BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF043I24

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011094205.1|  PREDICTED: fasciclin-like arabinogalactan pr...    246   3e-75   Sesamum indicum [beniseed]
ref|XP_011077777.1|  PREDICTED: fasciclin-like arabinogalactan pr...    234   1e-70   Sesamum indicum [beniseed]
ref|XP_006339181.1|  PREDICTED: fasciclin-like arabinogalactan pr...    232   3e-70   Solanum tuberosum [potatoes]
ref|XP_004249393.1|  PREDICTED: fasciclin-like arabinogalactan pr...    232   5e-70   
gb|EYU18152.1|  hypothetical protein MIMGU_mgv1a003573mg                233   3e-69   Erythranthe guttata [common monkey flower]
ref|XP_009587619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    227   2e-68   Nicotiana tomentosiformis
ref|XP_009794483.1|  PREDICTED: fasciclin-like arabinogalactan pr...    227   3e-68   Nicotiana sylvestris
emb|CDP10566.1|  unnamed protein product                                227   7e-68   Coffea canephora [robusta coffee]
gb|EPS67882.1|  hypothetical protein M569_06891                         224   1e-66   Genlisea aurea
gb|EYU38707.1|  hypothetical protein MIMGU_mgv1a006053mg                223   2e-66   Erythranthe guttata [common monkey flower]
ref|XP_009595093.1|  PREDICTED: fasciclin-like arabinogalactan pr...    221   6e-66   Nicotiana tomentosiformis
gb|AGN92422.1|  putative fasciclin-like arabinogalactan protein 2       220   2e-65   Centaurium erythraea
ref|XP_009783700.1|  PREDICTED: fasciclin-like arabinogalactan pr...    218   6e-65   Nicotiana sylvestris
gb|KJB36231.1|  hypothetical protein B456_006G147500                    207   7e-62   Gossypium raimondii
ref|XP_006495395.1|  PREDICTED: fasciclin-like arabinogalactan pr...    206   1e-61   Citrus sinensis [apfelsine]
ref|XP_004303393.1|  PREDICTED: fasciclin-like arabinogalactan pr...    209   2e-61   Fragaria vesca subsp. vesca
gb|KDO70682.1|  hypothetical protein CISIN_1g019153mg                   205   9e-61   Citrus sinensis [apfelsine]
ref|XP_006430020.1|  hypothetical protein CICLE_v10011703mg             207   1e-60   Citrus clementina [clementine]
gb|KJB36232.1|  hypothetical protein B456_006G147500                    207   1e-60   Gossypium raimondii
ref|XP_006481636.1|  PREDICTED: fasciclin-like arabinogalactan pr...    207   2e-60   Citrus sinensis [apfelsine]
gb|KJB36230.1|  hypothetical protein B456_006G147500                    207   2e-60   Gossypium raimondii
gb|ABV27485.1|  fasciclin-like arabinogalactan protein 14               207   2e-60   Gossypium hirsutum [American cotton]
gb|KHG03559.1|  Fasciclin-like arabinogalactan protein 17               205   8e-60   Gossypium arboreum [tree cotton]
ref|XP_007204352.1|  hypothetical protein PRUPE_ppa005721mg             204   1e-59   
ref|XP_009130939.1|  PREDICTED: fasciclin-like arabinogalactan pr...    203   5e-59   
gb|KDP42957.1|  hypothetical protein JCGZ_23899                         203   5e-59   Jatropha curcas
emb|CDY55758.1|  BnaA03g55350D                                          203   7e-59   Brassica napus [oilseed rape]
ref|XP_008241098.1|  PREDICTED: fasciclin-like arabinogalactan pr...    203   9e-59   Prunus mume [ume]
emb|CDX81004.1|  BnaC03g02580D                                          203   9e-59   
ref|XP_011047143.1|  PREDICTED: fasciclin-like arabinogalactan pr...    202   1e-58   Populus euphratica
ref|XP_009362660.1|  PREDICTED: fasciclin-like arabinogalactan pr...    202   2e-58   Pyrus x bretschneideri [bai li]
ref|XP_002309262.1|  hypothetical protein POPTR_0006s21460g             202   2e-58   Populus trichocarpa [western balsam poplar]
emb|CDX98919.1|  BnaC09g49160D                                          201   3e-58   
ref|XP_007028043.1|  FASCICLIN-like arabinogalactan protein 17 pr...    201   3e-58   
ref|XP_011042549.1|  PREDICTED: fasciclin-like arabinogalactan pr...    201   5e-58   Populus euphratica
ref|XP_008387142.1|  PREDICTED: fasciclin-like arabinogalactan pr...    201   5e-58   Malus domestica [apple tree]
ref|XP_009388984.1|  PREDICTED: fasciclin-like arabinogalactan pr...    201   5e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002322769.2|  hypothetical protein POPTR_0016s06680g             201   6e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010248022.1|  PREDICTED: fasciclin-like arabinogalactan pr...    200   8e-58   Nelumbo nucifera [Indian lotus]
ref|XP_007010508.1|  FASCICLIN-like arabinogalactan protein 16 pr...    199   1e-57   
ref|XP_009348615.1|  PREDICTED: fasciclin-like arabinogalactan pr...    199   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_007163001.1|  hypothetical protein PHAVU_001G197900g             199   2e-57   Phaseolus vulgaris [French bean]
ref|XP_002882744.1|  beta-Ig-H3 domain-containing protein               199   3e-57   
ref|XP_008392004.1|  PREDICTED: fasciclin-like arabinogalactan pr...    198   3e-57   
ref|XP_010543842.1|  PREDICTED: fasciclin-like arabinogalactan pr...    199   3e-57   Tarenaya hassleriana [spider flower]
ref|XP_010491197.1|  PREDICTED: fasciclin-like arabinogalactan pr...    198   3e-57   Camelina sativa [gold-of-pleasure]
ref|XP_009122246.1|  PREDICTED: fasciclin-like arabinogalactan pr...    198   4e-57   Brassica rapa
ref|XP_010110455.1|  hypothetical protein L484_006448                   198   4e-57   Morus notabilis
ref|XP_010423345.1|  PREDICTED: fasciclin-like arabinogalactan pr...    198   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010452564.1|  PREDICTED: fasciclin-like arabinogalactan pr...    198   4e-57   Camelina sativa [gold-of-pleasure]
gb|AAF02137.1|AC009918_9  unknown protein                               198   4e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270321.1|  PREDICTED: fasciclin-like arabinogalactan pr...    198   4e-57   Vitis vinifera
emb|CDY57989.1|  BnaA10g30360D                                          197   6e-57   Brassica napus [oilseed rape]
ref|NP_566398.1|  FASCICLIN-like arabinogalactan protein 18 precu...    198   6e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297639.1|  hypothetical protein CARUB_v10013670mg             197   7e-57   Capsella rubella
ref|XP_006399110.1|  hypothetical protein EUTSA_v10013481mg             197   7e-57   
ref|XP_010058812.1|  PREDICTED: fasciclin-like arabinogalactan pr...    197   7e-57   Eucalyptus grandis [rose gum]
ref|XP_010263095.1|  PREDICTED: fasciclin-like arabinogalactan pr...    198   8e-57   Nelumbo nucifera [Indian lotus]
ref|XP_003521503.1|  PREDICTED: fasciclin-like arabinogalactan pr...    197   8e-57   Glycine max [soybeans]
ref|XP_009387789.1|  PREDICTED: fasciclin-like arabinogalactan pr...    197   9e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010464900.1|  PREDICTED: fasciclin-like arabinogalactan pr...    197   9e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010497995.1|  PREDICTED: fasciclin-like arabinogalactan pr...    197   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006399111.1|  hypothetical protein EUTSA_v10013481mg             197   1e-56   Eutrema salsugineum [saltwater cress]
gb|ABV27486.1|  fasciclin-like arabinogalactan protein 15               197   1e-56   Gossypium hirsutum [American cotton]
gb|KCW90412.1|  hypothetical protein EUGRSUZ_A02551                     197   1e-56   Eucalyptus grandis [rose gum]
ref|NP_196257.2|  fasciclin-like arabinogalactan protein 17 precu...    197   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009146690.1|  PREDICTED: fasciclin-like arabinogalactan pr...    197   1e-56   Brassica rapa
gb|KJB73327.1|  hypothetical protein B456_011G228300                    196   1e-56   Gossypium raimondii
ref|XP_009121226.1|  PREDICTED: fasciclin-like arabinogalactan pr...    197   1e-56   Brassica rapa
dbj|BAB08961.1|  unnamed protein product                                197   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315410.2|  hypothetical protein POPTR_0010s25110g             196   1e-56   
gb|KCW90413.1|  hypothetical protein EUGRSUZ_A02551                     196   2e-56   Eucalyptus grandis [rose gum]
gb|KHG10334.1|  Fasciclin-like arabinogalactan protein 17               196   2e-56   Gossypium arboreum [tree cotton]
ref|XP_008803482.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    196   2e-56   Phoenix dactylifera
ref|XP_010908912.1|  PREDICTED: fasciclin-like arabinogalactan pr...    195   3e-56   Elaeis guineensis
ref|XP_010045160.1|  PREDICTED: fasciclin-like arabinogalactan pr...    196   3e-56   Eucalyptus grandis [rose gum]
gb|KJB73326.1|  hypothetical protein B456_011G228300                    197   3e-56   Gossypium raimondii
ref|XP_006287712.1|  hypothetical protein CARUB_v10000921mg             196   3e-56   
ref|XP_004296276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    196   3e-56   Fragaria vesca subsp. vesca
ref|XP_010486838.1|  PREDICTED: fasciclin-like arabinogalactan pr...    196   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009399002.1|  PREDICTED: fasciclin-like arabinogalactan pr...    196   4e-56   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY32082.1|  BnaC04g44840D                                          195   5e-56   Brassica napus [oilseed rape]
emb|CDY01050.1|  BnaC05g41500D                                          195   6e-56   
ref|XP_010938934.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    195   8e-56   
emb|CDY40429.1|  BnaA04g20880D                                          194   9e-56   Brassica napus [oilseed rape]
emb|CDY08502.1|  BnaA05g27380D                                          194   1e-55   Brassica napus [oilseed rape]
ref|XP_010516833.1|  PREDICTED: fasciclin-like arabinogalactan pr...    191   1e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010553413.1|  PREDICTED: fasciclin-like arabinogalactan pr...    194   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_002871217.1|  beta-Ig-H3 domain-containing protein               194   2e-55   
ref|XP_010525828.1|  PREDICTED: fasciclin-like arabinogalactan pr...    194   2e-55   Tarenaya hassleriana [spider flower]
ref|XP_006348432.1|  PREDICTED: fasciclin-like arabinogalactan pr...    193   3e-55   Solanum tuberosum [potatoes]
ref|XP_004139069.1|  PREDICTED: fasciclin-like arabinogalactan pr...    193   4e-55   
ref|XP_006407421.1|  hypothetical protein EUTSA_v10020679mg             193   4e-55   Eutrema salsugineum [saltwater cress]
ref|XP_002879581.1|  predicted protein                                  192   5e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_009141525.1|  PREDICTED: fasciclin-like arabinogalactan pr...    192   6e-55   Brassica rapa
ref|XP_010516793.1|  PREDICTED: fasciclin-like arabinogalactan pr...    192   6e-55   Camelina sativa [gold-of-pleasure]
ref|XP_002270606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    192   6e-55   Vitis vinifera
ref|XP_009133050.1|  PREDICTED: fasciclin-like arabinogalactan pr...    192   6e-55   Brassica rapa
ref|NP_850253.1|  fasciclin-like arabinogalactan protein 16             192   6e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509549.1|  PREDICTED: fasciclin-like arabinogalactan pr...    192   7e-55   Camelina sativa [gold-of-pleasure]
ref|XP_006388929.1|  hypothetical protein POPTR_0073s00210g             190   7e-55   
gb|AAD21471.1|  unknown protein                                         192   7e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDX84594.1|  BnaA03g16360D                                          192   8e-55   
ref|XP_008450315.1|  PREDICTED: fasciclin-like arabinogalactan pr...    192   1e-54   Cucumis melo [Oriental melon]
ref|XP_011024125.1|  PREDICTED: fasciclin-like arabinogalactan pr...    192   1e-54   Populus euphratica
ref|XP_010505110.1|  PREDICTED: fasciclin-like arabinogalactan pr...    192   1e-54   Camelina sativa [gold-of-pleasure]
emb|CDX79631.1|  BnaC03g19670D                                          191   1e-54   
ref|XP_006379435.1|  hypothetical protein POPTR_0008s013101g            191   1e-54   
ref|XP_006379436.1|  hypothetical protein POPTR_0008s013101g            191   1e-54   
ref|XP_010534382.1|  PREDICTED: fasciclin-like arabinogalactan pr...    192   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_011032963.1|  PREDICTED: fasciclin-like arabinogalactan pr...    191   2e-54   Populus euphratica
ref|XP_006294220.1|  hypothetical protein CARUB_v10023217mg             191   2e-54   Capsella rubella
ref|XP_006410756.1|  hypothetical protein EUTSA_v10016656mg             191   3e-54   Eutrema salsugineum [saltwater cress]
ref|XP_008798695.1|  PREDICTED: fasciclin-like arabinogalactan pr...    191   3e-54   Phoenix dactylifera
gb|KHG00930.1|  Fasciclin-like arabinogalactan protein 17               190   4e-54   Gossypium arboreum [tree cotton]
ref|XP_010431275.1|  PREDICTED: fasciclin-like arabinogalactan pr...    184   6e-54   
gb|ABV27487.1|  fasciclin-like arabinogalactan protein 16               190   7e-54   Gossypium hirsutum [American cotton]
tpg|DAA51812.1|  TPA: hypothetical protein ZEAMMB73_870378              187   7e-54   
gb|KFK36481.1|  hypothetical protein AALP_AA4G130300                    189   8e-54   Arabis alpina [alpine rockcress]
gb|KJB78512.1|  hypothetical protein B456_013G003200                    189   8e-54   Gossypium raimondii
gb|KDP36078.1|  hypothetical protein JCGZ_08722                         189   1e-53   Jatropha curcas
gb|ABI95409.1|  fasciclin-like protein FLA19                            189   1e-53   Triticum aestivum [Canadian hard winter wheat]
emb|CDY23209.1|  BnaA04g05500D                                          188   2e-53   Brassica napus [oilseed rape]
ref|XP_010685475.1|  PREDICTED: fasciclin-like arabinogalactan pr...    187   3e-53   
emb|CDX95333.1|  BnaC04g28250D                                          187   3e-53   
ref|XP_009139464.1|  PREDICTED: fasciclin-like arabinogalactan pr...    187   4e-53   Brassica rapa
ref|XP_010685474.1|  PREDICTED: fasciclin-like arabinogalactan pr...    188   4e-53   
ref|XP_006403811.1|  hypothetical protein EUTSA_v10010381mg             187   7e-53   Eutrema salsugineum [saltwater cress]
gb|KEH24284.1|  fasciclin-like arabinogalactan protein 16 precursor     186   1e-52   Medicago truncatula
ref|NP_001130335.1|  uncharacterized protein LOC100191430 precursor     186   1e-52   Zea mays [maize]
tpg|DAA51813.1|  TPA: LOW QUALITY PROTEIN: fasciclin domain protein     186   1e-52   
ref|XP_002524094.1|  conserved hypothetical protein                     186   2e-52   Ricinus communis
ref|XP_004228680.1|  PREDICTED: fasciclin-like arabinogalactan pr...    185   2e-52   Solanum lycopersicum
ref|XP_010515698.1|  PREDICTED: fasciclin-like arabinogalactan pr...    185   3e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010426853.1|  PREDICTED: fasciclin-like arabinogalactan pr...    185   3e-52   Camelina sativa [gold-of-pleasure]
gb|ACG39696.1|  fasciclin domain                                        186   3e-52   Zea mays [maize]
ref|XP_010503981.1|  PREDICTED: fasciclin-like arabinogalactan pr...    184   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_004981498.1|  PREDICTED: fasciclin-like arabinogalactan pr...    185   6e-52   Setaria italica
ref|NP_190805.1|  fasciclin-like arabinogalactan protein 15             184   6e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876139.1|  beta-Ig-H3 domain-containing protein               184   7e-52   
ref|XP_006291159.1|  hypothetical protein CARUB_v10017276mg             184   9e-52   Capsella rubella
ref|NP_001159324.1|  uncharacterized protein LOC100304417 precursor     184   1e-51   Zea mays [maize]
ref|XP_004167872.1|  PREDICTED: fasciclin-like arabinogalactan pr...    184   1e-51   
gb|ABI95416.1|  fasciclin-like protein FLA26                            182   7e-51   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001051504.1|  Os03g0788600                                       182   7e-51   
gb|ABI95417.1|  fasciclin-like protein FLA27                            182   9e-51   Triticum aestivum [Canadian hard winter wheat]
gb|KFK34484.1|  hypothetical protein AALP_AA5G151600                    181   9e-51   Arabis alpina [alpine rockcress]
ref|XP_002463768.1|  hypothetical protein SORBIDRAFT_01g005770          181   2e-50   Sorghum bicolor [broomcorn]
ref|XP_008442961.1|  PREDICTED: fasciclin-like arabinogalactan pr...    180   3e-50   Cucumis melo [Oriental melon]
ref|XP_004136532.1|  PREDICTED: fasciclin-like arabinogalactan pr...    180   3e-50   Cucumis sativus [cucumbers]
ref|XP_004494272.1|  PREDICTED: fasciclin-like arabinogalactan pr...    179   4e-50   
ref|XP_004494271.1|  PREDICTED: fasciclin-like arabinogalactan pr...    179   6e-50   
gb|KDO48671.1|  hypothetical protein CISIN_1g013434mg                   179   7e-50   Citrus sinensis [apfelsine]
gb|ABI95415.1|  fasciclin-like protein FLA25                            179   7e-50   Triticum aestivum [Canadian hard winter wheat]
gb|KEH29726.1|  fasciclin-like arabinogalactan protein 16 precursor     179   8e-50   Medicago truncatula
ref|XP_003554480.1|  PREDICTED: fasciclin-like arabinogalactan pr...    179   1e-49   Glycine max [soybeans]
ref|XP_006445815.1|  hypothetical protein CICLE_v10015097mg             179   1e-49   Citrus clementina [clementine]
ref|XP_003559349.1|  PREDICTED: fasciclin-like arabinogalactan pr...    179   1e-49   Brachypodium distachyon [annual false brome]
gb|ABK25415.1|  unknown                                                 177   5e-49   Picea sitchensis
ref|XP_002515862.1|  conserved hypothetical protein                     177   6e-49   Ricinus communis
ref|XP_006826417.1|  hypothetical protein AMTR_s00004p00159330          176   1e-48   Amborella trichopoda
dbj|BAJ97817.1|  predicted protein                                      176   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS68119.1|  hypothetical protein M569_06649                         173   2e-48   Genlisea aurea
ref|XP_004487436.1|  PREDICTED: fasciclin-like arabinogalactan pr...    175   3e-48   Cicer arietinum [garbanzo]
gb|KDO48944.1|  hypothetical protein CISIN_1g043668mg                   174   3e-48   Citrus sinensis [apfelsine]
ref|XP_004506247.1|  PREDICTED: fasciclin-like arabinogalactan pr...    174   3e-48   
gb|EAZ38767.1|  hypothetical protein OsJ_23169                          174   4e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010557991.1|  PREDICTED: fasciclin-like arabinogalactan pr...    174   4e-48   Tarenaya hassleriana [spider flower]
ref|NP_001058941.1|  Os07g0160600                                       174   6e-48   
dbj|BAJ98684.1|  predicted protein                                      174   7e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006424052.1|  hypothetical protein CICLE_v10030024mg             173   8e-48   
dbj|BAE71191.1|  hypothetical protein                                   173   9e-48   Trifolium pratense [peavine clover]
gb|EEC81554.1|  hypothetical protein OsI_24980                          174   1e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_003557575.1|  PREDICTED: fasciclin-like arabinogalactan pr...    172   3e-47   Brachypodium distachyon [annual false brome]
ref|XP_011076879.1|  PREDICTED: fasciclin-like arabinogalactan pr...    172   4e-47   Sesamum indicum [beniseed]
gb|EMT22481.1|  hypothetical protein F775_14603                         166   1e-46   
ref|XP_007132513.1|  hypothetical protein PHAVU_011G100600g             167   1e-45   Phaseolus vulgaris [French bean]
ref|XP_003540278.1|  PREDICTED: fasciclin-like arabinogalactan pr...    167   3e-45   Glycine max [soybeans]
ref|XP_006487826.1|  PREDICTED: fasciclin-like arabinogalactan pr...    165   1e-44   Citrus sinensis [apfelsine]
ref|XP_004955500.1|  PREDICTED: fasciclin-like arabinogalactan pr...    165   2e-44   Setaria italica
ref|XP_010677585.1|  PREDICTED: fasciclin-like arabinogalactan pr...    164   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003527510.1|  PREDICTED: fasciclin-like arabinogalactan pr...    164   3e-44   Glycine max [soybeans]
gb|EYU19863.1|  hypothetical protein MIMGU_mgv1a006599mg                163   4e-44   Erythranthe guttata [common monkey flower]
ref|XP_010917919.1|  PREDICTED: fasciclin-like arabinogalactan pr...    165   5e-44   Elaeis guineensis
ref|XP_006651891.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    164   5e-44   
gb|KHN36515.1|  Fasciclin-like arabinogalactan protein 16               161   7e-44   Glycine soja [wild soybean]
ref|XP_003596932.1|  Fasciclin-like arabinogalactan protein             162   1e-43   Medicago truncatula
ref|XP_003543398.1|  PREDICTED: fasciclin-like arabinogalactan pr...    160   6e-43   Glycine max [soybeans]
ref|XP_008790162.1|  PREDICTED: fasciclin-like arabinogalactan pr...    161   1e-42   Phoenix dactylifera
ref|XP_006651890.1|  PREDICTED: fasciclin-like arabinogalactan pr...    158   3e-42   Oryza brachyantha
ref|XP_007150000.1|  hypothetical protein PHAVU_005G117500g             154   1e-40   Phaseolus vulgaris [French bean]
ref|XP_004154697.1|  PREDICTED: fasciclin-like arabinogalactan pr...    149   3e-39   
gb|AAT75258.1|  expressed protein                                       150   3e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010090522.1|  hypothetical protein L484_017146                   150   3e-39   
ref|XP_006592365.1|  PREDICTED: fasciclin-like arabinogalactan pr...    150   3e-39   Glycine max [soybeans]
ref|NP_001051505.1|  Os03g0788700                                       150   4e-39   
gb|EAY92117.1|  hypothetical protein OsI_13824                          150   7e-39   Oryza sativa Indica Group [Indian rice]
gb|AAO24903.1|  putative arabinogalactan-protein                        150   7e-39   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002461483.1|  hypothetical protein SORBIDRAFT_02g003410          149   2e-38   Sorghum bicolor [broomcorn]
ref|XP_006658293.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   5e-38   
gb|KHN41248.1|  Fasciclin-like arabinogalactan protein 16               136   2e-35   Glycine soja [wild soybean]
gb|KHN21208.1|  Fasciclin-like arabinogalactan protein 18               127   5e-32   Glycine soja [wild soybean]
ref|XP_002992031.1|  hypothetical protein SELMODRAFT_23020              119   2e-28   
ref|XP_002964493.1|  hypothetical protein SELMODRAFT_64323              117   2e-27   
gb|KHN43596.1|  Fasciclin-like arabinogalactan protein 15               116   2e-27   Glycine soja [wild soybean]
gb|EMT06107.1|  Fasciclin-like arabinogalactan protein 16               108   3e-25   
gb|AEW07983.1|  hypothetical protein 0_16121_01                         103   5e-24   Pinus radiata
gb|AFG49337.1|  hypothetical protein 0_16121_01                         103   6e-24   Pinus taeda
gb|AFG49328.1|  hypothetical protein 0_16121_01                         103   6e-24   Pinus taeda
ref|XP_002990854.1|  hypothetical protein SELMODRAFT_44414              106   1e-23   
ref|XP_002974338.1|  hypothetical protein SELMODRAFT_54466              106   1e-23   
gb|AFG49330.1|  hypothetical protein 0_16121_01                         100   5e-23   Pinus taeda
ref|XP_001766851.1|  predicted protein                                94.7    2e-19   
ref|XP_001784356.1|  predicted protein                                92.8    1e-18   
ref|XP_006388223.1|  hypothetical protein POPTR_0276s00200g           77.0    1e-13   
ref|WP_027101725.1|  fasciclin                                        73.9    7e-13   
ref|WP_039118704.1|  fasciclin                                        71.2    5e-12   Flavobacterium sp. JRM
ref|WP_039115355.1|  fasciclin                                        71.2    5e-12   Flavobacterium
ref|WP_035621627.1|  fasciclin                                        68.2    6e-11   Flavobacterium hydatis
ref|WP_025139515.1|  fasciclin                                        67.8    8e-11   Achromobacter sp. DH1f
ref|WP_035173683.1|  hypothetical protein                             67.4    1e-10   
ref|WP_042566888.1|  fasciclin                                        66.6    2e-10   Flavobacterium sp. MEB061
ref|WP_035643556.1|  fasciclin                                        66.6    2e-10   Flavobacterium sp. Fl
ref|WP_035625480.1|  fasciclin                                        66.2    3e-10   Flavobacterium
ref|WP_035688618.1|  fasciclin                                        65.9    3e-10   Flavobacterium
gb|AEG94766.1|  Conserved hypothetical protein                        65.9    4e-10   Ramlibacter tataouinensis TTB310
ref|WP_041676596.1|  fasciclin                                        65.1    6e-10   
