKDARKINLGVGAYRDGNGKPYVLSAVKKAEEAL  78

Query  523  LQRGENKEYLPIEGLAAFTKS  585
                 +KEYLPI GLA FTK+
Sbjct  79   RAANPDKEYLPITGLADFTKN  99



>gb|KFP56730.1| hypothetical protein N323_06988, partial [Cathartes aura]
Length=401

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>gb|KFP38914.1| hypothetical protein N324_09434, partial [Chlamydotis macqueenii]
Length=401

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>gb|KFM02723.1| hypothetical protein AS27_01862, partial [Aptenodytes forsteri]
Length=401

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTQA  79



>ref|XP_009569498.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cuculus 
canorus]
Length=393

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMMASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIAGLADFTRA  71



>ref|XP_001520484.1| PREDICTED: aspartate aminotransferase, mitochondrial-like, partial 
[Ornithorhynchus anatinus]
Length=95

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +
Sbjct  1    SWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLPSVRKAEAQIAAK  60

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA F K+
Sbjct  61   NLDKEYLPIGGLAEFCKA  78



>gb|EOA96948.1| Aspartate aminotransferase, mitochondrial, partial [Anas platyrhynchos]
Length=402

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  3    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  62

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  63   KMDKEYLPIGGLADFTRA  80



>gb|KFV92257.1| hypothetical protein N326_05957, partial [Eurypyga helias]
Length=401

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KIK94907.1| hypothetical protein PAXRUDRAFT_827518 [Paxillus rubicundulus 
Ve08.2h10]
Length=424

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGITEAFKADKDSRKINLGVGAYRDENGKPYVLNAVKKAEEKMAS  79

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GL +FT++
Sbjct  80   AKLDKEYLPITGLGSFTQN  98



>gb|KII93192.1| hypothetical protein PLICRDRAFT_35377 [Plicaturopsis crispa FD-325 
SS-3]
Length=426

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 54/77 (70%), Gaps = 0/77 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR E  +PYVL  VKKAE L+  
Sbjct  22   LSTWSAVPAGPPDPILGVSEAFKADKDPRKINLGVGAYRDENGKPYVLGSVKKAEELVAS  81

Query  529  RGENKEYLPIEGLAAFT  579
               +KEYLPI GL  FT
Sbjct  82   SNPDKEYLPITGLPEFT  98



>ref|XP_007298245.1| hypothetical protein STEHIDRAFT_88821 [Stereum hirsutum FP-91666 
SS1]
 gb|EIM92100.1| hypothetical protein STEHIDRAFT_88821 [Stereum hirsutum FP-91666 
SS1]
Length=427

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR    +PYVL  VKKAE  +  
Sbjct  23   VSTWSHVPAGPPDPILGVSEAFKADKDPRKINLGVGAYRDGNGKPYVLGAVKKAEEAIRA  82

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GLA FTK+
Sbjct  83   SNADKEYLPITGLADFTKN  101



>ref|XP_009870982.1| PREDICTED: LOW QUALITY PROTEIN: aspartate aminotransferase, mitochondrial 
[Apaloderma vittatum]
Length=390

 Score = 96.7 bits (239),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE +M  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAIMASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>gb|KFV54532.1| hypothetical protein N341_00606, partial [Tyto alba]
Length=401

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +P+VL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPFVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>gb|KFV73576.1| hypothetical protein N308_13552, partial [Struthio camelus australis]
Length=401

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAQIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIAGLADFTRA  79



>ref|XP_007852807.1| aspartate aminotransferase [Moniliophthora roreri MCA 2997]
 gb|ESK87894.1| aspartate aminotransferase [Moniliophthora roreri MCA 2997]
Length=427

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  525
            ++S +  ++  PPD ILGV+EAFKAD D  K+NLGVGAYR +  +PYVL  VKKAE+L+ 
Sbjct  22   SISVWSSVAAGPPDSILGVTEAFKADKDPRKINLGVGAYRDDNGKPYVLPSVKKAEDLVA  81