ref|WP_040326723.1|  beta-Ig-H3/fasciclin                             65.1    7e-10   
ref|WP_031527389.1|  fasciclin                                        66.6    8e-10   Dyadobacter crusticola
ref|WP_035694679.1|  beta-Ig-H3/fasciclin                             64.7    8e-10   
gb|EAS49051.1|  conserved hypothetical protein                        64.7    9e-10   Aurantimonas manganoxydans SI85-9A1
ref|WP_013930336.1|  fasciclin                                        66.2    1e-09   
ref|WP_011470727.1|  fasciclin                                        64.3    1e-09   Rhodopseudomonas palustris
ref|WP_026985001.1|  fasciclin                                        63.9    2e-09   Flavobacterium sp. URHB0058
ref|WP_039348353.1|  hypothetical protein                             63.9    2e-09   Chryseobacterium jeonii
ref|WP_006383916.1|  fasciclin                                        63.5    2e-09   Achromobacter
emb|CCH55845.1|  beta-Ig-H3/fasciclin                                 63.2    3e-09   Fibrisoma limi BUZ 3
ref|WP_006390658.1|  fasciclin                                        63.2    3e-09   Achromobacter
ref|WP_008187750.1|  fasciclin                                        63.2    3e-09   Rhodobacteraceae bacterium HTCC2150
ref|WP_021005218.1|  fascilin domain-containing protein               63.2    3e-09   
ref|WP_040006463.1|  fasciclin                                        63.2    3e-09   Fibrisoma limi
ref|WP_013930695.1|  fasciclin                                        63.2    3e-09   
ref|WP_009034009.1|  fasciclin                                        63.2    4e-09   Indibacter alkaliphilus
ref|WP_031455382.1|  fasciclin                                        62.8    4e-09   Flavobacterium chungangense
ref|WP_026993752.1|  fasciclin                                        64.3    6e-09   Flectobacillus major
ref|WP_044397596.1|  hypothetical protein                             62.4    6e-09   Lacinutrix sp. Hel_I_90
gb|ETZ19558.1|  fasciclin                                             62.0    9e-09   Pedobacter sp. V48
ref|WP_035128417.1|  beta-Ig-H3/fasciclin                             61.6    9e-09   
ref|WP_026628687.1|  fasciclin                                        61.2    2e-08   Dyadobacter alkalitolerans
ref|WP_020926856.1|  Transforming growth factor-beta induced prot...  60.8    2e-08   Achromobacter xylosoxidans
ref|WP_026383804.1|  fasciclin                                        60.8    2e-08   Achromobacter xylosoxidans
ref|WP_029270485.1|  fasciclin                                        60.8    2e-08   Flavobacterium sp. KJJ
ref|WP_039108199.1|  fasciclin                                        60.8    2e-08   Flavobacterium sp. AED
ref|WP_008237596.1|  fasciclin                                        60.8    2e-08   Pedobacter sp. BAL39
ref|WP_008198277.1|  fasciclin                                        60.8    2e-08   
ref|WP_013581063.1|  fasciclin                                        60.8    2e-08   Granulicella tundricola
ref|WP_008468907.1|  fasciclin                                        60.5    3e-08   Flavobacterium sp. F52
ref|WP_041693709.1|  fasciclin                                        62.4    3e-08   
ref|WP_027377970.1|  fasciclin                                        60.5    3e-08   Chryseobacterium palustre
ref|WP_041518150.1|  fasciclin                                        60.5    3e-08   Flavobacterium hibernum
gb|AFK01534.1|  beta-Ig-H3/fasciclin                                  62.4    3e-08   Emticicia oligotrophica DSM 17448
ref|WP_010685739.1|  beta-Ig-H3/fasciclin                             60.5    3e-08   Methylobacterium mesophilicum
ref|WP_037104727.1|  fasciclin                                        60.1    4e-08   Rhizobium sp. OK665
ref|WP_025143993.1|  fasciclin                                        60.1    4e-08   Pedobacter jeongneungensis
ref|WP_026710745.1|  hypothetical protein                             60.1    5e-08   Flavobacterium filum
ref|WP_031530692.1|  fasciclin                                        59.7    5e-08   Dyadobacter crusticola
ref|WP_026715494.1|  fasciclin                                        59.7    5e-08   Flavobacterium daejeonense
gb|KDV22874.1|  fasciclin                                             60.1    5e-08   
ref|WP_035672201.1|  fasciclin                                        59.7    5e-08   Flavobacterium sp. 83
ref|WP_028283821.1|  beta-Ig-H3/fasciclin                             60.1    5e-08   Olleya marilimosa
ref|WP_041879641.1|  fasciclin                                        59.7    6e-08   Pedobacter lusitanus
ref|WP_019596591.1|  fasciclin                                        59.7    6e-08   Rhodonellum
ref|WP_026897046.1|  fasciclin                                        59.7    6e-08   Pedobacter oryzae
ref|WP_015190134.1|  beta-Ig-H3/fasciclin                             60.1    6e-08   Gloeocapsa sp. PCC 7428
ref|WP_036351167.1|  fasciclin                                        59.7    6e-08   
ref|WP_041372747.1|  MULTISPECIES: beta-Ig-H3/fasciclin               59.3    6e-08   
ref|WP_034673367.1|  fasciclin                                        59.7    6e-08   Chryseobacterium formosense
ref|WP_042309351.1|  fasciclin                                        59.3    6e-08   Burkholderiaceae
ref|WP_020600171.1|  fasciclin                                        59.3    7e-08   Spirosoma panaciterrae
ref|WP_019945789.1|  fasciclin                                        61.2    7e-08   
ref|WP_038115278.1|  fasciclin                                        59.3    7e-08   
ref|WP_026956116.1|  fasciclin                                        59.3    7e-08   
ref|WP_026728753.1|  fasciclin                                        59.3    7e-08   
ref|WP_036264257.1|  fasciclin                                        59.3    7e-08   
gb|KFG69234.1|  fasciclin                                             59.3    7e-08   
ref|WP_010918302.1|  hypothetical protein                             59.3    7e-08   
ref|WP_017498603.1|  fasciclin                                        59.3    7e-08   
ref|WP_024284255.1|  fasciclin                                        59.3    9e-08   
ref|WP_034925308.1|  beta-Ig-H3/fasciclin                             59.3    9e-08   
ref|WP_040880130.1|  fasciclin                                        58.9    9e-08   
ref|WP_021078852.1|  antibiotic transport system ATP-binding protein  58.9    9e-08   
ref|WP_024831186.1|  beta-Ig-H3/fasciclin                             58.9    1e-07   
gb|EIJ40476.1|  secreted/surface protein with fasciclin-like repeats  58.9    1e-07   
ref|WP_026838640.1|  beta-Ig-H3/fasciclin                             59.3    1e-07   
ref|WP_034465580.1|  hypothetical protein                             58.9    1e-07   
ref|WP_015131806.1|  beta-Ig-H3/fasciclin                             60.5    1e-07   
ref|WP_029584032.1|  beta-Ig-H3/fasciclin                             58.9    1e-07   
gb|EFF73810.1|  fasciclin domain protein                              58.9    1e-07   
ref|WP_036005845.1|  hypothetical protein                             58.9    1e-07   
ref|WP_043007360.1|  fasciclin                                        58.9    1e-07   
ref|WP_041567297.1|  beta-Ig-H3/fasciclin                             58.5    1e-07   
ref|WP_020096572.1|  MULTISPECIES: fasciclin                          58.9    1e-07   
ref|WP_039883479.1|  fasciclin                                        58.5    1e-07   
ref|WP_014218319.1|  fasciclin                                        58.5    1e-07   
ref|WP_027561813.1|  MULTISPECIES: beta-Ig-H3/fasciclin               58.5    1e-07   
ref|WP_026950580.1|  fasciclin                                        58.5    1e-07   
gb|AGC75625.1|  fasciclin domain containing surface protein           58.9    1e-07   
ref|WP_043759390.1|  beta-Ig-H3/fasciclin                             58.5    1e-07   
ref|WP_012591858.1|  fasciclin                                        58.5    1e-07   
ref|WP_025425745.1|  fasciclin                                        58.2    2e-07   
ref|XP_004602914.1|  PREDICTED: stabilin-2                            60.8    2e-07   
gb|KIX17067.1|  fasciclin                                             58.2    2e-07   
ref|WP_042674188.1|  fasciclin                                        57.8    2e-07   
ref|WP_023571179.1|  beta-Ig-H3/fasciclin                             58.2    2e-07   
ref|WP_012024826.1|  fasciclin                                        58.2    2e-07   
gb|EJL69903.1|  secreted/surface protein with fasciclin-like repeats  58.2    2e-07   
ref|WP_042673475.1|  beta-Ig-H3/fasciclin                             58.2    2e-07   
ref|WP_035126807.1|  hypothetical protein                             58.2    2e-07   
gb|AIQ91525.1|  Beta-Ig-H3/fasciclin                                  58.2    2e-07   
gb|KIQ27477.1|  fasciclin                                             58.2    2e-07   
ref|WP_029357694.1|  beta-Ig-H3/fasciclin                             58.2    2e-07   
ref|WP_011923583.1|  fasciclin                                        58.2    2e-07   
ref|WP_009030532.1|  fasciclin                                        58.2    2e-07   
ref|WP_042580996.1|  fasciclin                                        57.8    2e-07   
ref|WP_017744011.1|  hypothetical protein                             58.5    2e-07   
ref|WP_039471303.1|  fasciclin                                        58.2    2e-07   
ref|XP_002448333.1|  hypothetical protein SORBIDRAFT_06g025350        59.3    2e-07   
ref|WP_025111142.1|  fasciclin                                        58.2    2e-07   
ref|WP_007588401.1|  MULTISPECIES: fasciclin                          57.8    2e-07   
ref|WP_043350407.1|  MULTISPECIES: beta-Ig-H3/fasciclin               58.2    2e-07   
ref|WP_023739771.1|  MULTISPECIES: fasciclin                          58.2    2e-07   
ref|WP_043758657.1|  beta-Ig-H3/fasciclin                             57.8    2e-07   
ref|WP_008138011.1|  fasciclin                                        57.8    2e-07   
ref|WP_008961328.1|  fasciclin                                        57.8    3e-07   
ref|WP_013538934.1|  fasciclin                                        57.8    3e-07   
ref|WP_031499208.1|  fasciclin                                        57.8    3e-07   
ref|WP_006612278.1|  fasciclin                                        57.8    3e-07   
ref|WP_029081266.1|  beta-Ig-H3/fasciclin                             57.8    3e-07   
ref|WP_026709245.1|  fasciclin                                        57.8    3e-07   
ref|WP_007738484.1|  fasciclin                                        57.8    3e-07   
ref|WP_027523490.1|  beta-Ig-H3/fasciclin                             57.8    3e-07   
ref|WP_016991182.1|  fasciclin                                        57.8    3e-07   
ref|WP_026442250.1|  fasciclin                                        57.8    3e-07   
ref|WP_023805797.1|  MULTISPECIES: fasciclin                          57.8    3e-07   
ref|WP_024538317.1|  fasciclin                                        57.8    3e-07   
ref|WP_013500252.1|  fasciclin                                        57.8    3e-07   
ref|WP_042704849.1|  fasciclin                                        57.4    3e-07   
ref|WP_026726724.1|  hypothetical protein                             57.8    3e-07   
ref|WP_034368521.1|  fasciclin                                        57.4    4e-07   
ref|WP_023748265.1|  fasciclin                                        57.4    4e-07   
ref|WP_026716400.1|  hypothetical protein                             57.4    4e-07   
ref|WP_027555377.1|  beta-Ig-H3/fasciclin                             57.4    4e-07   
ref|WP_026946237.1|  fasciclin                                        57.4    4e-07   
ref|WP_038332799.1|  hypothetical protein                             57.4    4e-07   
ref|WP_038478625.1|  fasciclin                                        57.4    4e-07   
ref|WP_027539443.1|  beta-Ig-H3/fasciclin                             57.4    4e-07   
ref|WP_012040682.1|  fasciclin                                        57.4    4e-07   
ref|WP_042480857.1|  fasciclin                                        57.0    4e-07   
ref|WP_027303073.1|  fasciclin                                        57.0    4e-07   
ref|WP_015663511.1|  Fas1 domain-containing protein                   57.0    4e-07   
ref|WP_010414955.1|  fasciclin                                        57.4    5e-07   
ref|WP_017671289.1|  hypothetical protein                             57.4    5e-07   
ref|WP_012455751.1|  fasciclin                                        57.0    5e-07   
ref|WP_010227235.1|  beta-Ig-H3/fasciclin                             57.4    5e-07   
ref|WP_016964374.1|  fasciclin                                        57.0    5e-07   
ref|WP_034716273.1|  hypothetical protein                             57.0    5e-07   
ref|WP_014265684.1|  fasciclin                                        57.0    5e-07   
gb|AFD06483.1|  secreted/surface protein with fasciclin-like repeats  57.0    6e-07   
ref|WP_038596903.1|  beta-Ig-H3/fasciclin                             57.0    6e-07   
ref|WP_014490676.1|  fasciclin                                        57.0    6e-07   
ref|WP_028340862.1|  beta-Ig-H3/fasciclin                             57.0    6e-07   
ref|WP_014388155.1|  fasciclin                                        57.0    6e-07   
ref|WP_039000770.1|  fasciclin                                        56.6    6e-07   
ref|WP_026966716.1|  fasciclin                                        56.6    6e-07   
ref|WP_016840267.1|  fasciclin                                        57.0    6e-07   
ref|WP_035324863.1|  beta-Ig-H3/fasciclin                             57.0    6e-07   
ref|WP_043616880.1|  fasciclin                                        56.6    6e-07   
ref|WP_034797313.1|  fasciclin                                        56.6    7e-07   
ref|WP_028337885.1|  beta-Ig-H3/fasciclin                             56.6    7e-07   
ref|WP_021076096.1|  formate dehydrogenase, beta subunit              56.6    7e-07   
ref|WP_035336806.1|  beta-Ig-H3/fasciclin                             57.0    7e-07   
ref|WP_028348444.1|  beta-Ig-H3/fasciclin                             56.6    7e-07   
ref|WP_044586735.1|  beta-Ig-H3/fasciclin                             56.6    7e-07   
ref|WP_017013877.1|  hypothetical protein                             56.2    7e-07   
ref|WP_025291225.1|  hypothetical protein                             56.6    8e-07   
ref|WP_013928607.1|  beta-Ig-H3/fasciclin                             56.2    8e-07   
ref|WP_011796324.1|  fasciclin                                        56.6    8e-07   
dbj|GAN50934.1|  secreted/surface protein with fasciclin-like rep...  58.5    8e-07   
ref|WP_027543908.1|  beta-Ig-H3/fasciclin                             56.6    8e-07   
ref|WP_008920493.1|  fasciclin                                        56.6    8e-07   
ref|WP_002714019.1|  fasciclin                                        56.6    8e-07   
ref|WP_036776687.1|  hypothetical protein                             55.8    8e-07   
ref|WP_008248366.1|  fasciclin                                        56.6    8e-07   
ref|WP_029414780.1|  beta-Ig-H3/fasciclin                             56.6    9e-07   
ref|WP_034513878.1|  fasciclin                                        56.2    9e-07   
ref|WP_017009653.1|  hypothetical protein                             56.2    9e-07   
ref|WP_027566357.1|  beta-Ig-H3/fasciclin                             56.2    9e-07   
gb|AEV35191.1|  Beta-Ig-H3/Fasciclin                                  55.8    9e-07   
emb|CCP13376.1|  Fasciclin-like arabinogalactan protein 17 Flags:...  56.2    9e-07   
ref|WP_042246101.1|  fasciclin                                        56.2    9e-07   
ref|WP_036805312.1|  fasciclin                                        56.2    1e-06   
ref|WP_018459783.1|  fasciclin                                        56.2    1e-06   
ref|WP_028250229.1|  fasciclin                                        56.2    1e-06   
ref|WP_033425847.1|  fasciclin                                        56.2    1e-06   
ref|WP_018645154.1|  fasciclin                                        56.2    1e-06   
ref|WP_017257820.1|  fasciclin                                        56.2    1e-06   
ref|WP_034740201.1|  hypothetical protein                             56.2    1e-06   
ref|WP_007139091.1|  fasciclin                                        56.2    1e-06   
ref|WP_041767895.1|  fasciclin                                        55.8    1e-06   
gb|EED38261.1|  beta-Ig-H3/fasciclin                                  55.8    1e-06   
ref|WP_038387235.1|  beta-Ig-H3/fasciclin                             56.2    1e-06   
ref|WP_019703147.1|  MULTISPECIES: fasciclin                          56.2    1e-06   
ref|WP_035665701.1|  beta-Ig-H3/fasciclin                             55.5    1e-06   
ref|WP_020602151.1|  fasciclin                                        55.8    1e-06   
ref|WP_027573033.1|  beta-Ig-H3/fasciclin                             55.8    1e-06   
ref|WP_008548399.1|  fasciclin                                        55.5    1e-06   
ref|WP_011083338.1|  MULTISPECIES: fasciclin                          55.8    1e-06   
ref|WP_007094499.1|  beta-Ig-H3/fasciclin                             55.8    1e-06   
ref|WP_044513127.1|  fasciclin                                        56.2    1e-06   
ref|WP_040597663.1|  fasciclin                                        55.8    1e-06   
ref|WP_040490073.1|  beta-Ig-H3/fasciclin                             55.8    1e-06   
ref|WP_044540752.1|  beta-Ig-H3/fasciclin                             55.8    1e-06   
ref|WP_028174909.1|  MULTISPECIES: beta-Ig-H3/fasciclin               55.8    1e-06   
ref|WP_016875514.1|  hypothetical protein                             57.4    1e-06   
ref|WP_038018294.1|  hypothetical protein                             55.8    1e-06   
ref|WP_006367816.1|  fasciclin                                        55.8    1e-06   
gb|EAU42073.1|  hypothetical protein FP2506_16609                     55.8    1e-06   
ref|WP_025539426.1|  fasciclin                                        55.8    1e-06   
ref|WP_022671610.1|  hypothetical protein                             55.8    1e-06   
ref|WP_026978717.1|  hypothetical protein                             55.8    1e-06   
ref|WP_019042465.1|  fasciclin                                        55.8    1e-06   
ref|WP_027514955.1|  beta-Ig-H3/fasciclin                             55.8    1e-06   
ref|WP_022689965.1|  fasciclin                                        55.8    1e-06   
ref|WP_014786931.1|  fasciclin                                        55.8    1e-06   
ref|WP_041233004.1|  fasciclin                                        56.2    1e-06   
ref|WP_012373934.1|  beta-Ig-H3/fasciclin                             55.5    1e-06   
ref|WP_040007043.1|  fasciclin                                        55.8    1e-06   
ref|WP_017651361.1|  hypothetical protein                             55.8    2e-06   
ref|WP_026226840.1|  fasciclin                                        55.5    2e-06   
ref|WP_013751279.1|  beta-Ig-H3/fasciclin                             55.5    2e-06   
ref|WP_036144533.1|  hypothetical protein                             55.8    2e-06   
ref|WP_034491272.1|  hypothetical protein                             55.5    2e-06   
ref|WP_008330494.1|  fasciclin                                        55.1    2e-06   
gb|AIU25491.1|  fasciclin                                             55.8    2e-06   
ref|WP_028139268.1|  MULTISPECIES: beta-Ig-H3/fasciclin               55.5    2e-06   
ref|WP_044130025.1|  fasciclin                                        55.5    2e-06   
ref|WP_034103771.1|  fasciclin                                        55.5    2e-06   
ref|WP_043007833.1|  fasciclin                                        55.5    2e-06   
ref|WP_036831357.1|  hypothetical protein                             55.1    2e-06   
ref|WP_026440088.1|  fasciclin                                        55.5    2e-06   
ref|WP_022825536.1|  fasciclin                                        55.5    2e-06   
ref|WP_007604237.1|  fasciclin                                        55.5    2e-06   
gb|EMP56265.1|  hypothetical protein MSNKSG1_10338                    55.1    2e-06   
ref|WP_044416575.1|  beta-Ig-H3/fasciclin                             55.5    2e-06   
gb|AFZ23758.1|  secreted/surface protein with fasciclin-like repeats  55.8    2e-06   
ref|WP_028657995.1|  fasciclin                                        55.1    2e-06   
ref|WP_014247808.1|  fasciclin                                        55.5    2e-06   
ref|WP_026769975.1|  MULTISPECIES: fasciclin                          55.5    2e-06   
ref|WP_030002864.1|  fasciclin                                        55.5    2e-06   
ref|WP_015111548.1|  beta-Ig-H3/fasciclin                             56.6    2e-06   
ref|WP_014438964.1|  fasciclin                                        55.5    2e-06   
ref|WP_011155790.1|  fasciclin                                        55.5    2e-06   
ref|WP_037011531.1|  fasciclin                                        55.5    2e-06   
ref|WP_034359569.1|  fasciclin                                        55.5    2e-06   
ref|WP_022691622.1|  fasciclin                                        55.5    2e-06   
ref|WP_039346019.1|  fasciclin                                        55.5    2e-06   
ref|WP_029941155.1|  fasciclin                                        55.1    2e-06   
ref|WP_024515101.1|  beta-Ig-H3/fasciclin                             55.1    2e-06   
ref|WP_015228573.1|  secreted/surface protein with fasciclin-like...  55.5    2e-06   
ref|WP_011661929.1|  fasciclin                                        55.5    2e-06   
ref|WP_007714953.1|  fasciclin                                        55.1    2e-06   
ref|WP_035703008.1|  beta-Ig-H3/fasciclin                             55.1    3e-06   
ref|WP_007598785.1|  fasciclin                                        55.1    3e-06   
ref|WP_023576931.1|  hypothetical protein                             55.1    3e-06   
ref|WP_024956821.1|  fasciclin                                        55.1    3e-06   
ref|WP_025539468.1|  fasciclin                                        55.1    3e-06   
ref|WP_025765268.1|  fasciclin                                        55.1    3e-06   
ref|WP_003605765.1|  fasciclin                                        55.1    3e-06   
ref|WP_040886753.1|  beta-Ig-H3/fasciclin                             55.1    3e-06   
ref|WP_042442676.1|  fasciclin                                        55.1    3e-06   
ref|WP_023777813.1|  fasciclin                                        55.1    3e-06   
ref|WP_012493991.1|  fasciclin                                        55.1    3e-06   
ref|WP_029061866.1|  fasciclin                                        54.7    3e-06   
ref|WP_007682576.1|  fasciclin                                        55.1    3e-06   
ref|WP_017477100.1|  fasciclin                                        55.1    3e-06   
gb|ETZ21999.1|  fasciclin                                             54.7    3e-06   
ref|WP_042112409.1|  fasciclin                                        55.1    3e-06   
ref|WP_018318924.1|  fasciclin                                        54.7    3e-06   
ref|WP_012254846.1|  fasciclin                                        55.1    3e-06   
ref|WP_011318706.1|  beta-Ig-H3/fasciclin                             55.8    3e-06   
ref|WP_032958323.1|  fasciclin                                        54.7    3e-06   
dbj|BAI71839.1|  hypothetical protein AZL_012010                      55.1    3e-06   
gb|AGO88348.1|  Beta-Ig-H3/fasciclin repeat containing protein        54.7    3e-06   
ref|WP_013891875.1|  fasciclin                                        54.7    3e-06   
ref|WP_013188115.1|  fasciclin                                        55.1    3e-06   
ref|WP_006023458.1|  hypothetical protein                             55.1    3e-06   
ref|WP_040426863.1|  beta-Ig-H3/fasciclin                             55.1    3e-06   
ref|WP_024921149.1|  MULTISPECIES: beta-Ig-H3/fasciclin               55.1    4e-06   
emb|CCH14266.1|  Secreted and surface protein containing fascicli...  54.3    4e-06   
ref|WP_036767099.1|  hypothetical protein                             53.9    4e-06   



>ref|XP_011094205.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Sesamum 
indicum]
Length=465

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 150/192 (78%), Gaps = 4/192 (2%)
 Frame = +3

Query  57   MDAQIFGlskllcfsvfllvfglvggaalHENPSRNLSSGAQINSNSVLVALLDSHYTEL  236
            MD+QI+G+  LL F++F  +  +         P++  SSG QINSNSVLVALLDSHYTEL
Sbjct  1    MDSQIYGVPNLLYFTLFTFLVLVTSALPESNTPAKPSSSGTQINSNSVLVALLDSHYTEL  60

Query  237  SELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLLFH  416
            SELVEKALLLQTLEEAVS HNITIFAPRNEALERDLDPEFKRFLL+PGNLRSLQNLLLFH
Sbjct  61   SELVEKALLLQTLEEAVSTHNITIFAPRNEALERDLDPEFKRFLLEPGNLRSLQNLLLFH  120

Query  417  MIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE----VSGAKVVSLDDVVRPD  584
            MIPTRIESKHWP    +    H +LC DA  E +++ E+     VS A+V+  DD++RPD
Sbjct  121  MIPTRIESKHWPVELNKKPVYHSSLCPDASDEKILLKEKNGEKIVSMARVIKSDDIIRPD  180

Query  585  GIIHGIERVLIP  620
            GIIHGIER+LIP
Sbjct  181  GIIHGIERLLIP  192



>ref|XP_011077777.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Sesamum 
indicum]
Length=463

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 132/161 (82%), Gaps = 4/161 (2%)
 Frame = +3

Query  150  NPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEA  329
             PS +  +G QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVS+HNITIFAPRNEA
Sbjct  31   KPSNSGGAGGQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSKHNITIFAPRNEA  90

Query  330  LERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGG  509
            LERDLDPEFKRFLL+PGNL+SLQNLLLFHMIPTRIES+ WP    +   +H +LC DA  
Sbjct  91   LERDLDPEFKRFLLEPGNLKSLQNLLLFHMIPTRIESRQWPVGLSKKPLHHTSLCPDAND  150

Query  510  ENLVVSERE----VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            E + + E+     V  AKV+  DD++RPDGIIHGIER+L+P
Sbjct  151  EKIQLHEKNGEKIVGIAKVIKSDDIIRPDGIIHGIERLLVP  191



>ref|XP_006339181.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Solanum 
tuberosum]
Length=453

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 135/164 (82%), Gaps = 11/164 (7%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
             ENP   +S+  QINSNS+LVALLDSHYTELSELVEKALLLQTLEEAVS+HNITIFAP+N
Sbjct  28   QENPKSPISTVPQINSNSILVALLDSHYTELSELVEKALLLQTLEEAVSKHNITIFAPKN  87

Query  324  EALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA  503
            EALERDLDPEFKRFLL+PGNL+SLQNLLLFHMIPTRI SK+WP      GR H TL   A
Sbjct  88   EALERDLDPEFKRFLLEPGNLKSLQNLLLFHMIPTRIVSKNWPAR----GRVHSTLY--A  141

Query  504  GGENLV-----VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            G EN++      +E+ VS AK++  DD+V+PDGIIHGIERVLIP
Sbjct  142  GEENVLQISEKKTEKSVSSAKIIKQDDIVKPDGIIHGIERVLIP  185



>ref|XP_004249393.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Solanum 
lycopersicum]
Length=449

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 135/164 (82%), Gaps = 11/164 (7%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
             ENP   +S+  QINSNS+LVALLDSHYTELSELVEKALLLQTLEEAVS+HNITIFAP+N
Sbjct  28   QENPKSPISTVPQINSNSILVALLDSHYTELSELVEKALLLQTLEEAVSKHNITIFAPKN  87

Query  324  EALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA  503
            EALERDLDPEFKRFLL+PGNL+SLQNLLLFHMIPTRI SK+WP      GR H TL   A
Sbjct  88   EALERDLDPEFKRFLLEPGNLKSLQNLLLFHMIPTRIVSKNWPVR----GRVHSTLY--A  141

Query  504  GGENLV-----VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            G EN++      +E+ VS AK++  DD+V+PDGIIHGIERVLIP
Sbjct  142  GEENVLQISDKKTEKSVSSAKIIKQDDIVKPDGIIHGIERVLIP  185



>gb|EYU18152.1| hypothetical protein MIMGU_mgv1a003573mg [Erythranthe guttata]
 gb|EYU18153.1| hypothetical protein MIMGU_mgv1a003573mg [Erythranthe guttata]
Length=576

 Score =   233 bits (594),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 147/195 (75%), Gaps = 13/195 (7%)
 Frame = +3

Query  54   AMDAQIFGlskllcfsvfllvfglvggaalHENPSRNLSSGAQINSNSVLVALLDSHYTE  233
            AMD+QI+G+   L F        +       ENPS   +  AQINSNSVLVALLDSHYTE
Sbjct  121  AMDSQIYGVVLFLTFLAVSSTSAMP------ENPS-TANPTAQINSNSVLVALLDSHYTE  173

Query  234  LSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLLF  413
            LSELVEKALLLQTLE+AV+RHNITIFAPRNEALERDLDPEFK FLL+P NL+SLQNLLLF
Sbjct  174  LSELVEKALLLQTLEQAVTRHNITIFAPRNEALERDLDPEFKLFLLEPRNLKSLQNLLLF  233

Query  414  HMIPTRIESKHWP-ENSRRGGRNHITLCRDAGGE--NLVV---SEREVSGAKVVSLDDVV  575
            HMIP+RIES HWP E   +    H +LCRDA GE   L+V    ++ VS A+V+  DD+V
Sbjct  234  HMIPSRIESNHWPLEKKMKKSVFHASLCRDANGERIQLIVQKNGDKAVSTARVIKSDDIV  293

Query  576  RPDGIIHGIERVLIP  620
            RPDG+IHGIER+LIP
Sbjct  294  RPDGVIHGIERLLIP  308



>ref|XP_009587619.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
tomentosiformis]
Length=449

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 135/164 (82%), Gaps = 8/164 (5%)
 Frame = +3

Query  144  HENPS-RNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPR  320
             ENPS ++  S  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAV+ HNITIFAP+
Sbjct  24   QENPSAKHQMSAPQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVTTHNITIFAPK  83

Query  321  NEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD  500
            NEALERDLDPEFKRFLL+PGNL+SLQ LLLFHMIPTRI+S HWP+   +  R+H TLC  
Sbjct  84   NEALERDLDPEFKRFLLEPGNLKSLQKLLLFHMIPTRIQSLHWPKTELK-PRHHSTLC--  140

Query  501  AGGENLVV----SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             G E++ V     +R VS AKV+  DD+++PDGIIHGIERVLIP
Sbjct  141  PGDEHISVLRKNGDRMVSMAKVIRADDIIKPDGIIHGIERVLIP  184



>ref|XP_009794483.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
sylvestris]
Length=449

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 145/193 (75%), Gaps = 14/193 (7%)
 Frame = +3

Query  57   MDAQIFGlskllcfsvfllvfglvggaalHENPS-RNLSSGAQINSNSVLVALLDSHYTE  233
            MD+QI+G    L     +    L       E+PS ++  S  QINSNSVLVALLDSHYTE
Sbjct  1    MDSQIYGFLFTLILFFAITGAAL------QESPSAKHQMSAPQINSNSVLVALLDSHYTE  54

Query  234  LSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLLF  413
            LSELVEKALLLQTLEEAV++HNITIFAP+NEALERDLDPEFKRFLL+PGNL+SLQ LLLF
Sbjct  55   LSELVEKALLLQTLEEAVTKHNITIFAPKNEALERDLDPEFKRFLLEPGNLKSLQKLLLF  114

Query  414  HMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVV----SEREVSGAKVVSLDDVVRP  581
            HMIPTRI+S HWP+   +  R+H TLC   G E + V     +R VS AKV+  DD+++P
Sbjct  115  HMIPTRIQSLHWPKTELK-PRHHSTLC--PGDERISVLRKSGDRMVSMAKVIRADDIIKP  171

Query  582  DGIIHGIERVLIP  620
            DGIIHGIERVLIP
Sbjct  172  DGIIHGIERVLIP  184



>emb|CDP10566.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 130/152 (86%), Gaps = 5/152 (3%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVS+HNITIFAP+NEALERDLDPEFK
Sbjct  49   QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSKHNITIFAPKNEALERDLDPEFK  108

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPEN-SRRGGRNHITLCRDAGGENLVVSER-  533
            RFLL+PGNL+SLQNLLLFHMIP+RI+S HWP + S     +H +LC+DA  E+L +S R 
Sbjct  109  RFLLEPGNLKSLQNLLLFHMIPSRIDSAHWPHHRSSNKSSHHTSLCKDAFDESLRISHRN  168

Query  534  ---EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                +S A++   +D+VRPDGIIHGIERVLIP
Sbjct  169  GDDHISVARIFKPNDIVRPDGIIHGIERVLIP  200