Query  526  QRGENKEYLPIEGLAAFTKS  585
                +KEYLPI GLA FTK+
Sbjct  82   SSKPDKEYLPITGLAEFTKN  101



>ref|XP_005490808.1| PREDICTED: aspartate aminotransferase, mitochondrial [Zonotrichia 
albicollis]
Length=422

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  23   SWWSHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  82

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  83   KMDKEYLPIGGLADFTRA  100



>gb|KFO63074.1| hypothetical protein N302_07001, partial [Corvus brachyrhynchos]
Length=401

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 59/78 (76%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KIO08228.1| hypothetical protein M404DRAFT_997154 [Pisolithus tinctorius 
Marx 270]
Length=424

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  337  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  516
            +T ++S +  +   PPD ILG++EAFKAD D  K+NLGVGAYR E  +PYVL+VVKKAE 
Sbjct  16   STASLSTWGAVPAGPPDAILGITEAFKADKDPRKINLGVGAYRDENGKPYVLNVVKKAEE  75

Query  517  LMLQRGENKEYLPIEGLAAFTKS  585
             +     +KEYLPI GLA+FT++
Sbjct  76   RITAAKMDKEYLPITGLASFTQN  98



>ref|XP_003227907.1| PREDICTED: aspartate aminotransferase, mitochondrial [Anolis 
carolinensis]
Length=424

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  RMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVV  501
            R+   A    S +  + M PPDPILGV+EAFK DT   K+NLGVGAYR +  +PYVL+ V
Sbjct  15   RLASCAARASSWWAQVEMGPPDPILGVTEAFKRDTSAKKMNLGVGAYRDDNGKPYVLNCV  74

Query  502  KKAENLMLQRGENKEYLPIEGLAAFTKS  585
            +KAE  +  +  +KEYLPI GLA FTK+
Sbjct  75   RKAEAQIAAKKMDKEYLPIAGLAEFTKA  102



>gb|KFV01058.1| hypothetical protein N339_06116, partial [Pterocles gutturalis]
Length=401

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEATIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>ref|XP_001176672.2| PREDICTED: aspartate aminotransferase, mitochondrial-like isoform 
2 [Strongylocentrotus purpuratus]
Length=431

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +1

Query  337  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  516
            A+   S ++G+ M PPDPILGVSEAFK DT+  K+NLGVGAYR +E +P+VL  VK+ E+
Sbjct  27   ASAKSSLWDGVEMGPPDPILGVSEAFKRDTNTNKINLGVGAYRDDEGKPFVLQSVKQVED  86

Query  517  LMLQRGENKEYLPIEGLAAFTK  582
             +     +KEYLPI GLA F K
Sbjct  87   KVRNMSLDKEYLPITGLADFAK  108



>ref|XP_008308463.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cynoglossus 
semilaevis]
Length=428

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +1

Query  283  QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAY  462
            QC   GN + + G   ++++ + S + G+ M PPDPILGV+EAFK D++  K+NLGVGAY
Sbjct  11   QC--LGNISPALG---VLSSRHSSWWGGVQMGPPDPILGVTEAFKRDSNPKKMNLGVGAY  65

Query  463  RTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKSLQSCCL  603
            R ++ +P+VL  V+KAE L+  +  +KEYLPI GL  F K+     L
Sbjct  66   RDDQGKPFVLSCVRKAEALIAAKQLDKEYLPIGGLGEFNKACAQLAL  112



>ref|XP_008944416.1| PREDICTED: aspartate aminotransferase, mitochondrial [Merops 
nubicus]
Length=393

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE L+  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEALIASKKMDKEYL  60

Query  553  PIEGLAAFTKSLQSCCL  603
            PI GLA FT++     L
Sbjct  61   PIAGLADFTRAAAELAL  77



>gb|KFU92658.1| hypothetical protein M959_01402, partial [Chaetura pelagica]
Length=401

 Score = 96.3 bits (238),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++   
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASN  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FT++
Sbjct  62   KMDKEYLPIGGLADFTRA  79



>gb|KIM48153.1| hypothetical protein M413DRAFT_439876 [Hebeloma cylindrosporum 
h7]
Length=426