>gb|EPS67882.1| hypothetical protein M569_06891, partial [Genlisea aurea]
Length=475

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 127/159 (80%), Gaps = 4/159 (3%)
 Frame = +3

Query  156  SRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALE  335
            S  L SG QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAV+RHNITIFAPRNEALE
Sbjct  47   SVGLGSGPQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVARHNITIFAPRNEALE  106

Query  336  RDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGEN  515
            RDLDPEFKRFLL+P NL SLQNLLLFH+IP RI+   WP      G +H +LCRD  GE 
Sbjct  107  RDLDPEFKRFLLEPRNLESLQNLLLFHVIPGRIDGGRWPAAPSGRGVHHSSLCRDGNGEK  166

Query  516  LVV----SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            + +     E+ V  ++V+  DDVVRPDGIIHGIER+L+P
Sbjct  167  IRLNENNGEKTVGISRVIKSDDVVRPDGIIHGIERILVP  205



>gb|EYU38707.1| hypothetical protein MIMGU_mgv1a006053mg [Erythranthe guttata]
Length=459

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 125/145 (86%), Gaps = 4/145 (3%)
 Frame = +3

Query  198  VLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQP  377
            VLVALLDSHYTELSELVEKALLLQTLEEAVS+HNI+IFAPRNEALERDLDPEFKRFLL+P
Sbjct  43   VLVALLDSHYTELSELVEKALLLQTLEEAVSKHNISIFAPRNEALERDLDPEFKRFLLEP  102

Query  378  GNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVV----SEREVSG  545
            GNL+SLQNL+LFHMIP+RIESKHWP   ++   +H +LCRDAG E + +     ER V  
Sbjct  103  GNLKSLQNLILFHMIPSRIESKHWPAGVQKKQVHHASLCRDAGDEKIRLHEKNGERIVGM  162

Query  546  AKVVSLDDVVRPDGIIHGIERVLIP  620
            A+V+  DD++RPDGIIHGIER+L+P
Sbjct  163  ARVIKPDDIIRPDGIIHGIERLLVP  187



>ref|XP_009595093.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
tomentosiformis]
Length=454

 Score =   221 bits (563),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 129/167 (77%), Gaps = 16/167 (10%)
 Frame = +3

Query  144  HENPSRNL----SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIF  311
             ENP+       +S  QINSNS+LVALLDSHYTELSELVEKALLLQTLEEAVS+HNITIF
Sbjct  28   QENPTATFAKPTTSAPQINSNSILVALLDSHYTELSELVEKALLLQTLEEAVSKHNITIF  87

Query  312  APRNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITL  491
            AP+NEALERDLDPEFKRFLL+PGNLRSLQNLLLFHMIPTRI S  WP       R H TL
Sbjct  88   APKNEALERDLDPEFKRFLLEPGNLRSLQNLLLFHMIPTRIVSNQWP------ARVHATL  141

Query  492  CRDAGGENLVV----SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                G EN+ V     E+ VS A ++  DD+++PDG+IHGIERVLIP
Sbjct  142  Y--PGDENVNVVEKNGEKMVSSAMIIKQDDIIKPDGVIHGIERVLIP  186



>gb|AGN92422.1| putative fasciclin-like arabinogalactan protein 2 [Centaurium 
erythraea]
Length=461

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 132/163 (81%), Gaps = 9/163 (6%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
            H NPS   S    +NSNSVLVALLDS YTELSELVEKALLLQ LEEAVS+HNITIFAPRN
Sbjct  28   HPNPSAKHS----VNSNSVLVALLDSQYTELSELVEKALLLQKLEEAVSKHNITIFAPRN  83

Query  324  EALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA  503
            EALERDLDPEFKRFLL+PGNL+SLQ+LLL+HMIPTRI+S  WP+   +   +H +LC+++
Sbjct  84   EALERDLDPEFKRFLLEPGNLKSLQDLLLYHMIPTRIQSSQWPKQLHK-SFHHSSLCKES  142

Query  504  GGENLVVS----EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              E L +S    E+ VSGAK+   DDV+RPDGIIHGIER+LIP
Sbjct  143  SXEILKISNKNGEKIVSGAKITRPDDVIRPDGIIHGIERLLIP  185



>ref|XP_009783700.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nicotiana 
sylvestris]
Length=454

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 123/194 (63%), Positives = 143/194 (74%), Gaps = 14/194 (7%)
 Frame = +3

Query  57   MDAQIFGlskllcfsvfllvfglvggaalHENPS--RNLSSGAQINSNSVLVALLDSHYT  230
            MD QI+G+S L  F+V LL          ++N +  +  +S  QINSNS+LVALLDSHYT
Sbjct  1    MDFQIYGVSNLFIFTVILLFSIAAATLQENQNATFVKPTTSAPQINSNSILVALLDSHYT  60

Query  231  ELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLL  410
            ELSELVEKALLLQTLEEAVS+HNITIFAP+NEALERDLDPEFKRFLL+PGNLRSLQNLLL
Sbjct  61   ELSELVEKALLLQTLEEAVSKHNITIFAPKNEALERDLDPEFKRFLLEPGNLRSLQNLLL  120

Query  411  FHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVV----SEREVSGAKVVSLDDVVR  578
            FHMIP RI S  WP       R H TL    G EN+ V     E+ VS A ++  DD+++
Sbjct  121  FHMIPARIVSNQWP------ARVHATLY--PGDENVNVVQKNGEKMVSSAMIIKQDDIIK  172

Query  579  PDGIIHGIERVLIP  620
            PDG+IHGIERVLIP
Sbjct  173  PDGVIHGIERVLIP  186



>gb|KJB36231.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=330

 Score =   207 bits (527),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            +NPS   S   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNE
Sbjct  31   QNPSGKSSPSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNE  90

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-A  503
            ALER LDPEFKRFLL+PGNL+SLQ LL+FH+IP R+ S  WP+  + G   H TLC D  
Sbjct  91   ALERQLDPEFKRFLLEPGNLKSLQTLLMFHIIPKRVGSHQWPD-PKTGPVKHNTLCNDHI  149

Query  504  GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               +    ++ V  A++V  DDV+RPDG+IHGI+++LIP
Sbjct  150  RLTSQSTGKKTVDSAELVRPDDVIRPDGVIHGIQQLLIP  188



>ref|XP_006495395.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like, partial 
[Citrus sinensis]
Length=309

 Score =   206 bits (524),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            SS  QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAP+NEALER+LD
Sbjct  30   SSQPQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPKNEALERELD  89

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFKRFLL+PGN++SLQ LL+FH++P+RI S++WP+  + G R H TL  D    +   S
Sbjct  90   PEFKRFLLEPGNVKSLQTLLMFHILPSRIGSRNWPD-EKSGSRKHNTLWNDFVHLSSKSS  148

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +R +  A++   DD+ RPDG+IHGIER+L+P
Sbjct  149  KRLIGSAEIFRPDDITRPDGVIHGIERLLVP  179



>ref|XP_004303393.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Fragaria 
vesca subsp. vesca]
Length=457

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 127/155 (82%), Gaps = 10/155 (6%)
 Frame = +3

Query  171  SGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDP  350
            S AQI+SNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HNITIFAPRNEALER LDP
Sbjct  40   SSAQIHSNSVLVALLDSHYTELAELVEKALLLQTLEQAVGQHNITIFAPRNEALERQLDP  99

Query  351  EFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSE  530
            EFKRFLL+PGNL+SLQ LL+FH+IP RI S  WP++S  G   H TLC++   E+L +S 
Sbjct  100  EFKRFLLEPGNLKSLQTLLMFHIIPKRIASDQWPKDS--GSGRHRTLCKN---EHLHLSS  154

Query  531  RE-----VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            ++     V  A+VV  DDV+RPDG+IHGIERVLIP
Sbjct  155  KDSGNKAVDSAEVVRPDDVIRPDGLIHGIERVLIP  189



>gb|KDO70682.1| hypothetical protein CISIN_1g019153mg [Citrus sinensis]
Length=345

 Score =   205 bits (521),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            SS  QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAP+NEALER+LD
Sbjct  30   SSQPQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPKNEALERELD  89

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFKRFLL+PGN++SLQ LL+FH++P+RI S++WP+  + G R H TL  D    +   S
Sbjct  90   PEFKRFLLEPGNVKSLQTLLMFHILPSRIGSRNWPD-EKSGSRKHNTLWNDFVHLSSKSS  148

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +R +  A++   DD+ RPDG+IHGIER+L+P
Sbjct  149  KRLIGSAEIFRPDDITRPDGVIHGIERLLVP  179



>ref|XP_006430020.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 ref|XP_006430021.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 gb|ESR43260.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
 gb|ESR43261.1| hypothetical protein CICLE_v10011703mg [Citrus clementina]
Length=451

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            SS  QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAP+NEALER+LD
Sbjct  30   SSQPQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPKNEALERELD  89

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFKRFLL+PGNL+SLQ LL+FH++P+RI S++WP+  + G R H TL  D    +   +
Sbjct  90   PEFKRFLLEPGNLKSLQTLLMFHILPSRIGSRNWPDE-KSGSRKHNTLWNDFVHLSSKST  148

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +R +  A++   DD+ RPDG+IHGIER+L+P
Sbjct  149  KRLIGSAEIFRPDDITRPDGVIHGIERLLVP  179



>gb|KJB36232.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=460

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            +NPS   S   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNE
Sbjct  31   QNPSGKSSPSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNE  90

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-A  503
            ALER LDPEFKRFLL+PGNL+SLQ LL+FH+IP R+ S  WP + + G   H TLC D  
Sbjct  91   ALERQLDPEFKRFLLEPGNLKSLQTLLMFHIIPKRVGSHQWP-DPKTGPVKHNTLCNDHI  149

Query  504  GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               +    ++ V  A++V  DDV+RPDG+IHGI+++LIP
Sbjct  150  RLTSQSTGKKTVDSAELVRPDDVIRPDGVIHGIQQLLIP  188



>ref|XP_006481636.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
Length=451

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 124/151 (82%), Gaps = 1/151 (1%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            SS  QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAP+NEALER+LD
Sbjct  30   SSQPQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPKNEALERELD  89

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFKRFLL+PGN++SLQ LL+FH++P+RI S++WP+  + G R H TL  D    +   S
Sbjct  90   PEFKRFLLEPGNVKSLQTLLMFHILPSRIGSRNWPDE-KSGSRKHNTLWNDFVHLSSKSS  148

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +R +  A++   DD+ RPDG+IHGIER+L+P
Sbjct  149  KRLIGSAEIFRPDDITRPDGVIHGIERLLVP  179



>gb|KJB36230.1| hypothetical protein B456_006G147500 [Gossypium raimondii]
Length=459

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            +NPS   S   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNE
Sbjct  31   QNPSGKSSPSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNE  90

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-A  503
            ALER LDPEFKRFLL+PGNL+SLQ LL+FH+IP R+ S  WP + + G   H TLC D  
Sbjct  91   ALERQLDPEFKRFLLEPGNLKSLQTLLMFHIIPKRVGSHQWP-DPKTGPVKHNTLCNDHI  149

Query  504  GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               +    ++ V  A++V  DDV+RPDG+IHGI+++LIP
Sbjct  150  RLTSQSTGKKTVDSAELVRPDDVIRPDGVIHGIQQLLIP  188



>gb|ABV27485.1| fasciclin-like arabinogalactan protein 14 [Gossypium hirsutum]
Length=459

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 125/159 (79%), Gaps = 2/159 (1%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            +NPS   S   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNE
Sbjct  31   QNPSGKSSPSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNE  90

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-A  503
            ALER LDPEFKRFLL+PGNL+SLQ+LL+FH+IP R+ S  WP + + G   H TLC D  
Sbjct  91   ALERQLDPEFKRFLLEPGNLKSLQSLLMFHIIPKRVGSHQWP-DPKTGPVKHNTLCNDHI  149

Query  504  GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               +    ++ V  A++V  DDV+RPDG+IHGI+++LIP
Sbjct  150  RLTSQSTGKKTVDSAELVRPDDVIRPDGVIHGIQQLLIP  188



>gb|KHG03559.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=459

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            +NPS   S   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNE
Sbjct  31   QNPSGKSSPSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNE  90

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-A  503
            ALER LDPEFKRFLL+PGNL+SLQ+LL+FH+IP R+ S  WP + +     H TLC D  
Sbjct  91   ALERQLDPEFKRFLLEPGNLKSLQSLLMFHIIPKRVGSHQWP-DPKTSPAKHNTLCNDHI  149

Query  504  GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               +    ++ V  A++V  DDV+RPDG+IHGI+++LIP
Sbjct  150  RLTSQSTGKKTVDSAELVRPDDVIRPDGVIHGIQQLLIP  188



>ref|XP_007204352.1| hypothetical protein PRUPE_ppa005721mg [Prunus persica]
 gb|EMJ05551.1| hypothetical protein PRUPE_ppa005721mg [Prunus persica]
Length=447

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 6/152 (4%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
            AQINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV  HNITIFAP+NEALER LDPEF
Sbjct  23   AQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGNHNITIFAPKNEALERQLDPEF  82

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVV----  524
            KRFLL+PGNL+SLQ LL+FH+IP RI S  WP      GR+H TLC      +L      
Sbjct  83   KRFLLEPGNLKSLQTLLMFHIIPNRIGSTQWPHPG--SGRHHQTLCSSHERLHLATHKNN  140

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            S + V+ A+++  DDV RPDG+IHGIER+LIP
Sbjct  141  SRKSVNSAQIIRPDDVTRPDGVIHGIERLLIP  172



>ref|XP_009130939.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
 ref|XP_009130940.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
Length=458

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 124/159 (78%), Gaps = 4/159 (3%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            +NP+ +  SG QINSNSVLVALLDS YTELSELVEKALLLQTLE+AV RHNITIFAPRNE
Sbjct  30   KNPNPSSGSG-QINSNSVLVALLDSRYTELSELVEKALLLQTLEDAVGRHNITIFAPRNE  88

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGR-NHITLCRDA  503
            ALERDLDPEFKRFLL+PGNL+SLQ LL+FH+IPTR+ S  WP  S   GR  HITL  D 
Sbjct  89   ALERDLDPEFKRFLLEPGNLKSLQTLLMFHIIPTRVGSDQWP--SEDPGRVKHITLANDH  146

Query  504  GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                    ++ V  A ++  DD+ RPDG+IHGIER+LIP
Sbjct  147  LHLIKGDGKKMVDSAAIIRPDDLTRPDGLIHGIERLLIP  185



>gb|KDP42957.1| hypothetical protein JCGZ_23899 [Jatropha curcas]
Length=458

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 120/156 (77%), Gaps = 10/156 (6%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S+  QINSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV RHN+TIFAP+NEALER LD
Sbjct  35   SNSTQINSNSVLVALLDSHYTELAELVEKALLLQTLEQAVGRHNVTIFAPKNEALERHLD  94

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRN-----HITLCRDAGGE  512
            PEFKRFLL+PGNL+SLQ L+LFH+IPTRI S  WP +S     N     H+ L R+    
Sbjct  95   PEFKRFLLEPGNLKSLQELILFHIIPTRINSDQWPTHSLSTHHNTLSSDHLHLTREQKS-  153

Query  513  NLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                 ER V  AKV+  D V+RPDGIIHGIER+LIP
Sbjct  154  ----GERIVGHAKVIHPDSVIRPDGIIHGIERLLIP  185



>emb|CDY55758.1| BnaA03g55350D [Brassica napus]
Length=458

 Score =   203 bits (516),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 121/158 (77%), Gaps = 6/158 (4%)
 Frame = +3

Query  150  NPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEA  329
            NPS   S   QINSNSVLVALLDS YTELSELVEKALLLQTLE+AV RHNITIFAPRNEA
Sbjct  34   NPS---SGSGQINSNSVLVALLDSRYTELSELVEKALLLQTLEDAVGRHNITIFAPRNEA  90

Query  330  LERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGR-NHITLCRDAG  506
            LERDLDPEFKRFLL+PGNL+SLQ LL+FH+IPTR+ S  WP  S   GR  HITL  D  
Sbjct  91   LERDLDPEFKRFLLEPGNLKSLQTLLMFHIIPTRVGSDQWP--SEDPGRVKHITLANDHL  148

Query  507  GENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                   ++ V  A ++  DD+ RPDG+IHGIER+LIP
Sbjct  149  HLIKGDGKKMVDSAAIIRPDDLTRPDGLIHGIERLLIP  186



>ref|XP_008241098.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Prunus 
mume]
Length=483

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 118/151 (78%), Gaps = 6/151 (4%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV  HNITIFAP+NEALER LDPEFK
Sbjct  60   QINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGNHNITIFAPKNEALERQLDPEFK  119

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVV----S  527
            RFLL+PGNL+SLQ LL+FH+IP RI S  WP      GR+H TLC      +L      S
Sbjct  120  RFLLEPGNLKSLQTLLMFHIIPNRIGSTQWPHPG--SGRHHQTLCSSHERLHLATHKNDS  177

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             + V+ A+++  DDV RPDG+IHGIER+LIP
Sbjct  178  RKSVNSAQIIRPDDVTRPDGVIHGIERLLIP  208



>emb|CDX81004.1| BnaC03g02580D [Brassica napus]
Length=488

 Score =   203 bits (517),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 128/161 (80%), Gaps = 8/161 (5%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            +NP+ +  SG QINSNSVLVALLDS YTELSELVEKALLLQTLE+AV RHNITIFAPRNE
Sbjct  28   KNPNTSSGSG-QINSNSVLVALLDSRYTELSELVEKALLLQTLEDAVGRHNITIFAPRNE  86

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGR-NHITLCRDA  503
            ALERDLDPEFKRFLL+PGNL+SLQ LL+FH+IPTR+ S  WP  S   GR  H+TL  D 
Sbjct  87   ALERDLDPEFKRFLLEPGNLKSLQTLLMFHIIPTRVGSDQWP--SEDSGRVKHVTLANDH  144

Query  504  GGENLVVSE--REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               +L+  +  + V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  145  --LHLIKGDGRKMVDSAEIIRPDDLTRPDGLIHGIERLLIP  183



>ref|XP_011047143.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Populus 
euphratica]
Length=466

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 123/161 (76%), Gaps = 3/161 (2%)
 Frame = +3

Query  144  HENPS-RNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPR  320
            H+N +  N  +G  INSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPR
Sbjct  31   HQNKTGNNTGTGQMINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPR  90

Query  321  NEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD  500
            NEALER LDPEFKRFLL+PGNL+SLQ LLLFH+IP R+ S  WP +     R H TLC D
Sbjct  91   NEALERQLDPEFKRFLLEPGNLKSLQTLLLFHIIPQRVGSNDWPGHKSYPSR-HTTLCND  149

Query  501  AGGENLVVSEREVSG-AKVVSLDDVVRPDGIIHGIERVLIP  620
                    S ++V G A++   DDV RPDG+IHGIER+L+P
Sbjct  150  HLHLITKNSGKKVVGSAELTRPDDVTRPDGVIHGIERLLVP  190



>ref|XP_009362660.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Pyrus x 
bretschneideri]
Length=457

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 122/157 (78%), Gaps = 7/157 (4%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N SS A +NSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV  HN+TIFAP+NEALER 
Sbjct  29   NKSSTAAVNSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGNHNVTIFAPKNEALERQ  88

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDPEFKRFLL+PGNL+SLQ LL+FH+IP+RI S  WP  S   G +H TL  +    +L 
Sbjct  89   LDPEFKRFLLEPGNLKSLQTLLMFHIIPSRIGSAQWPSGS---GHHHKTLSGNHEHIHLT  145

Query  522  VSE----REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +    + V+ A+++  DDV RPDG+IHGIER+LIP
Sbjct  146  THKPTGRKSVNSAQIIGPDDVTRPDGVIHGIERLLIP  182



>ref|XP_002309262.1| hypothetical protein POPTR_0006s21460g [Populus trichocarpa]
 gb|EEE92785.1| hypothetical protein POPTR_0006s21460g [Populus trichocarpa]
Length=466

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +3

Query  144  HENPSRN-LSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPR  320
            H+N + N   +G  INSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPR
Sbjct  31   HQNKTGNSTGTGQMINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPR  90

Query  321  NEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD  500
            NEALER LDPEFKRFLL+PGNL+SLQ L+LFH+IP R+ S  WP +     R H TLC D
Sbjct  91   NEALERQLDPEFKRFLLEPGNLKSLQTLVLFHIIPQRVGSNDWPGHKSNPSR-HTTLCND  149

Query  501  AGGENLVVSEREVSG-AKVVSLDDVVRPDGIIHGIERVLIP  620
                    S ++V G A V   DDV RPDG+IHGIER+L+P
Sbjct  150  HLHLITKNSGKKVVGSADVTRPDDVTRPDGVIHGIERLLVP  190



>emb|CDX98919.1| BnaC09g49160D [Brassica napus]
Length=457

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S   QINSNSVLVALLDS YTELSELVEKALLLQTLEEAV RHNITIFAPRNEALERDLD
Sbjct  36   SGSGQINSNSVLVALLDSRYTELSELVEKALLLQTLEEAVGRHNITIFAPRNEALERDLD  95

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFKRFLL+PGNL+SLQ LL+FH+IP R+ S  WP N   G   H TL  D         
Sbjct  96   PEFKRFLLEPGNLKSLQTLLMFHIIPNRVGSDQWP-NEESGRVKHDTLGSDHVHLTNGDG  154

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            ++ V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  155  KKMVDSAEIIRPDDLTRPDGLIHGIERLLIP  185



>ref|XP_007028043.1| FASCICLIN-like arabinogalactan protein 17 precursor [Theobroma 
cacao]
 gb|EOY08545.1| FASCICLIN-like arabinogalactan protein 17 precursor [Theobroma 
cacao]
Length=463

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 120/151 (79%), Gaps = 6/151 (4%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNEALER LDPEF
Sbjct  45   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNEALERQLDPEF  104

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV---VS  527
            KRFLL+PGNL+SLQ LL+FH+IP R+ S  WP + + G   H TLC D    NL      
Sbjct  105  KRFLLEPGNLKSLQTLLMFHIIPKRVGSHQWP-DPKTGPVKHNTLCNDH--LNLTSKSTG  161

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            ++ V  A+++  DDV+RPDG+IHGI+++LIP
Sbjct  162  KKTVDSAELIRPDDVIRPDGVIHGIQQLLIP  192



>ref|XP_011042549.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
 ref|XP_011042550.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=466

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 125/161 (78%), Gaps = 3/161 (2%)
 Frame = +3

Query  144  HENPSRNLS-SGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPR  320
            H+N + N + +G  INSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAP+
Sbjct  31   HQNRTGNSTVTGQMINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPK  90

Query  321  NEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD  500
            NEALER LDPEFKRFLL+PGNL+SLQ LLLFH+IP R+ S  WP +     R H TLC D
Sbjct  91   NEALERQLDPEFKRFLLEPGNLKSLQTLLLFHIIPQRVGSNDWPGHKSNPTR-HTTLCND  149

Query  501  AGGENLVVSEREVSGAKVVS-LDDVVRPDGIIHGIERVLIP  620
                    S +++ GA V++  DDV RPDG+IHGIER+L+P
Sbjct  150  HLHLITKNSGKKLVGAAVLTRPDDVTRPDGVIHGIERLLVP  190



>ref|XP_008387142.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Malus domestica]
Length=455

 Score =   201 bits (510),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 122/157 (78%), Gaps = 7/157 (4%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N SS A +NSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV  HN+TIFAP+NEALER 
Sbjct  28   NKSSTAAVNSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGNHNVTIFAPKNEALERQ  87

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDPEFKRFLL+PGNL+SLQ LL+FH+IP+RI S  WP  S   GR+H TL  +    +L 
Sbjct  88   LDPEFKRFLLEPGNLKSLQTLLMFHIIPSRIGSAQWPSGS---GRHHKTLSGNHEHIHLT  144

Query  522  VSE----REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +    + V+ A+++  DDV RPDG+IHGIE +LIP
Sbjct  145  THKPTGRKSVNSAQIIRPDDVTRPDGVIHGIEGLLIP  181



>ref|XP_009388984.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009388985.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 121/152 (80%), Gaps = 3/152 (2%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            +SG QINSNSVLVALLDSHYTEL+ELVEKALLL +LE AV RHN+TIFAPRNEALERDLD
Sbjct  41   ASGGQINSNSVLVALLDSHYTELAELVEKALLLPSLEAAVGRHNVTIFAPRNEALERDLD  100

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRG-GRNHITLCRDAGGENLVV  524
            PEFKRFLL+PGNLRSLQ LLL+H++P+R+ S  WP++ R     +H+ L   +     V 
Sbjct  101  PEFKRFLLEPGNLRSLQTLLLYHVVPSRVASDSWPQSRRPTLAGDHVQLSSSSSAGAAV-  159

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             +R+V  A VV  D VVRPDG+IHGIER+L+P
Sbjct  160  -DRKVGLAAVVHPDAVVRPDGVIHGIERLLVP  190



>ref|XP_002322769.2| hypothetical protein POPTR_0016s06680g [Populus trichocarpa]
 gb|EEF04530.2| hypothetical protein POPTR_0016s06680g [Populus trichocarpa]
Length=466

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 125/161 (78%), Gaps = 3/161 (2%)
 Frame = +3

Query  144  HENPSRNLS-SGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPR  320
            H+N + N + +G  INSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAP+
Sbjct  31   HQNRTGNSTVTGQMINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPK  90

Query  321  NEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD  500
            NEALER LDPEFKRFLL+PGNL+SLQ LLLFH+IP R+ S  WP +     R H TLC D
Sbjct  91   NEALERQLDPEFKRFLLEPGNLKSLQTLLLFHIIPQRVGSNDWPGHKSNPTR-HTTLCND  149

Query  501  AGGENLVVSEREVSGAKVVS-LDDVVRPDGIIHGIERVLIP  620
                    S +++ GA V++  DDV RPDG+IHGIER+L+P
Sbjct  150  HLHLITKNSGKKLVGAAVLTRPDDVTRPDGVIHGIERLLVP  190



>ref|XP_010248022.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Nelumbo 
nucifera]
Length=469

 Score =   200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 16/159 (10%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S+  QINS+SVLVALLDSHYTELSELVEKALLLQTLEEAV ++NITIFAP+NEALERDLD
Sbjct  39   SNSGQINSHSVLVALLDSHYTELSELVEKALLLQTLEEAVGKYNITIFAPKNEALERDLD  98

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRN--------HITLCRDA  503
            PEFKRFLL+PGNL+SLQ LL+FH+IP RI S  WP+ + +  R+        H+T C+D+
Sbjct  99   PEFKRFLLEPGNLKSLQTLLMFHIIPKRIASDEWPKIAAKSVRHQTLSNDHLHLT-CKDS  157

Query  504  GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            G       ++ V  A VV  D VVRPDG+IHGIER+LIP
Sbjct  158  G-------KKVVDLATVVHPDAVVRPDGVIHGIERLLIP  189



>ref|XP_007010508.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 ref|XP_007010509.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 gb|EOY19318.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
 gb|EOY19319.1| FASCICLIN-like arabinogalactan protein 16 precursor isoform 1 
[Theobroma cacao]
Length=454

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 124/165 (75%), Gaps = 12/165 (7%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
             E PS    SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEE V +HNITIFAP+N
Sbjct  23   QETPSTTTHSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEETVGKHNITIFAPKN  81

Query  324  EALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA  503
            EALERDLDPEFKRFLL+PGNL+SLQ LLL+H++P+RIE   WP+++    R H TL  D 
Sbjct  82   EALERDLDPEFKRFLLEPGNLKSLQTLLLYHIVPSRIEPHSWPKSTSDSTR-HRTLSND-  139

Query  504  GGENLVVSEREVSGAKVVSLDDVV------RPDGIIHGIERVLIP  620
                + +S  + SGAK +    V+      RPDG+IHGIE++LIP
Sbjct  140  ---RVQLSSEDSSGAKFIGTAKVINPNAVDRPDGVIHGIEQLLIP  181



>ref|XP_009348615.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Pyrus x 
bretschneideri]
Length=452

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 122/157 (78%), Gaps = 6/157 (4%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N SS   +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE AV  HN+TIFAP+NEALER 
Sbjct  28   NKSSTTAVNSNSVLVALLDSHYTELAELVEKALLLQTLEAAVGNHNVTIFAPKNEALERQ  87

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDPEFKRFLL+PGNL+SLQ LL+FH+IP+RI S  WP++    GR+H TL  +    +L 
Sbjct  88   LDPEFKRFLLEPGNLKSLQTLLMFHIIPSRIGSTQWPDSG--SGRHHKTLSGNHEHLHLT  145

Query  522  VSE----REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +    + V+ A+++  DDV RPDG+IHGIER+LIP
Sbjct  146  THKPTGRKSVNSAQIIRPDDVTRPDGVIHGIERLLIP  182



>ref|XP_007163001.1| hypothetical protein PHAVU_001G197900g [Phaseolus vulgaris]
 gb|ESW34995.1| hypothetical protein PHAVU_001G197900g [Phaseolus vulgaris]
Length=437

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 120/157 (76%), Gaps = 10/157 (6%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N S+  Q+NSNS+LVALLDSHYTEL+ELV+KALLLQ LE+AV  HNIT+FAPRN+ALERD
Sbjct  32   NSSTTPQVNSNSILVALLDSHYTELAELVDKALLLQQLEDAVGNHNITVFAPRNQALERD  91

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRR----GGRNHITLCRDAGG  509
            LDPEFKRFLL+P NLRSLQ LL+ H++PTRI S+HWP   RR    G  +H+ L     G
Sbjct  92   LDPEFKRFLLEPRNLRSLQTLLMSHILPTRISSRHWPAADRRHATLGNHHHLHLATKPSG  151

Query  510  ENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  +  V  A+++  DD+VRPDG+IHGIER+L+P
Sbjct  152  ------QMTVDAAEILRADDIVRPDGVIHGIERLLVP  182



>ref|XP_002882744.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59003.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=460

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 123/165 (75%), Gaps = 11/165 (7%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            E+   N++   QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV RHNITIFAPRNE
Sbjct  25   ESGHHNITGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNE  84

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA-  503
            ALERDLDP+FKRFLLQPGNL+SLQ LLL H+IP R+ S  WPE++  G   H+TL  D  
Sbjct  85   ALERDLDPDFKRFLLQPGNLKSLQTLLLSHIIPKRVGSNQWPEDN-SGRVKHVTLGHDQV  143

Query  504  ------GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                   G N    +R V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  144  LHLSKIKGAN---GKRLVNSAVITRPDDLTRPDGLIHGIERLLIP  185



>ref|XP_008392004.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Malus domestica]
Length=454

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 122/157 (78%), Gaps = 6/157 (4%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N SS   +NSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV  HN+TIFAP+NEALER 
Sbjct  31   NKSSTTAVNSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGNHNVTIFAPKNEALERQ  90

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDPEFKRFLL+PGNL+SLQ LL+FH+IP+RI S  WP++    GR+H TL  +    +L 
Sbjct  91   LDPEFKRFLLEPGNLKSLQTLLMFHIIPSRIGSTQWPDSG--SGRHHKTLSGNHEHLHLX  148

Query  522  VSE----REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +    + V+ A+++  DDV RPDG+IHGIE +LIP
Sbjct  149  THKPTGRKSVNSAQIIRPDDVTRPDGVIHGIESLLIP  185



>ref|XP_010543842.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=468

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 124/161 (77%), Gaps = 6/161 (4%)
 Frame = +3

Query  153  PSRNLSSGAQ---INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
            P RNLSSG+    INSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV +HNIT+FAPRN
Sbjct  35   PGRNLSSGSGSGLINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGKHNITVFAPRN  94

Query  324  EALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA  503
            EALER+LDPEFKRFLL+PGNL+SLQ LL+FH +P R+ S  WP+    G   H TL +D 
Sbjct  95   EALERELDPEFKRFLLEPGNLKSLQTLLMFHFLPKRVGSHQWPDEE-SGLVRHETLGQDN  153

Query  504  GGENLV--VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               + +    +R V  A+++  DDV RPDG+IHGIER+LIP
Sbjct  154  VHLSKIKKTGKRMVDSAEIIRPDDVTRPDGVIHGIERLLIP  194



>ref|XP_010491197.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=457

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = +3

Query  162  NLSSGA-QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALER  338
            NLSSG+ QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV  HNITIFAPRNEALER
Sbjct  33   NLSSGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGLHNITIFAPRNEALER  92

Query  339  DLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGR-NHITLCRDAGGEN  515
            DLDPEFKRFLLQPGNL+SLQ LL+FH+IP R+ S  WP  S   GR  H TL  D    +
Sbjct  93   DLDPEFKRFLLQPGNLKSLQTLLMFHIIPNRVGSDQWP--SEESGRVKHNTLGNDQVHLS  150

Query  516  LVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                ++ V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  151  NGDGKKMVDLAEIIRPDDLTRPDGLIHGIERLLIP  185



>ref|XP_009122246.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Brassica 
rapa]
Length=457

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 121/157 (77%), Gaps = 13/157 (8%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S   QINSNSVLVALLDS YTELSELVEKALLLQTLEEAV RHNITIFAPRNEALER+LD
Sbjct  36   SGSGQINSNSVLVALLDSRYTELSELVEKALLLQTLEEAVGRHNITIFAPRNEALERELD  95

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWP-ENSRRG-----GRNHITLCRDAGG  509
            PEFKRFLL+PGNL+SLQ LL+FH+IP R+ S+ WP E+S R      G +H+ L    G 
Sbjct  96   PEFKRFLLEPGNLKSLQTLLMFHIIPNRVGSEQWPKEDSGRVKHDTLGNDHLHLINGDG-  154

Query  510  ENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  ++ V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  155  ------KKMVDSAEIIRPDDLTRPDGLIHGIERLLIP  185



>ref|XP_010110455.1| hypothetical protein L484_006448 [Morus notabilis]
 gb|EXC26397.1| hypothetical protein L484_006448 [Morus notabilis]
Length=460

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 117/154 (76%), Gaps = 12/154 (8%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNEALER LDPEF
Sbjct  40   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNEALERQLDPEF  99

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENS------RRGGRNHITLCRDAGGENL  518
            KRFLL+PGNL+SLQ LL+FH+IP+R+ S  WP +       R     H+       GE +
Sbjct  100  KRFLLEPGNLKSLQILLMFHIIPSRVGSGDWPVSGSDPVRHRTLSTEHVHFASKGSGEKV  159

Query  519  VVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V S      A++V  DDVVRPDG+IHGIER+LIP
Sbjct  160  VNS------AEIVRPDDVVRPDGVIHGIERLLIP  187



>ref|XP_010423345.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=459

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = +3

Query  162  NLSSGA-QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALER  338
            NLSSG+ QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV  HNITIFAPRNEALER
Sbjct  35   NLSSGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGLHNITIFAPRNEALER  94

Query  339  DLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGR-NHITLCRDAGGEN  515
            DLDPEFKRFLLQPGNL+SLQ LL+FH+IP R+ S  WP  S   GR  H TL  D    +
Sbjct  95   DLDPEFKRFLLQPGNLKSLQTLLMFHIIPNRVGSDQWP--SEESGRVKHHTLGNDQVHLS  152

Query  516  LVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                ++ V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  153  NGNGKKMVDLAEIIRPDDLTRPDGLIHGIERLLIP  187



>ref|XP_010452564.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Camelina 
sativa]
Length=456

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = +3

Query  162  NLSSGA-QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALER  338
            NLSSG+ QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV  HNITIFAPRNEALER
Sbjct  32   NLSSGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGLHNITIFAPRNEALER  91

Query  339  DLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGR-NHITLCRDAGGEN  515
            DLDPEFKRFLLQPGNL+SLQ LL+FH+IP R+ S  WP  S   GR  H TL  D    +
Sbjct  92   DLDPEFKRFLLQPGNLKSLQTLLMFHIIPNRVGSDQWP--SEESGRVKHHTLGNDQVHLS  149

Query  516  LVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                ++ V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  150  NGDGKKMVDLAEIIRPDDLTRPDGLIHGIERLLIP  184



>gb|AAF02137.1|AC009918_9 unknown protein [Arabidopsis thaliana]
Length=447

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 122/165 (74%), Gaps = 11/165 (7%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            E+   N++   QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV RHNITIFAPRNE
Sbjct  27   ESGHHNITGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNE  86

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA-  503
            ALERDLDP+FKRFLLQPGNL+SLQ LLL H+IP R+ S  WPE +  G   H+TL  D  
Sbjct  87   ALERDLDPDFKRFLLQPGNLKSLQTLLLSHIIPKRVGSNQWPEEN-SGRVKHVTLGHDQV  145

Query  504  ------GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                   G N    +R V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  146  LHLSKLKGTN---GKRLVNSAVITRPDDLTRPDGLIHGIERLLIP  187



>ref|XP_002270321.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Vitis vinifera]
Length=466

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 118/156 (76%), Gaps = 10/156 (6%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S+  QINSNSVLVALLDSHYTEL+ELVEKALLL TLE+AV +HNITIFAPRNEALERDLD
Sbjct  42   SNSPQINSNSVLVALLDSHYTELAELVEKALLLPTLEDAVGKHNITIFAPRNEALERDLD  101

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-----AGGE  512
            PEFKRFLL+PGNL+SLQ LLLFH+IP RI S  WPE    G   H TL  D     + G 
Sbjct  102  PEFKRFLLEPGNLKSLQTLLLFHIIPNRIGSGEWPEG-LSGDPTHSTLSNDRLRLESKGS  160

Query  513  NLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             +    R V  A VV  D V+RPDG+IHGIER+LIP
Sbjct  161  GV----RSVDLAAVVQPDAVLRPDGVIHGIERLLIP  192



>emb|CDY57989.1| BnaA10g30360D [Brassica napus]
Length=457

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 120/157 (76%), Gaps = 13/157 (8%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S   QINSNSVLVALLDS YTELSELVEKALLLQTLEEAV RHNITIFAPRNEALER+LD
Sbjct  36   SGSGQINSNSVLVALLDSRYTELSELVEKALLLQTLEEAVGRHNITIFAPRNEALERELD  95

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWP-ENSRRG-----GRNHITLCRDAGG  509
            PEFKRFLL+PGNL+SLQ LL+FH+IP R+ S+ WP E S R      G +H+ L    G 
Sbjct  96   PEFKRFLLEPGNLKSLQTLLMFHIIPNRVGSEQWPKEESGRVKHDTLGNDHVHLINGDG-  154

Query  510  ENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  ++ V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  155  ------KKMVDSAEIIRPDDLTRPDGLIHGIERLLIP  185