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            VS +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PY+L  VKKAE ++  
Sbjct  22   VSTWSNVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYILPSVKKAEEIVQS  81

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GL  FTK+
Sbjct  82   SKPDKEYLPITGLPEFTKN  100



>ref|XP_005229254.1| PREDICTED: aspartate aminotransferase, mitochondrial [Falco peregrinus]
 ref|XP_005440356.1| PREDICTED: aspartate aminotransferase, mitochondrial [Falco cherrug]
Length=393

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIAGLADFTRA  71



>ref|XP_009641563.1| PREDICTED: aspartate aminotransferase, mitochondrial [Egretta 
garzetta]
Length=393

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIAGLADFTRA  71



>gb|KFW90670.1| hypothetical protein N336_10326, partial [Phalacrocorax carbo]
Length=401

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +
Sbjct  2    SWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASK  61

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GL  FT++
Sbjct  62   KMDKEYLPIAGLVDFTRA  79



>ref|XP_009697580.1| PREDICTED: aspartate aminotransferase, mitochondrial [Cariama 
cristata]
Length=393

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIAGLADFTRA  71



>gb|KIJ68385.1| hypothetical protein HYDPIDRAFT_173129 [Hydnomerulius pinastri 
MD-312]
Length=424

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILG+SEAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  M  
Sbjct  20   LSTWSAVPAGPPDPILGISEAFKADKDPRKINLGVGAYRDENGKPYVLNAVKKAEAKMAL  79

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GLA+F ++
Sbjct  80   AKLDKEYLPITGLASFAQN  98



>ref|XP_011399285.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM26389.1| Aspartate aminotransferase P2, mitochondrial [Auxenochlorella 
protothecoides]
Length=386

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/62 (77%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +1

Query  391  ILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLA  570
            ILGVSEAFK +T   KLNLGVGAYRTEELQPYVL VV KAE  ML+RG+NKEYL IEGL 
Sbjct  23   ILGVSEAFKRETSTDKLNLGVGAYRTEELQPYVLRVVGKAEKRMLERGDNKEYLSIEGLP  82

Query  571  AF  576
             F
Sbjct  83   EF  84



>ref|XP_003209725.2| PREDICTED: aspartate aminotransferase, mitochondrial [Meleagris 
gallopavo]
Length=393

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIAGLADFTRA  71



>ref|XP_009958443.1| PREDICTED: aspartate aminotransferase, mitochondrial [Leptosomus 
discolor]
Length=393

 Score = 95.9 bits (237),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIAGLADFTRA  71



>ref|XP_008175935.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X1 [Chrysemys picta bellii]
Length=429

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 64/98 (65%), Gaps = 0/98 (0%)
 Frame = +1

Query  292  LFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTE  471
            L   A + H  +  VA    S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +
Sbjct  10   LLSAAAQRHLCLAPVAARASSWWSHVEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDD  69

Query  472  ELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTKS  585
              +P+VL+ V+KAE  +  +  +KEYLPI GLA F K+
Sbjct  70   NGKPFVLNSVRKAEAQIAAKKMDKEYLPIAGLAEFNKA  107



>ref|XP_010164289.1| PREDICTED: aspartate aminotransferase, mitochondrial [Caprimulgus 
carolinensis]
Length=393

 Score = 95.9 bits (237),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIAGLADFTRA  71



>ref|XP_009583475.1| PREDICTED: aspartate aminotransferase, mitochondrial, partial 
[Fulmarus glacialis]
Length=301

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>ref|XP_009078129.1| PREDICTED: aspartate aminotransferase, mitochondrial [Acanthisitta 
chloris]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>gb|EPT04274.1| hypothetical protein FOMPIDRAFT_1021952 [Fomitopsis pinicola 
FP-58527 SS1]
Length=425

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +1

Query  337  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  516
            A   +S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR    +PYVL  VKKAE 
Sbjct  18   AAAALSTWSNVPAGPPDPILGVTEAFKADQDSRKINLGVGAYRDGNGKPYVLSSVKKAEE  77