>ref|NP_566398.1| FASCICLIN-like arabinogalactan protein 18 precursor [Arabidopsis 
thaliana]
 sp|Q93W32.1|FLA18_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 18; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07046.1| unknown protein [Arabidopsis thaliana]
 gb|AAL24265.1| AT3g11700/T19F11_10 [Arabidopsis thaliana]
 gb|AAM91728.1| unknown protein [Arabidopsis thaliana]
 gb|AEE75085.1| FASCICLIN-like arabinogalactan protein 18 precursor [Arabidopsis 
thaliana]
Length=462

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 122/165 (74%), Gaps = 11/165 (7%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            E+   N++   QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV RHNITIFAPRNE
Sbjct  27   ESGHHNITGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNE  86

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA-  503
            ALERDLDP+FKRFLLQPGNL+SLQ LLL H+IP R+ S  WPE +  G   H+TL  D  
Sbjct  87   ALERDLDPDFKRFLLQPGNLKSLQTLLLSHIIPKRVGSNQWPEEN-SGRVKHVTLGHDQV  145

Query  504  ------GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                   G N    +R V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  146  LHLSKLKGTN---GKRLVNSAVITRPDDLTRPDGLIHGIERLLIP  187



>ref|XP_006297639.1| hypothetical protein CARUB_v10013670mg [Capsella rubella]
 gb|EOA30537.1| hypothetical protein CARUB_v10013670mg [Capsella rubella]
Length=457

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 121/161 (75%), Gaps = 13/161 (8%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N++   QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV RHNITIFAPRNEALERD
Sbjct  29   NVTGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNEALERD  88

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWP-ENSRRGGRNHITLCRDA-----  503
            LDP+FKRFLLQPGNL+SLQ LLL H+IP R+ S  WP ENS R    H+TL  D      
Sbjct  89   LDPDFKRFLLQPGNLKSLQTLLLSHIIPKRVASNQWPDENSGR--VKHVTLGNDQVLHLT  146

Query  504  --GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               G N    +R V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  147  QLKGTN---GKRLVNSAVITRPDDLTRPDGLIHGIERLLIP  184



>ref|XP_006399110.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
 gb|ESQ40563.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
Length=438

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 126/164 (77%), Gaps = 12/164 (7%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            +NP+ +  SG QINSNSVLVALLDS YTELSELVEKALLL+TLE+AV RHNITIFAPRNE
Sbjct  30   KNPNPSSGSG-QINSNSVLVALLDSRYTELSELVEKALLLETLEDAVGRHNITIFAPRNE  88

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWP-ENSRRG-----GRNHIT  488
            ALERDLDP FKRFLL+PGNL+SLQ LL+FH+IP R+ S  WP E+S R      G +H+ 
Sbjct  89   ALERDLDPGFKRFLLEPGNLKSLQTLLMFHIIPNRVGSDQWPSEDSGRVKHHTLGNDHVH  148

Query  489  LCRDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            L +       V  ++ V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  149  LSKTK-----VDGKKMVDSAEIIRPDDLTRPDGLIHGIERLLIP  187



>ref|XP_010058812.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Eucalyptus 
grandis]
 gb|KCW90414.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
 gb|KCW90415.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=439

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 120/157 (76%), Gaps = 11/157 (7%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            ++GAQINSNSVLVALLDSHYTEL+ELVEKALLLQ+LE+AV RHN+TIFAPRNEALERDLD
Sbjct  34   ATGAQINSNSVLVALLDSHYTELAELVEKALLLQSLEDAVGRHNLTIFAPRNEALERDLD  93

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD------AGG  509
            PEF+RFLL+P NLRSLQ LLL H++P R+ S  WP    R  R H TL  D      A G
Sbjct  94   PEFRRFLLEPRNLRSLQTLLLSHIVPARLGSPQWPLPDSRPAR-HPTLGSDPVHLSVAPG  152

Query  510  ENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              L      V  A+VV  DDVVRPDG+IHGI+R+LIP
Sbjct  153  SGLPA----VDSAEVVRPDDVVRPDGVIHGIQRLLIP  185



>ref|XP_010263095.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Nelumbo 
nucifera]
Length=470

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/168 (64%), Positives = 126/168 (75%), Gaps = 17/168 (10%)
 Frame = +3

Query  147  ENPSRNLSS---GAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAP  317
            ENPS   SS     QINSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HNITIFAP
Sbjct  29   ENPSLKPSSPSNSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNITIFAP  88

Query  318  RNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRG------GRN  479
            RNEALER+LDPEFKRFLL+PGNL+SLQ LLLFH+IP RI S+ WP+ S           +
Sbjct  89   RNEALERELDPEFKRFLLEPGNLKSLQTLLLFHIIPKRIGSEKWPKLSAESVHHQTLSNH  148

Query  480  HITL-CRDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            H+ L C+D+        ++ V  A V+  D VVRPDG+IHGIER+L+P
Sbjct  149  HLHLTCKDS-------DKKIVDLATVIHPDAVVRPDGVIHGIERLLVP  189



>ref|XP_003521503.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
Length=453

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 120/158 (76%), Gaps = 9/158 (6%)
 Frame = +3

Query  156  SRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALE  335
            S N ++ AQINSNS+LVALLDSHYTEL+ELVEKALLLQ LE+AV  HNITIFAPRN+ALE
Sbjct  32   SHNSTTSAQINSNSILVALLDSHYTELAELVEKALLLQQLEDAVGNHNITIFAPRNQALE  91

Query  336  RDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENS---RRGGRNHITLCRDAG  506
            RDLDPEFKRFLL+P NLRSLQ LL+ H++PTRI S HWP      R    +H+ L     
Sbjct  92   RDLDPEFKRFLLEPRNLRSLQTLLMSHILPTRIASHHWPAADLLHRTLSDHHLHLASKPS  151

Query  507  GENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            G      +R V  A+++  DDV+RPDG+IHGIER+++P
Sbjct  152  G------QRTVDSAEILRADDVLRPDGVIHGIERLIVP  183



>ref|XP_009387789.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 119/156 (76%), Gaps = 11/156 (7%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            SSG QINSNSVLVALLDSHYTEL+ELVEKALLL +LE AV RHN+TIFAPRNEALERDLD
Sbjct  39   SSGGQINSNSVLVALLDSHYTELAELVEKALLLPSLEAAVGRHNLTIFAPRNEALERDLD  98

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-----AGGE  512
            PEFKRFLL+PGNLRSLQ LLL+H++P RI S+ WP++       H TL  D     + GE
Sbjct  99   PEFKRFLLEPGNLRSLQTLLLYHVVPARIPSEAWPQS------RHPTLAGDHIHLSSSGE  152

Query  513  NLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  + V  A VV  D VVRPDG+IHGIER+L+P
Sbjct  153  GSSGGGKTVGLAAVVQPDAVVRPDGVIHGIERLLVP  188



>ref|XP_010464900.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Camelina 
sativa]
Length=462

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 122/170 (72%), Gaps = 19/170 (11%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            E+   N++   QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV RHNITIFAPRNE
Sbjct  27   ESGHHNVTGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNE  86

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD--  500
            ALERDLDP+FKRFLLQPGNL+SLQ LLL H+IP R+ S  WPE +  G   H+TL  D  
Sbjct  87   ALERDLDPDFKRFLLQPGNLKSLQTLLLSHIIPKRVGSNEWPEEN-SGRVKHVTLGNDQV  145

Query  501  ----------AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                       GG+ LV S      A +   DD+ RPDG+IHGIER+LIP
Sbjct  146  LHLSKLKGTNGGGKRLVNS------AVITRPDDLTRPDGLIHGIERLLIP  189



>ref|XP_010497995.1| PREDICTED: fasciclin-like arabinogalactan protein 18 isoform 
X1 [Camelina sativa]
 ref|XP_010498004.1| PREDICTED: fasciclin-like arabinogalactan protein 18 isoform 
X2 [Camelina sativa]
Length=469

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 120/165 (73%), Gaps = 19/165 (12%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N++   QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV RHNITIFAPRNEALERD
Sbjct  39   NVTGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNEALERD  98

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-------  500
            LDP+FKRFLLQPGNL+SLQ LLL H+IP R+ S  WPE +  G   H+TL  D       
Sbjct  99   LDPDFKRFLLQPGNLKSLQTLLLSHIIPKRVGSNQWPEEN-SGRVKHVTLGNDQVLHLSK  157

Query  501  -----AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  GG+ LV S      A +   DD+ RPDG+IHGIER+LIP
Sbjct  158  LKGTNGGGKRLVNS------AVITRPDDLARPDGLIHGIERLLIP  196



>ref|XP_006399111.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
 gb|ESQ40564.1| hypothetical protein EUTSA_v10013481mg [Eutrema salsugineum]
Length=460

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 126/164 (77%), Gaps = 12/164 (7%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            +NP+ +  SG QINSNSVLVALLDS YTELSELVEKALLL+TLE+AV RHNITIFAPRNE
Sbjct  30   KNPNPSSGSG-QINSNSVLVALLDSRYTELSELVEKALLLETLEDAVGRHNITIFAPRNE  88

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWP-ENSRRG-----GRNHIT  488
            ALERDLDP FKRFLL+PGNL+SLQ LL+FH+IP R+ S  WP E+S R      G +H+ 
Sbjct  89   ALERDLDPGFKRFLLEPGNLKSLQTLLMFHIIPNRVGSDQWPSEDSGRVKHHTLGNDHVH  148

Query  489  LCRDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            L +       V  ++ V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  149  LSKTK-----VDGKKMVDSAEIIRPDDLTRPDGLIHGIERLLIP  187



>gb|ABV27486.1| fasciclin-like arabinogalactan protein 15 [Gossypium hirsutum]
Length=460

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 124/167 (74%), Gaps = 16/167 (10%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
             EN S  + SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEE V +HNITIFAP+N
Sbjct  29   QENSSATVRSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEETVGKHNITIFAPKN  87

Query  324  EALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCR--  497
            EALERDLDPEFKRFLL+PGNL+SLQ LLL+H++P RI+   WP+ S     +H TL    
Sbjct  88   EALERDLDPEFKRFLLEPGNLKSLQTLLLYHIVPARIDRHSWPK-STSALTHHFTLSNER  146

Query  498  ------DAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  D+ GE  + S      AKV+S + V RPDG+IHGIE++LIP
Sbjct  147  VELSGDDSSGEKFIGS------AKVISSNAVDRPDGVIHGIEQLLIP  187



>gb|KCW90412.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=463

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 120/157 (76%), Gaps = 11/157 (7%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            ++GAQINSNSVLVALLDSHYTEL+ELVEKALLLQ+LE+AV RHN+TIFAPRNEALERDLD
Sbjct  34   ATGAQINSNSVLVALLDSHYTELAELVEKALLLQSLEDAVGRHNLTIFAPRNEALERDLD  93

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD------AGG  509
            PEF+RFLL+P NLRSLQ LLL H++P R+ S  WP    R  R H TL  D      A G
Sbjct  94   PEFRRFLLEPRNLRSLQTLLLSHIVPARLGSPQWPLPDSRPAR-HPTLGSDPVHLSVAPG  152

Query  510  ENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              L      V  A+VV  DDVVRPDG+IHGI+R+LIP
Sbjct  153  SGLPA----VDSAEVVRPDDVVRPDGVIHGIQRLLIP  185



>ref|NP_196257.2| fasciclin-like arabinogalactan protein 17 precursor [Arabidopsis 
thaliana]
 sp|Q66GR0.1|FLA17_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 17; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAU05465.1| At5g06390 [Arabidopsis thaliana]
 gb|AAV74247.1| At5g06390 [Arabidopsis thaliana]
 gb|AED91009.1| fasciclin-like arabinogalactan protein 17 precursor [Arabidopsis 
thaliana]
Length=458

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 138/189 (73%), Gaps = 4/189 (2%)
 Frame = +3

Query  57   MDAQIFGlskllcfsvfllvfglvggaalHENPSRNLSSGAQINSNSVLVALLDSHYTEL  236
            MD +I+G S ++   +F  V      +AL +N S +  SG QINSNSVLVALLDS YTEL
Sbjct  1    MDRRIYGGSAVIHLFLFFSVLIFSAASALSKNQSPSSGSG-QINSNSVLVALLDSRYTEL  59

Query  237  SELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLLFH  416
            +ELVEKALLLQTLE+AV RHNITIFAPRNEALERDLDPEFKRFLL+PGNL+SLQ LL+FH
Sbjct  60   AELVEKALLLQTLEDAVGRHNITIFAPRNEALERDLDPEFKRFLLEPGNLKSLQTLLMFH  119

Query  417  MIPTRIESKHWPENSRRGGR-NHITLCRDAGGENLVVSEREVSGAKVVSLDDVVRPDGII  593
            +IP R+ S  WP  S   GR  H TL  D    +    ++ V  A+++  DD+ RPDG+I
Sbjct  120  IIPNRVGSNQWP--SEESGRVKHHTLGNDQVRLSNGQGKKMVDLAEIIRPDDLTRPDGLI  177

Query  594  HGIERVLIP  620
            HGIER+LIP
Sbjct  178  HGIERLLIP  186



>ref|XP_009146690.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Brassica 
rapa]
Length=456

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 124/159 (78%), Gaps = 10/159 (6%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N +   QINSNSVLVALLDSHYTEL+ELVEKALLLQ LE+AV RHNITIFAPRNEALERD
Sbjct  29   NKTGSGQINSNSVLVALLDSHYTELAELVEKALLLQKLEDAVGRHNITIFAPRNEALERD  88

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDP+FKRFLLQPGNL+SLQ LLL H++PTR+ S  WPE +  G   H+TL  D   + L 
Sbjct  89   LDPDFKRFLLQPGNLKSLQTLLLSHIVPTRVGSNQWPEEN-SGRVKHLTLGSD---QVLH  144

Query  522  VSEREVSGAKVVSL------DDVVRPDGIIHGIERVLIP  620
            +S+ + +G ++V+       DD+ RPDG+IHGIER+LIP
Sbjct  145  LSKTKGNGKRLVNSAVITRPDDLTRPDGLIHGIERLLIP  183



>gb|KJB73327.1| hypothetical protein B456_011G228300 [Gossypium raimondii]
Length=443

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 124/167 (74%), Gaps = 16/167 (10%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
             EN S  + SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEE V +HNITIFAP+N
Sbjct  29   QENSSATVRSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEETVGKHNITIFAPKN  87

Query  324  EALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCR--  497
            EALERDLDPEFKRFLL+PGNL+SLQ LLL+H++P RI+   WP+ S     +H TL    
Sbjct  88   EALERDLDPEFKRFLLEPGNLKSLQTLLLYHIVPARIDRHSWPK-STSALTHHFTLSNER  146

Query  498  ------DAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  D+ GE  + S      AKV+S + V RPDG+IHGIE++LIP
Sbjct  147  VELSGDDSSGEKFIGS------AKVISPNAVDRPDGVIHGIEQLLIP  187



>ref|XP_009121226.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Brassica 
rapa]
Length=464

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 121/161 (75%), Gaps = 13/161 (8%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N++   QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV RHNITIFAPRNEALERD
Sbjct  34   NITGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNEALERD  93

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHIT--------LCR  497
            LDP FKRFLLQPGNL+SLQ LLL H+IPTR+ S  WPE S +  + H+T        L +
Sbjct  94   LDPGFKRFLLQPGNLKSLQTLLLSHIIPTRVGSTQWPEESSKRVK-HVTLGHGQVLHLSK  152

Query  498  DAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              G  N +V    V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  153  TKGNVNRLV----VNSAVITRPDDLTRPDGLIHGIERLLIP  189



>dbj|BAB08961.1| unnamed protein product [Arabidopsis thaliana]
Length=465

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 138/189 (73%), Gaps = 4/189 (2%)
 Frame = +3

Query  57   MDAQIFGlskllcfsvfllvfglvggaalHENPSRNLSSGAQINSNSVLVALLDSHYTEL  236
            MD +I+G S ++   +F  V      +AL +N S +  SG QINSNSVLVALLDS YTEL
Sbjct  1    MDRRIYGGSAVIHLFLFFSVLIFSAASALSKNQSPSSGSG-QINSNSVLVALLDSRYTEL  59

Query  237  SELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLLFH  416
            +ELVEKALLLQTLE+AV RHNITIFAPRNEALERDLDPEFKRFLL+PGNL+SLQ LL+FH
Sbjct  60   AELVEKALLLQTLEDAVGRHNITIFAPRNEALERDLDPEFKRFLLEPGNLKSLQTLLMFH  119

Query  417  MIPTRIESKHWPENSRRGGR-NHITLCRDAGGENLVVSEREVSGAKVVSLDDVVRPDGII  593
            +IP R+ S  WP  S   GR  H TL  D    +    ++ V  A+++  DD+ RPDG+I
Sbjct  120  IIPNRVGSNQWP--SEESGRVKHHTLGNDQVRLSNGQGKKMVDLAEIIRPDDLTRPDGLI  177

Query  594  HGIERVLIP  620
            HGIER+LIP
Sbjct  178  HGIERLLIP  186



>ref|XP_002315410.2| hypothetical protein POPTR_0010s25110g [Populus trichocarpa]
 gb|EEF01581.2| hypothetical protein POPTR_0010s25110g [Populus trichocarpa]
Length=439

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 125/165 (76%), Gaps = 19/165 (12%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            EN S    SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HNITIFAP+NE
Sbjct  31   ENHSNGTYSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNITIFAPKNE  89

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD--  500
            ALERDLDPEFKRFLL+PGNL+SLQ LLL+H++P RI   H   NS    ++H TLCRD  
Sbjct  90   ALERDLDPEFKRFLLEPGNLKSLQTLLLYHIVPNRINPSH---NSSL--QHHSTLCRDRV  144

Query  501  -----AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                   GE L+ S      AK++ ++ V RPDG+IHGIER+LIP
Sbjct  145  KLSSQESGEKLIDS------AKIIQVNAVERPDGVIHGIERLLIP  183



>gb|KCW90413.1| hypothetical protein EUGRSUZ_A02551 [Eucalyptus grandis]
Length=462

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 120/157 (76%), Gaps = 11/157 (7%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            ++GAQINSNSVLVALLDSHYTEL+ELVEKALLLQ+LE+AV RHN+TIFAPRNEALERDLD
Sbjct  34   ATGAQINSNSVLVALLDSHYTELAELVEKALLLQSLEDAVGRHNLTIFAPRNEALERDLD  93

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD------AGG  509
            PEF+RFLL+P NLRSLQ LLL H++P R+ S  WP    R  R H TL  D      A G
Sbjct  94   PEFRRFLLEPRNLRSLQTLLLSHIVPARLGSPQWPLPDSRPAR-HPTLGSDPVHLSVAPG  152

Query  510  ENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              L      V  A+VV  DDVVRPDG+IHGI+R+LIP
Sbjct  153  SGLPA----VDSAEVVRPDDVVRPDGVIHGIQRLLIP  185



>gb|KHG10334.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=468

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 124/167 (74%), Gaps = 16/167 (10%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
             EN S  + SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEE V +HNITIFAP+N
Sbjct  28   QENSSATVRSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEETVGKHNITIFAPKN  86

Query  324  EALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCR--  497
            EALERDLDPEFKRFLL+PGNL+SLQ LLL+H++P RI+   WP+ S     +H TL    
Sbjct  87   EALERDLDPEFKRFLLEPGNLKSLQTLLLYHIVPARIDRHSWPK-STSALTHHFTLSNER  145

Query  498  ------DAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  D+ GE  + S      AKV+S + V RPDG+IHGIE++LIP
Sbjct  146  VELSGDDSSGEKFIGS------AKVISSNAVDRPDGVIHGIEQLLIP  186



>ref|XP_008803482.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 17 [Phoenix dactylifera]
Length=465

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 124/163 (76%), Gaps = 8/163 (5%)
 Frame = +3

Query  147  ENP-SRN-LSSGA---QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIF  311
            ENP SR+ L SG+   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV RHN+TIF
Sbjct  30   ENPVSRSTLPSGSGSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGRHNVTIF  89

Query  312  APRNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITL  491
            APRNEALERDLDPEFKRFLL+P NL+SLQ L+LFH+IPTRI S  WP +       H TL
Sbjct  90   APRNEALERDLDPEFKRFLLEPRNLKSLQTLILFHVIPTRIGSDSWPTSEP---ARHRTL  146

Query  492  CRDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              D    +     + V  A VV  D VVRPDG+IHGIER+L+P
Sbjct  147  AADPLHLSGSREAKRVDLAAVVHPDSVVRPDGVIHGIERLLVP  189



>ref|XP_010908912.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Elaeis 
guineensis]
Length=416

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/157 (66%), Positives = 121/157 (77%), Gaps = 15/157 (10%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S   QINSNSVLVALLDSHYTEL+ELVEKALLLQ LE+AV RHN+TIFAPRNEALERDLD
Sbjct  41   SGSGQINSNSVLVALLDSHYTELAELVEKALLLQNLEDAVGRHNVTIFAPRNEALERDLD  100

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWP--ENSRRGGRNHITLCRD----AGG  509
            PEFKRFLL+P NL+SLQ L+LFH+IP+RI S  WP  E++R     H TL  D    +GG
Sbjct  101  PEFKRFLLEPRNLKSLQTLILFHVIPSRISSDSWPISESAR-----HRTLAADHVHLSGG  155

Query  510  ENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                 + ++V  A VV  D V+RPDG+IHGIER+L+P
Sbjct  156  S----AAKQVDIAAVVYPDAVIRPDGVIHGIERLLVP  188



>ref|XP_010045160.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Eucalyptus 
grandis]
 gb|KCW87313.1| hypothetical protein EUGRSUZ_B03801 [Eucalyptus grandis]
 gb|KCW87314.1| hypothetical protein EUGRSUZ_B03801 [Eucalyptus grandis]
Length=480

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 120/153 (78%), Gaps = 9/153 (6%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNS+LVALLDSHYTEL+ELVEKALLLQTLEE V RHNITIFAP+NEALERDLDPEFK
Sbjct  57   QINSNSILVALLDSHYTELAELVEKALLLQTLEETVGRHNITIFAPKNEALERDLDPEFK  116

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPE--NSRRGGRNHITLC----RDAGGENLV  521
             FLL+P NL+SLQ LL+FH++P+RI+S  WPE   S  G R  ++L     R A  E+  
Sbjct  117  SFLLEPRNLKSLQTLLMFHIVPSRIDSADWPEPAPSAAGHREELSLSSHRLRLAKRES--  174

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              EREV  A+V+  D V RPDG+IHGIER+LIP
Sbjct  175  -GEREVDRARVIHADAVARPDGVIHGIERLLIP  206



>gb|KJB73326.1| hypothetical protein B456_011G228300 [Gossypium raimondii]
Length=515

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 124/167 (74%), Gaps = 16/167 (10%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
             EN S  + SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEE V +HNITIFAP+N
Sbjct  84   QENSSATVRSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEETVGKHNITIFAPKN  142

Query  324  EALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCR--  497
            EALERDLDPEFKRFLL+PGNL+SLQ LLL+H++P RI+   WP+ S     +H TL    
Sbjct  143  EALERDLDPEFKRFLLEPGNLKSLQTLLLYHIVPARIDRHSWPK-STSALTHHFTLSNER  201

Query  498  ------DAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  D+ GE  + S      AKV+S + V RPDG+IHGIE++LIP
Sbjct  202  VELSGDDSSGEKFIGS------AKVISPNAVDRPDGVIHGIEQLLIP  242



>ref|XP_006287712.1| hypothetical protein CARUB_v10000921mg [Capsella rubella]
 gb|EOA20610.1| hypothetical protein CARUB_v10000921mg [Capsella rubella]
Length=459

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 120/158 (76%), Gaps = 6/158 (4%)
 Frame = +3

Query  150  NPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEA  329
            NPS   S   QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV  HNITIFAPRNEA
Sbjct  35   NPS---SGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGLHNITIFAPRNEA  91

Query  330  LERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGR-NHITLCRDAG  506
            LERDLDPEFKRFLL+PGNL+SLQ LL+FH+IP R+ S  WP  S   GR  H TL  D  
Sbjct  92   LERDLDPEFKRFLLEPGNLKSLQTLLMFHIIPHRVGSDQWP--SEDSGRVKHPTLGNDQV  149

Query  507  GENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +    ++ V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  150  HLSHGDGKKMVDSAEIIRPDDLTRPDGLIHGIERLLIP  187



>ref|XP_004296276.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Fragaria 
vesca subsp. vesca]
Length=459

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 3/152 (2%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            SS AQINSNSVLVALLDSHY+EL+ELVEKALLLQTLEEAV  HNITIFAPRN+A++RDLD
Sbjct  35   SSAAQINSNSVLVALLDSHYSELAELVEKALLLQTLEEAVGSHNITIFAPRNDAVDRDLD  94

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-AGGENLVV  524
            P+FKR+LL+PGNL+SLQ LLL+H+IPTR+ S  WP  +R     H TL +D      L  
Sbjct  95   PDFKRYLLEPGNLKSLQKLLLYHVIPTRVGSDEWP--TRSASARHQTLSQDHLHLSRLDS  152

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             ++ V  A+V+  D V RPDG+IH IER+LIP
Sbjct  153  GDKAVDLARVIHPDSVTRPDGVIHAIERLLIP  184



>ref|XP_010486838.1| PREDICTED: fasciclin-like arabinogalactan protein 18 [Camelina 
sativa]
Length=461

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 121/170 (71%), Gaps = 19/170 (11%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            E+   N++   QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV RHNITIFAPRNE
Sbjct  26   ESGHHNVTGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNE  85

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD--  500
            ALERDLDP+FKRFLLQPGNL+SLQ LLL H+IP R+ S  WPE +  G   H+TL  D  
Sbjct  86   ALERDLDPDFKRFLLQPGNLKSLQMLLLSHIIPKRVGSNEWPEEN-SGRVKHVTLGNDQV  144

Query  501  ----------AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                       GG  LV S      A +   DD+ RPDG+IHGIER+LIP
Sbjct  145  LHLSKLKGTNGGGRRLVNS------AVITRPDDLTRPDGLIHGIERLLIP  188



>ref|XP_009399002.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 121/167 (72%), Gaps = 26/167 (16%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            SSG QINSNSVLVALLDSHYTEL+ELVEKALLL +LE AV RHN+TIFAPRNEALERDLD
Sbjct  49   SSGGQINSNSVLVALLDSHYTELAELVEKALLLPSLEAAVGRHNLTIFAPRNEALERDLD  108

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD---------  500
            PEFKRFLL+P NLRSLQ LLL+H++P RI S  WP++       H TL  D         
Sbjct  109  PEFKRFLLEPRNLRSLQTLLLYHVVPDRIPSDAWPQS------RHPTLAGDHLHLSSSSS  162

Query  501  ----AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIPSRC  629
                AGG      E++V  A V+  D VVRPDG+IHGIER+L+P RC
Sbjct  163  NGSTAGG------EKKVGHAAVLYPDAVVRPDGVIHGIERLLVP-RC  202



>emb|CDY32082.1| BnaC04g44840D [Brassica napus]
Length=444

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 120/154 (78%), Gaps = 5/154 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N  +  QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAPRN+ALER+
Sbjct  26   NKPTSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPRNDALERN  85

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDP+FK FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + 
Sbjct  86   LDPQFKSFLLEPRNLKSLQSLLMFHILPRRISSPQWPSLS----HHHRTLSNDHVHLTVD  141

Query  522  VSER-EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             + R +V  A++V  DDV+RPDGIIHGIER+LIP
Sbjct  142  TTRRLKVDSAEIVRPDDVIRPDGIIHGIERLLIP  175



>emb|CDY01050.1| BnaC05g41500D [Brassica napus]
Length=463

 Score =   195 bits (496),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 119/160 (74%), Gaps = 12/160 (8%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N +   QINSNSVLVALLDS YTEL+ELVEKALLLQ LE+AV RHNITIFAPRNEALERD
Sbjct  36   NKTGSGQINSNSVLVALLDSRYTELAELVEKALLLQKLEDAVGRHNITIFAPRNEALERD  95

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-------  500
            LDP+FKRFLLQPGNL+SLQ LLL H+IPTR+ S  WPE +  G   H+TL  D       
Sbjct  96   LDPDFKRFLLQPGNLKSLQTLLLSHIIPTRVGSNQWPEEN-SGRVKHLTLGSDQVLHLSK  154

Query  501  AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            A G      +R V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  155  AKGNG----KRLVNSAVITRPDDLTRPDGLIHGIERLLIP  190



>ref|XP_010938934.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 17 [Elaeis guineensis]
Length=468

 Score =   195 bits (495),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 115/147 (78%), Gaps = 3/147 (2%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV RHN+TIFAPRNEALERDLDPEFK
Sbjct  49   QINSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGRHNVTIFAPRNEALERDLDPEFK  108

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREV  539
            RFLL+P NL+SLQ L+LFH+IPTRI S  WP +       H TL  D    +   + + V
Sbjct  109  RFLLEPRNLKSLQTLILFHVIPTRIGSDSWPPSE---AARHRTLAADHLHLSGSGAAKRV  165

Query  540  SGAKVVSLDDVVRPDGIIHGIERVLIP  620
              A VV  D VVRPDG+IHGIER+L+P
Sbjct  166  DIAAVVHPDAVVRPDGVIHGIERLLVP  192



>emb|CDY40429.1| BnaA04g20880D [Brassica napus]
Length=443

 Score =   194 bits (494),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 120/154 (78%), Gaps = 5/154 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N  +  QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAPRN+ALER+
Sbjct  26   NKPTSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPRNDALERN  85

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDP+FK FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + 
Sbjct  86   LDPQFKSFLLEPRNLKSLQSLLMFHILPRRISSPQWPSLS----HHHRTLSNDHVHLTVD  141

Query  522  VSER-EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             + R +V  A+++  DDV+RPDGIIHGIER+LIP
Sbjct  142  TTRRLKVDSAEIIRPDDVIRPDGIIHGIERLLIP  175



>emb|CDY08502.1| BnaA05g27380D [Brassica napus]
Length=456

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 120/161 (75%), Gaps = 14/161 (9%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N +   QINSNSVLVALLDS YTEL+ELVEKALLLQ LE+AV RHNITIFAPRNEALERD
Sbjct  29   NKTGSGQINSNSVLVALLDSRYTELAELVEKALLLQKLEDAVGRHNITIFAPRNEALERD  88

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWP-ENSRRGGRNHITLCRD------  500
            LDP+FKRFLLQPGNL+SLQ LLL H+IPTR+ S  WP ENS R    H+TL  D      
Sbjct  89   LDPDFKRFLLQPGNLKSLQTLLLSHIIPTRVGSNQWPEENSVR--VKHLTLGSDQVLHLS  146

Query  501  -AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             A G      +R V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  147  KAKGNG----KRLVNSAVITRPDDLTRPDGLIHGIERLLIP  183



>ref|XP_010516833.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=325

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 116/148 (78%), Gaps = 4/148 (3%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNIT FAPRNEALER+LDP F
Sbjct  32   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITTFAPRNEALERNLDPLF  91

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + V+  +
Sbjct  92   KSFLLEPRNLKSLQSLLMFHILPKRITSPQWPSLS----HHHRTLSNDHLHLTVDVNTLK  147

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V  A++V  DDV+RPDGIIHGIER+LIP
Sbjct  148  VDSAELVRPDDVIRPDGIIHGIERLLIP  175



>ref|XP_010553413.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Tarenaya 
hassleriana]
Length=464

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 121/153 (79%), Gaps = 10/153 (7%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNIT+FAPRNEALER+LDPEFK
Sbjct  41   QINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITVFAPRNEALERELDPEFK  100

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWP-ENSRRGGRNHITLCRDAGGENLVVSE--  530
             FLL+P NLRSLQ LL+FH++P RI S  WP E+S  G   H TLC+D    NL+  +  
Sbjct  101  AFLLEPRNLRSLQTLLMFHIVPQRIRSHQWPREDS--GSVRHRTLCKDH--VNLIQFQGP  156

Query  531  ---REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               + +  A+++  DDV+R DGIIHGIE++LIP
Sbjct  157  NRRKMIDSAEIIRPDDVIRTDGIIHGIEKLLIP  189



>ref|XP_002871217.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47476.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=458

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 123/162 (76%), Gaps = 10/162 (6%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            +NP+ +  SG QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV RHNITIFAPRNE
Sbjct  31   KNPNPSSGSG-QINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNE  89

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD--  500
            ALERDLDPEFKRFLL+PGNL+SLQ LL+FH+IP R+    WP     G   H TL  D  
Sbjct  90   ALERDLDPEFKRFLLEPGNLKSLQTLLMFHIIPNRVGLDQWPPE-ELGRVKHHTLGNDQV  148

Query  501  --AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              + GE     ++ V  A+++  DD+ RPDG+IHGIER+LIP
Sbjct  149  HLSNGEG----KKMVDLAEIIRPDDLTRPDGLIHGIERLLIP  186



>ref|XP_010525828.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Tarenaya 
hassleriana]
Length=464

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 119/152 (78%), Gaps = 8/152 (5%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNSVLVALLDSHYTE SEL+EKALLLQTLE+AV +HNIT+FAPRNEALER+LDPEF+
Sbjct  42   QINSNSVLVALLDSHYTEFSELIEKALLLQTLEDAVGKHNITVFAPRNEALERELDPEFR  101

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSE---  530
             FLL+P NLRSLQ LL+FH++P RIES  WP +     + H TLC D    NL+  +   
Sbjct  102  AFLLEPRNLRSLQTLLMFHIVPKRIESHQWPRDDSSSAK-HRTLCNDH--VNLIQFDGPN  158

Query  531  --REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              + +  A+++  DDV+RPDGIIHGI+++LIP
Sbjct  159  RRKMIDSAEIIRPDDVIRPDGIIHGIQKLLIP  190



>ref|XP_006348432.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Solanum 
tuberosum]
Length=436

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 120/149 (81%), Gaps = 18/149 (12%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNSVLVALLDSHYTELSELVEKALLLQ LEEAV++HNITIFAPRNEALERDLDPEFK
Sbjct  33   QINSNSVLVALLDSHYTELSELVEKALLLQPLEEAVTKHNITIFAPRNEALERDLDPEFK  92

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREV  539
            RFLL+PGN++SLQNLLLFHM+PTR+ S H         +NH TLC    GE    +ER +
Sbjct  93   RFLLEPGNIKSLQNLLLFHMVPTRLTSWHQ--------KNHTTLCP---GE----AER-L  136

Query  540  SG--AKVVSLDDVVRPDGIIHGIERVLIP  620
            SG    ++  +D+++ DGIIHGI++VLIP
Sbjct  137  SGNMVNIIHPNDIIKSDGIIHGIKKVLIP  165



>ref|XP_004139069.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
 gb|KGN66568.1| hypothetical protein Csa_1G629740 [Cucumis sativus]
Length=466

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 121/162 (75%), Gaps = 13/162 (8%)
 Frame = +3

Query  150  NPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEA  329
            +PS N  S  QINSNSVLVALLDSHYTEL+EL+EKALLLQ LE+AV  HN+TIFAPRNEA
Sbjct  38   SPSAN--SSGQINSNSVLVALLDSHYTELAELIEKALLLQILEDAVGNHNLTIFAPRNEA  95

Query  330  LERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSR----RGGRNHIT-LC  494
            LERDLDPEFKRFLL+P NL+SLQ LL FH+IPTRI S  WP++S     +   NH+  L 
Sbjct  96   LERDLDPEFKRFLLEPRNLKSLQTLLTFHVIPTRIGSTEWPKHSESTRHQTLSNHVLRLT  155

Query  495  RDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              + G      ER V  AKV+  D + RPDG+IHGIER+LIP
Sbjct  156  HHSTG------ERTVDLAKVIQPDAITRPDGVIHGIERLLIP  191



>ref|XP_006407421.1| hypothetical protein EUTSA_v10020679mg [Eutrema salsugineum]
 gb|ESQ48874.1| hypothetical protein EUTSA_v10020679mg [Eutrema salsugineum]
Length=464

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 121/159 (76%), Gaps = 10/159 (6%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            +L+   QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV RHNITIFAPRNEALERD
Sbjct  35   SLNGSGQINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGRHNITIFAPRNEALERD  94

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDP+FKRFLLQPGNL+SLQ LLL H+IP R+ S  WPE +  G   H TL  D   + L 
Sbjct  95   LDPDFKRFLLQPGNLKSLQTLLLSHIIPNRVGSNQWPEEN-SGRVKHATLGHD---QVLH  150

Query  522  VSE------REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +S+      R V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  151  LSKTKGNGIRLVNSAVITRPDDLTRPDGLIHGIERLLIP  189



>ref|XP_002879581.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55840.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=445

 Score =   192 bits (489),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 4/148 (3%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALER+LDP F
Sbjct  32   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNDALERNLDPLF  91

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + V+  +
Sbjct  92   KSFLLEPRNLKSLQSLLMFHILPKRISSPQWPSLS----HHHRTLSNDHLHLTVDVNTLK  147

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V  A+++  DDV+RPDGIIHGIER+LIP
Sbjct  148  VDSAEIIRPDDVIRPDGIIHGIERLLIP  175



>ref|XP_009141525.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brassica 
rapa]
Length=443

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 119/154 (77%), Gaps = 5/154 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N  +  QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAPRN+ALER+
Sbjct  26   NKPTSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPRNDALERN  85

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDP FK FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + 
Sbjct  86   LDPLFKSFLLEPRNLKSLQSLLMFHILPRRISSPQWPSLS----HHHRTLSNDHVHLTVD  141

Query  522  VSER-EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             + R +V  A+++  DDV+RPDGIIHGIER+LIP
Sbjct  142  TTRRLKVDSAEIIRPDDVIRPDGIIHGIERLLIP  175



>ref|XP_010516793.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=445

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 4/153 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N     QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALER+
Sbjct  27   NKPVSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNDALERN  86

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDP FK FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + 
Sbjct  87   LDPLFKSFLLEPRNLKSLQSLLMFHILPKRITSPQWPSLS----HHHRTLSNDHLHLTVD  142

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V+  +V  A++V  DDV+RPDGIIHGIER+LIP
Sbjct  143  VNTLKVDSAELVRPDDVIRPDGIIHGIERLLIP  175



>ref|XP_002270606.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Vitis vinifera]
Length=466

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 116/156 (74%), Gaps = 10/156 (6%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S+  QINSNSVLVALLDS YTEL+ELVEKALLL TLE+AV +HNITIFAPRNEALERDLD
Sbjct  42   SNSPQINSNSVLVALLDSRYTELAELVEKALLLPTLEDAVGKHNITIFAPRNEALERDLD  101

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-----AGGE  512
            PEFKRFLL+PGNLRSLQ LLLFH+IP RI S  WP     G   H TL  D     + G 
Sbjct  102  PEFKRFLLEPGNLRSLQTLLLFHIIPNRIGSGEWP-GGLAGDPTHGTLSNDRLSLASKGS  160