Query  517  LMLQRGENKEYLPIEGLAAFTKS  585
             +     +KEYLPI GL  FTK+
Sbjct  78   FLTASNPDKEYLPISGLPEFTKA  100



>dbj|GAC99339.1| potential aspartate aminotransferase [Pseudozyma hubeiensis SY62]
Length=432

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  +   PPDPILGV+EAFK D D  K+NLGVGAYR E  +PYVL  V++AE L+L  
Sbjct  32   STWAHVKAGPPDPILGVTEAFKRDQDSRKINLGVGAYRDENGKPYVLPSVRQAEELVLNA  91

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FTK+
Sbjct  92   KGDKEYLPITGLANFTKN  109



>gb|EJT99836.1| aspartate aminotransferase [Dacryopinax sp. DJM-731 SS1]
Length=425

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 62/87 (71%), Gaps = 1/87 (1%)
 Frame = +1

Query  325  MRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVK  504
            +R+ AT  VS +  +   PPDPILGV+EAFKADT+  K+NLGVGAYR E  +PY+L  V+
Sbjct  14   VRLAATRPVSVWSTVPQGPPDPILGVTEAFKADTNPRKINLGVGAYRDENGKPYILPSVQ  73

Query  505  KAENLMLQRGENKEYLPIEGLAAFTKS  585
            +AEN  L    +KEYLPI GL +FT +
Sbjct  74   EAEN-RLHGQVDKEYLPITGLPSFTSA  99



>ref|XP_009485645.1| PREDICTED: aspartate aminotransferase, mitochondrial [Pelecanus 
crispus]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAVIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIAGLADFTRA  71



>ref|XP_010292847.1| PREDICTED: aspartate aminotransferase, mitochondrial [Phaethon 
lepturus]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>ref|XP_009881551.1| PREDICTED: aspartate aminotransferase, mitochondrial [Charadrius 
vociferus]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>ref|XP_010298153.1| PREDICTED: aspartate aminotransferase, mitochondrial [Balearica 
regulorum gibbericeps]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>ref|XP_008503619.1| PREDICTED: aspartate aminotransferase, mitochondrial [Calypte 
anna]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>ref|XP_010138136.1| PREDICTED: aspartate aminotransferase, mitochondrial [Buceros 
rhinoceros silvestris]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIVGLADFTRA  71



>ref|XP_009468749.1| PREDICTED: aspartate aminotransferase, mitochondrial [Nipponia 
nippon]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>emb|CEL53865.1| aspartate aminotransferase [Rhizoctonia solani AG-1 IB]
Length=426

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +1

Query  328  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  507
            R+     VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR +  +PY+L  V+ 
Sbjct  16   RLSLRAGVSTWANVPAGPPDPILGVSEAFKADKDSRKINLGVGAYRDDSGKPYILPSVQA  75

Query  508  AENLMLQRGENKEYLPIEGLAAFTK  582
            AE+ +     +KEYLPI GLA FTK
Sbjct  76   AEDKIAASKADKEYLPITGLADFTK  100



>ref|XP_009328640.1| PREDICTED: aspartate aminotransferase, mitochondrial [Pygoscelis 
adeliae]
Length=393

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>ref|XP_009088934.1| PREDICTED: aspartate aminotransferase, mitochondrial isoform 
X1 [Serinus canaria]
Length=423

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  358  FEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGE  537
            +  + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  
Sbjct  26   WSHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKM  85

Query  538  NKEYLPIEGLAAFTKS  585
            +KEYLPI GLA FT++
Sbjct  86   DKEYLPIGGLADFTRA  101



>ref|XP_009924468.1| PREDICTED: aspartate aminotransferase, mitochondrial [Haliaeetus 
albicilla]
Length=393

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>ref|XP_009809693.1| PREDICTED: aspartate aminotransferase, mitochondrial [Gavia stellata]
Length=393

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>ref|XP_009980094.1| PREDICTED: aspartate aminotransferase, mitochondrial [Tauraco 
erythrolophus]
Length=393

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>ref|XP_010013669.1| PREDICTED: aspartate aminotransferase, mitochondrial [Nestor 
notabilis]
Length=393

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDSGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIVGLADFTRA  71



>gb|KIJ27386.1| hypothetical protein M422DRAFT_37801 [Sphaerobolus stellatus 
SS14]
Length=423

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 56/85 (66%), Gaps = 0/85 (0%)
 Frame = +1

Query  328  RMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKK  507
            R  A  +VS +  +   PPDPILGVSEAFKAD    K+NLGVGAYR E  +PYVL  VKK
Sbjct  10   RRSAVRSVSLWANVPAGPPDPILGVSEAFKADPSPKKINLGVGAYRDENGKPYVLPSVKK  69

Query  508  AENLMLQRGENKEYLPIEGLAAFTK  582
            AE ++L    NKEY PI G   FTK
Sbjct  70   AETILLANKVNKEYAPITGEPEFTK  94



>gb|KIK28496.1| hypothetical protein PISMIDRAFT_673506 [Pisolithus microcarpus 
441]
Length=424

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILG++EAFKAD D  K+NLGVGAYR E  +PYVL+ VKKAE  ++ 
Sbjct  20   LSTWAAVPAGPPDPILGITEAFKADQDPRKINLGVGAYRDENGKPYVLNAVKKAEEKIIA  79

Query  529  RGENKEYLPIEGLAAFTKS  585
              ++KEYL I GLA FT++
Sbjct  80   AKQDKEYLAITGLATFTQN  98



>ref|XP_005025720.1| PREDICTED: aspartate aminotransferase, mitochondrial [Anas platyrhynchos]
Length=427

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +1

Query  367  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  546
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +  +KE
Sbjct  33   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASKKMDKE  92

Query  547  YLPIEGLAAFTKS  585
            YLPI GLA FT++
Sbjct  93   YLPIGGLADFTRA  105



>ref|XP_004317705.1| PREDICTED: aspartate aminotransferase, mitochondrial [Tursiops 
truncatus]
Length=430

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +1

Query  367  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  546
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL VV+KAE  +  R  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPVVRKAEAQIAARNLDKE  95

Query  547  YLPIEGLAAFTKS  585
            YLPI GLA F K+
Sbjct  96   YLPIGGLAEFCKA  108



>ref|XP_005526350.1| PREDICTED: aspartate aminotransferase, mitochondrial [Pseudopodoces 
humilis]
Length=423

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  358  FEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGE  537
            +  + M PPDPI+GV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +  
Sbjct  26   WSHVEMGPPDPIMGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASKKM  85

Query  538  NKEYLPIEGLAAFTKS  585
            +KEYLPI GLA FT++
Sbjct  86   DKEYLPIGGLADFTRA  101



>ref|XP_010127976.1| PREDICTED: aspartate aminotransferase, mitochondrial [Chlamydotis 
macqueenii]
Length=393

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIAGLADFTRA  71



>ref|XP_009289063.1| PREDICTED: aspartate aminotransferase, mitochondrial [Aptenodytes 
forsteri]
Length=393

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTQA  71



>ref|XP_007004780.1| hypothetical protein TREMEDRAFT_68635 [Tremella mesenterica DSM 
1558]
 gb|EIW69325.1| hypothetical protein TREMEDRAFT_68635 [Tremella mesenterica DSM 
1558]
Length=407

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  346  NVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLML  525
             +S +  +   PPDPILGV+E FKADT   K+NLGVGAYR E  +PYVL  V+KAE L+ 
Sbjct  3    GLSSWNNVPAGPPDPILGVTEKFKADTSPKKINLGVGAYRDENGKPYVLPSVQKAEKLLY  62

Query  526  QRGENKEYLPIEGLAAFTK  582
            +   +KEYLPI GLA FTK
Sbjct  63   EAKGDKEYLPITGLAPFTK  81



>dbj|BAG63601.1| unnamed protein product [Homo sapiens]
Length=189

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  358  FEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGE  537
            +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  
Sbjct  33   WTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNL  92

Query  538  NKEYLPIEGLAAFTKSLQS  594
            +KEYLPI GLA F K   S
Sbjct  93   DKEYLPIGGLAEFCKDFLS  111



>dbj|BAC56407.1| similar to aspartate aminotransferase [Bos taurus]
Length=173

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = +1

Query  367  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  546
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  95

Query  547  YLPIEGLAAFTKSLQSCCL  603
            YLPI GLA F K+     L
Sbjct  96   YLPIAGLAEFCKASAELAL  114



>emb|CCM01943.1| predicted protein [Fibroporia radiculosa]
Length=423

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR    +PYVL  VKKAE  +  
Sbjct  22   LSTWSAVPAGPPDPILGVSEAFKADQDSKKINLGVGAYRDGNGKPYVLSSVKKAEEYLSA  81

Query  529  RGENKEYLPIEGLAAFTKS  585
               +KEYLPI GL  FTK+
Sbjct  82   ANPDKEYLPISGLPEFTKA  100



>dbj|BAC56411.1| similar to aspartate aminotransferase [Bos taurus]
Length=133

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  367  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  546
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  21   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKE  80

Query  547  YLPIEGLAAFTKS  585
            YLPI GLA F K+
Sbjct  81   YLPIAGLAEFCKA  93



>ref|XP_002680594.1| aspartate aminotransferase [Naegleria gruberi]
 gb|EFC47850.1| aspartate aminotransferase [Naegleria gruberi]
Length=475

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 65/100 (65%), Gaps = 7/100 (7%)
 Frame = +1

Query  283  QCTLFGNATKSHGRMRMVATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAY  462
            Q  L+ N T +  +M        S F  I  AP DPILG+SEAFK DT   K+NLGVGAY
Sbjct  58   QSFLYSNTTAASNKM-------TSIFGTIPTAPRDPILGLSEAFKEDTSPSKVNLGVGAY  110

Query  463  RTEELQPYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            RTEE +P VL+VVKK E  +L++  +KEY+P +GL AF K
Sbjct  111  RTEEGKPLVLNVVKKVEQKILEQNLDKEYIPQDGLEAFKK  150



>ref|XP_006109334.1| PREDICTED: aspartate aminotransferase, mitochondrial-like, partial 
[Myotis lucifugus]
Length=177

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  ++KAE  +  +
Sbjct  9    SWWAHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSIRKAEAQIAAK  68

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA F K+
Sbjct  69   NLDKEYLPIGGLAEFCKA  86



>gb|KDQ20317.1| hypothetical protein BOTBODRAFT_27738 [Botryobasidium botryosum 
FD-172 SS1]
Length=420

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            +S +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL  V KAE ++  
Sbjct  16   LSTWSAVPAGPPDPILGVTEAFKADKDPRKINLGVGAYRDENGKPYVLPSVLKAEEIITA  75

Query  529  RGENKEYLPIEGLAAFTK  582
               +KEYLPI GLA FTK
Sbjct  76   SKADKEYLPITGLADFTK  93



>dbj|GAA98712.1| hypothetical protein E5Q_05400 [Mixia osmundae IAM 14324]
 gb|KEI41895.1| hypothetical protein L969DRAFT_91367 [Mixia osmundae IAM 14324]
Length=427

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  349  VSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQ  528
            V  +  +   PPDPILGV+EAFKAD D  K+NLGVGAYR E  +PYVL  V+KAE  ++ 
Sbjct  27   VKTWANVPAGPPDPILGVTEAFKADKDSRKINLGVGAYRDENGKPYVLPSVRKAEEAVIA  86

Query  529  RGENKEYLPIEGLAAFTKS  585
            +  +KEYLPI G A FTK+
Sbjct  87   KKGDKEYLPITGYADFTKN  105



>ref|XP_010147321.1| PREDICTED: aspartate aminotransferase, mitochondrial [Eurypyga 
helias]
Length=393

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = +1

Query  373  MAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKEYL  552
            M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE ++  +  +KEYL
Sbjct  1    MGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLSCVRKAEAMIASKKMDKEYL  60

Query  553  PIEGLAAFTKS  585
            PI GLA FT++
Sbjct  61   PIGGLADFTRA  71



>ref|XP_001731601.1| hypothetical protein MGL_0869 [Malassezia globosa CBS 7966]
 gb|EDP44387.1| hypothetical protein MGL_0869 [Malassezia globosa CBS 7966]
Length=427

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 60/94 (64%), Gaps = 4/94 (4%)
 Frame = +1

Query  313  SHGRMRMVATVNVSRFE----GISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQ  480
            S   + M   VN  R++    G+   PPDPILGV+EAFK D D  K+NLGVGAYR E  +
Sbjct  9    SRSTLAMKPVVNSVRYQSVWAGVPAGPPDPILGVTEAFKHDKDPRKINLGVGAYRDEHGK  68

Query  481  PYVLDVVKKAENLMLQRGENKEYLPIEGLAAFTK  582
            PYVL  V+KA++ + +   NKEYLPI GL  F K
Sbjct  69   PYVLPSVRKADHHIAKSNLNKEYLPITGLPGFNK  102



>emb|CDI51517.1| probable aspartate aminotransferase, mitochondrial precursor 
[Melanopsichium pennsylvanicum 4]
Length=432

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  +   PPDPILGV+EAFK D D  K+NLGVGAYR E  +PYVL  V++AE+L++  
Sbjct  32   STWAHVKAGPPDPILGVTEAFKRDQDPRKINLGVGAYRDENGKPYVLPSVREAEHLVINA  91

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA FTK+
Sbjct  92   KGDKEYLPITGLADFTKN  109



>ref|XP_003038704.1| hypothetical protein SCHCODRAFT_42521 [Schizophyllum commune 
H4-8]
 gb|EFJ03802.1| hypothetical protein SCHCODRAFT_42521, partial [Schizophyllum 
commune H4-8]
Length=410

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 57/83 (69%), Gaps = 0/83 (0%)
 Frame = +1

Query  337  ATVNVSRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAEN  516
            A  +VS +  +   PPDPILGVSEAFKAD D  K+NLGVGAYR E  +PYVL  VK AE 
Sbjct  2    AVRSVSVWANVPAGPPDPILGVSEAFKADKDPRKINLGVGAYRDENGKPYVLRSVKLAEK  61

Query  517  LMLQRGENKEYLPIEGLAAFTKS  585
             +     +KEYLPI GLA FTK+
Sbjct  62   AIEAAEPDKEYLPITGLADFTKN  84



>gb|EMP28841.1| Aspartate aminotransferase [Chelonia mydas]
Length=388

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL+ V+KAE  +  +
Sbjct  13   SWWSHVEMGPPDPILGVTEAFKRDTNAKKMNLGVGAYRDDNGKPYVLNSVRKAEAQIAAK  72

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA F K+
Sbjct  73   KMDKEYLPIAGLAEFNKA  90



>ref|XP_008562779.1| PREDICTED: aspartate aminotransferase, mitochondrial-like, partial 
[Galeopterus variegatus]
Length=148

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +1

Query  352  SRFEGISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQR  531
            S +  + M PPDPILGV+EA+K DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +
Sbjct  44   SWWAHVEMGPPDPILGVTEAYKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAK  103

Query  532  GENKEYLPIEGLAAFTKS  585
              +KEYLPI GLA F K+
Sbjct  104  NLDKEYLPIGGLAEFCKA  121



>gb|EDL87267.1| rCG39016, isoform CRA_b [Rattus norvegicus]
Length=199

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +1

Query  367  ISMAPPDPILGVSEAFKADTDEMKLNLGVGAYRTEELQPYVLDVVKKAENLMLQRGENKE  546
            + M PPDPILGV+EAFK DT+  K+NLGVGAYR +  +PYVL  V+KAE  +  +  +KE
Sbjct  36   VEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAGKNLDKE  95

Query  547  YLPIEGLAAFTKS  585
            YLPI GLA F K+
Sbjct  96   YLPIGGLADFCKA  108



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375