Query  513  NLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             +    + V  A VV  D +VRPDG+IHGIER+LIP
Sbjct  161  GV----KSVDLAAVVHPDAIVRPDGVIHGIERLLIP  192



>ref|XP_009133050.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brassica 
rapa]
Length=446

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 120/159 (75%), Gaps = 9/159 (6%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            P+    SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAPRN+AL
Sbjct  24   PATKPVSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPRNDAL  82

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENS---RRGGRNHITLCRDA  503
            ER+LDP FK FLL+P NL+SLQ LL+FH++P R+ S  WP  S   R    +H+ L  DA
Sbjct  83   ERNLDPLFKSFLLEPRNLKSLQTLLMFHILPRRVSSPQWPSLSHYHRTLSNDHVHLTVDA  142

Query  504  GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                L     +V  A+++  DDV+RPDGIIHGIER+LIP
Sbjct  143  PTLRL-----KVDSAEIIRPDDVIRPDGIIHGIERLLIP  176



>ref|NP_850253.1| fasciclin-like arabinogalactan protein 16 [Arabidopsis thaliana]
 sp|Q8RWC5.1|FLA16_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 16; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAM13188.1| unknown protein [Arabidopsis thaliana]
 gb|AAP31934.1| At2g35860 [Arabidopsis thaliana]
 gb|AEC09172.1| fasciclin-like arabinogalactan protein 16 [Arabidopsis thaliana]
Length=445

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 4/148 (3%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALER+LDP F
Sbjct  32   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNDALERNLDPLF  91

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + V+  +
Sbjct  92   KSFLLEPRNLKSLQSLLMFHILPKRITSPQWPSLS----HHHRTLSNDHLHLTVDVNTLK  147

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V  A+++  DDV+RPDGIIHGIER+LIP
Sbjct  148  VDSAEIIRPDDVIRPDGIIHGIERLLIP  175



>ref|XP_010509549.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=445

 Score =   192 bits (488),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 4/153 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N     QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALER+
Sbjct  27   NKPVSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNDALERN  86

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDP FK FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + 
Sbjct  87   LDPLFKSFLLEPRNLKSLQSLLMFHILPKRITSPQWPSLS----HHHRTLSNDHLHLTVD  142

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V+  +V  A++V  DDV+RPDGIIHGIER+LIP
Sbjct  143  VNTLKVDSAELVRPDDVIRPDGIIHGIERLLIP  175



>ref|XP_006388929.1| hypothetical protein POPTR_0073s00210g [Populus trichocarpa]
 gb|ERP47843.1| hypothetical protein POPTR_0073s00210g [Populus trichocarpa]
Length=361

 Score =   190 bits (482),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 125/165 (76%), Gaps = 19/165 (12%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            EN S    SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HNITIFAP+NE
Sbjct  45   ENHSNGTYSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNITIFAPKNE  103

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD--  500
            ALERDLDPEF+RFLL+PGNL+SLQ LLL+H++P RI   H   NS    +++ TLCRD  
Sbjct  104  ALERDLDPEFQRFLLEPGNLKSLQTLLLYHIVPNRINPSH---NSSL--QHNSTLCRDRV  158

Query  501  -----AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                   GE L+ S      AK++ ++ V RPDG+IHGI+R+LIP
Sbjct  159  KLSSQESGEKLIDS------AKIIQVNAVERPDGVIHGIKRLLIP  197



>gb|AAD21471.1| unknown protein [Arabidopsis thaliana]
Length=475

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 117/148 (79%), Gaps = 4/148 (3%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALER+LDP F
Sbjct  32   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNDALERNLDPLF  91

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + V+  +
Sbjct  92   KSFLLEPRNLKSLQSLLMFHILPKRITSPQWPSLS----HHHRTLSNDHLHLTVDVNTLK  147

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V  A+++  DDV+RPDGIIHGIER+LIP
Sbjct  148  VDSAEIIRPDDVIRPDGIIHGIERLLIP  175



>emb|CDX84594.1| BnaA03g16360D [Brassica napus]
Length=446

 Score =   192 bits (487),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 120/159 (75%), Gaps = 9/159 (6%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            P+    SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAPRN+AL
Sbjct  24   PATKPVSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPRNDAL  82

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENS---RRGGRNHITLCRDA  503
            ER+LDP FK FLL+P NL+SLQ LL+FH++P R+ S  WP  S   R    +H+ L  DA
Sbjct  83   ERNLDPLFKSFLLEPRNLKSLQTLLMFHILPRRVSSPQWPSLSHHHRTLSNDHVHLTVDA  142

Query  504  GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                L     +V  A+++  DDV+RPDGIIHGIER+LIP
Sbjct  143  PTLRL-----KVDSAEIIRPDDVIRPDGIIHGIERLLIP  176



>ref|XP_008450315.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Cucumis 
melo]
 ref|XP_008450316.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Cucumis 
melo]
Length=466

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 121/162 (75%), Gaps = 13/162 (8%)
 Frame = +3

Query  150  NPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEA  329
            +PS N  S  QINSNSVLVALLDSHYTEL+EL+EKALLLQ LE+AV  HN+TIFAPRNEA
Sbjct  38   SPSAN--SSGQINSNSVLVALLDSHYTELAELIEKALLLQILEDAVGNHNLTIFAPRNEA  95

Query  330  LERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSR----RGGRNHIT-LC  494
            LERDLDPEFKRFLL+P NL+SLQ+LL FH+IPTRI S  WP++S     +   NH+  L 
Sbjct  96   LERDLDPEFKRFLLEPRNLKSLQSLLTFHVIPTRIGSTEWPKHSESTRHQTLSNHVLRLT  155

Query  495  RDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                G      ER V  AKV+  D + RPDG+IHGIER+LIP
Sbjct  156  HHRTG------ERTVDLAKVIQPDAITRPDGVIHGIERLLIP  191



>ref|XP_011024125.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
 ref|XP_011024126.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=459

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 123/165 (75%), Gaps = 19/165 (12%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            EN S    SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HNITIFAP+NE
Sbjct  31   ENHSNGTYSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNITIFAPKNE  89

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA-  503
            ALERDLDPEFKRFLL+PGNL+SLQ LLL+H++P RI   H   NS    ++H TL RD  
Sbjct  90   ALERDLDPEFKRFLLEPGNLKSLQTLLLYHVVPNRINVSH---NSSL--QHHSTLSRDGV  144

Query  504  ------GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                   GE L+ S      AK++  + V RPDG+IHGIER+LIP
Sbjct  145  KLSSQESGEKLIDS------AKIIQANAVERPDGVIHGIERLLIP  183



>ref|XP_010505110.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Camelina 
sativa]
Length=492

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 118/153 (77%), Gaps = 4/153 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N     QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALER+
Sbjct  74   NKPVSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNDALERN  133

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDP FK FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + 
Sbjct  134  LDPLFKSFLLEPRNLKSLQSLLMFHILPKRITSPQWPSLS----HHHRTLSNDHLHLTVD  189

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V+  +V  A++V  DDV+RPDGIIHGIER+LIP
Sbjct  190  VNTLKVDSAELVRPDDVIRPDGIIHGIERLLIP  222



>emb|CDX79631.1| BnaC03g19670D [Brassica napus]
Length=446

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 115/151 (76%), Gaps = 8/151 (5%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAPRN+ALER+LDP F
Sbjct  31   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPRNDALERNLDPLF  90

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENS---RRGGRNHITLCRDAGGENLVVS  527
            K FLL+P NL+SLQ LL+FH++P R+ S  WP  S   R    +H+ L  DA    L   
Sbjct  91   KSFLLEPRNLKSLQTLLMFHILPRRVSSPQWPSLSHHHRTLSNDHVHLTVDAPTLRL---  147

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +V  A ++  DDV+RPDGIIHGIER+LIP
Sbjct  148  --KVDSADIIRPDDVIRPDGIIHGIERLLIP  176



>ref|XP_006379435.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57232.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
Length=440

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 116/153 (76%), Gaps = 5/153 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N S   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HNITIFAPRNEALERD
Sbjct  40   NGSYSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNITIFAPRNEALERD  99

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDPEFKRFLL+PGNL+SLQ LLL+H++P RI              +H TLCRD       
Sbjct  100  LDPEFKRFLLEPGNLKSLQTLLLYHIVPNRINLS-----HNSSLHHHSTLCRDRIKLGSQ  154

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              E+ +  AK++ ++ V RPDG+IHGIER+LIP
Sbjct  155  SGEKLIDSAKIIQVNAVERPDGVIHGIERLLIP  187



>ref|XP_006379436.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 ref|XP_006379437.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 ref|XP_002311924.2| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57233.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|ERP57234.1| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
 gb|EEE89291.2| hypothetical protein POPTR_0008s013101g, partial [Populus trichocarpa]
Length=439

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 116/153 (76%), Gaps = 5/153 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N S   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HNITIFAPRNEALERD
Sbjct  40   NGSYSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNITIFAPRNEALERD  99

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDPEFKRFLL+PGNL+SLQ LLL+H++P RI              +H TLCRD       
Sbjct  100  LDPEFKRFLLEPGNLKSLQTLLLYHIVPNRINLS-----HNSSLHHHSTLCRDRIKLGSQ  154

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              E+ +  AK++ ++ V RPDG+IHGIER+LIP
Sbjct  155  SGEKLIDSAKIIQVNAVERPDGVIHGIERLLIP  187



>ref|XP_010534382.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=468

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 120/153 (78%), Gaps = 11/153 (7%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNSVLVALLDS YTEL+ELVEKALLLQTLE+AV +HNITIFAPRNEALER+LDPEFK
Sbjct  43   QINSNSVLVALLDSRYTELAELVEKALLLQTLEDAVGQHNITIFAPRNEALERELDPEFK  102

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS----  527
            RFLL+PGNL+SLQ LL+FH++P R+ S  WP+      R H TL    G +N+ ++    
Sbjct  103  RFLLEPGNLKSLQTLLMFHILPKRVGSHQWPDQDSDRIR-HETL----GEDNVRLTRTEK  157

Query  528  --EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +R V  A+V+  DDV RPDG+IHGIER+LIP
Sbjct  158  NGKRMVDSAEVIRPDDVTRPDGVIHGIERLLIP  190



>ref|XP_011032963.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Populus 
euphratica]
Length=463

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 115/153 (75%), Gaps = 5/153 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N S   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HNITIFAPRNEALERD
Sbjct  40   NGSYSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNITIFAPRNEALERD  99

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDPEFKRFLL+PGNL+SLQ LLL+H++P RI   H             TLCRD       
Sbjct  100  LDPEFKRFLLEPGNLKSLQTLLLYHIVPNRINLSHNSSLHHH-----STLCRDRIKLGSQ  154

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              E+ +  AK++ ++ V RPDG+IHGIER+LIP
Sbjct  155  SGEKLIDSAKIIQVNAVERPDGVIHGIERLLIP  187



>ref|XP_006294220.1| hypothetical protein CARUB_v10023217mg [Capsella rubella]
 gb|EOA27118.1| hypothetical protein CARUB_v10023217mg [Capsella rubella]
Length=445

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 117/153 (76%), Gaps = 4/153 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N     QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALER+
Sbjct  27   NKPVSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNDALERN  86

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDP FK FLL+P NL+SLQ+LL+FH++P RI S  WP  S     +H TL  D     + 
Sbjct  87   LDPLFKSFLLEPRNLKSLQSLLMFHILPKRISSPQWPSLS----HHHRTLSNDHLHLTVD  142

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             +  +V  A++V  DDV+RPDGIIHGIER+LIP
Sbjct  143  ANTLKVDSAELVRPDDVIRPDGIIHGIERLLIP  175



>ref|XP_006410756.1| hypothetical protein EUTSA_v10016656mg [Eutrema salsugineum]
 gb|ESQ52209.1| hypothetical protein EUTSA_v10016656mg [Eutrema salsugineum]
Length=446

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/159 (65%), Positives = 120/159 (75%), Gaps = 9/159 (6%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            P     SG QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV RHNITIFAPRN+AL
Sbjct  24   PETKPGSG-QINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGRHNITIFAPRNDAL  82

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENS---RRGGRNHITLCRDA  503
            ER+LDP FK FLL+P NL+SLQ+LLLFH++P RI S  WP  S   R    +H+ L  D+
Sbjct  83   ERNLDPLFKSFLLEPRNLKSLQSLLLFHILPRRITSPQWPSLSHHHRTLSNDHLHLTVDS  142

Query  504  GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                L     +V  A+++  DDV+RPDGIIHGIER+LIP
Sbjct  143  PTLRL-----KVDSAEIIRPDDVIRPDGIIHGIERLLIP  176



>ref|XP_008798695.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Phoenix 
dactylifera]
Length=464

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 123/162 (76%), Gaps = 15/162 (9%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            P+   +   QINSNS+LVALLDSHYTEL+ELVEKALLLQTLE+AV RHN+TIFAPRNEAL
Sbjct  36   PTLPSNGSGQINSNSILVALLDSHYTELAELVEKALLLQTLEDAVGRHNVTIFAPRNEAL  95

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWP--ENSRRGGRNHITLCRD--  500
            ERDL+PEFKRFLL+P NL+SLQ L+LFH+IP+RI S  WP  E++R     H TL  D  
Sbjct  96   ERDLEPEFKRFLLEPRNLKSLQTLILFHVIPSRIGSDSWPTFESAR-----HRTLSADHV  150

Query  501  --AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +GG     + + V  A VV  D VVRPDG+IHGIER+L+P
Sbjct  151  HLSGGG----AAKLVDLAAVVHPDAVVRPDGVIHGIERLLVP  188



>gb|KHG00930.1| Fasciclin-like arabinogalactan protein 17 [Gossypium arboreum]
Length=434

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 120/154 (78%), Gaps = 11/154 (7%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QI+SNSVLVALLDSHYTEL+ELVEKALLLQ+LEE+V +HNITIFAP+NEALER+LDPEF
Sbjct  36   GQISSNSVLVALLDSHYTELAELVEKALLLQSLEESVGKHNITIFAPKNEALERNLDPEF  95

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            KRFLL+PGNL+SLQ LLL+H++PTRIE   WP NS  G   H TL       N+ +S  +
Sbjct  96   KRFLLEPGNLKSLQTLLLYHIVPTRIEPHSWP-NSTTGSIIHRTLSN----HNVELSSED  150

Query  537  VSG------AKVVSLDDVVRPDGIIHGIERVLIP  620
              G      AKV++ + V RPDG+IHGIE++LIP
Sbjct  151  SMGVKFIGSAKVINPNAVNRPDGVIHGIEQLLIP  184



>ref|XP_010431275.1| PREDICTED: fasciclin-like arabinogalactan protein 15, partial 
[Camelina sativa]
Length=246

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 114/149 (77%), Gaps = 7/149 (5%)
 Frame = +3

Query  174  GAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPE  353
              QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALE++LDPE
Sbjct  25   SGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGQHNITIFAPRNDALEKNLDPE  84

Query  354  FKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSER  533
            FK FLLQP NL+SLQ+LL+FH++P RI S   P        +H TL  D    +L  +  
Sbjct  85   FKSFLLQPKNLKSLQSLLMFHILPKRITS---PHQFSSAVVSHRTLSND----HLYFTNG  137

Query  534  EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  138  KVNSAVITKPDDLTRPDGVIHGIERLLIP  166



>gb|ABV27487.1| fasciclin-like arabinogalactan protein 16 [Gossypium hirsutum]
Length=457

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 120/154 (78%), Gaps = 11/154 (7%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QI+SNSVLVALLDSHYTEL+ELVEKALLLQ+LEE+V +HNITIFAP+NEALER+LDPEF
Sbjct  36   GQISSNSVLVALLDSHYTELAELVEKALLLQSLEESVGKHNITIFAPKNEALERNLDPEF  95

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            KRFLL+PGNL+SLQ LLL+H++PTRIE   WP NS  G   H TL       N+ +S  +
Sbjct  96   KRFLLEPGNLKSLQTLLLYHIVPTRIEPHSWP-NSTSGSIIHRTLSN----HNVELSSED  150

Query  537  VSG------AKVVSLDDVVRPDGIIHGIERVLIP  620
              G      AKV++ + V RPDG+IHGIE++LIP
Sbjct  151  SMGVKFIGSAKVINPNAVNRPDGVIHGIEQLLIP  184



>tpg|DAA51812.1| TPA: hypothetical protein ZEAMMB73_870378 [Zea mays]
Length=337

 Score =   187 bits (474),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 115/151 (76%), Gaps = 9/151 (6%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            ++   +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALERDLD
Sbjct  43   AAAVGVNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNVTIFAPRNEALERDLD  102

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFKRFLL+P NLRSLQ LLL+H++P+R+ S  WP  S      H TL    G E  + +
Sbjct  103  PEFKRFLLEPRNLRSLQALLLYHVLPSRLPSDSWPAAS------HPTLS---GEEVELGA  153

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               V  A V   D V+RPDG+IHGIER+L+P
Sbjct  154  GMRVGHAAVTRPDAVLRPDGVIHGIERLLVP  184



>gb|KFK36481.1| hypothetical protein AALP_AA4G130300 [Arabis alpina]
Length=447

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 117/154 (76%), Gaps = 5/154 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N     QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAV +HNITIFAP+NEALER+
Sbjct  27   NKPGSGQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVGKHNITIFAPKNEALERN  86

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV  521
            LDP FK FLL+P NL+SLQ+L+LFH++P RI S  WP  S     +H TL  D       
Sbjct  87   LDPLFKSFLLEPRNLKSLQSLILFHILPRRISSPQWPSLS----HHHRTLSNDHLHLTKT  142

Query  522  VSER-EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             + R +V  A+++  DDV+RPDGIIHGIER+LIP
Sbjct  143  PTLRFKVDSAEIIRPDDVIRPDGIIHGIERLLIP  176



>gb|KJB78512.1| hypothetical protein B456_013G003200 [Gossypium raimondii]
Length=457

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 120/154 (78%), Gaps = 11/154 (7%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QI+SNSVLVALLDSHYTEL+ELVEKALLLQ+LEE+V +HNITIFAP+NEALER+LDPEF
Sbjct  36   GQISSNSVLVALLDSHYTELAELVEKALLLQSLEESVGKHNITIFAPKNEALERNLDPEF  95

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            KRFLL+PGNL+SLQ LLL+H++PTRIE   WP NS  G   H TL       N+ +S  +
Sbjct  96   KRFLLEPGNLKSLQTLLLYHIVPTRIEPHSWP-NSTSGSILHRTLSN----HNVELSSED  150

Query  537  VSG------AKVVSLDDVVRPDGIIHGIERVLIP  620
              G      AKV++ + V RPDG+IHGIE++LIP
Sbjct  151  SMGVKFIGSAKVINPNAVNRPDGVIHGIEQLLIP  184



>gb|KDP36078.1| hypothetical protein JCGZ_08722 [Jatropha curcas]
Length=466

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 113/148 (76%), Gaps = 14/148 (9%)
 Frame = +3

Query  198  VLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQP  377
            VLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNEALER LDPEFKRFLL+P
Sbjct  52   VLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNEALERQLDPEFKRFLLEP  111

Query  378  GNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-------AGGENLVVSERE  536
            GNL+SLQ LL+FH+IP R+ S  WP    +  + H TLC D       + G      ++ 
Sbjct  112  GNLKSLQTLLMFHIIPKRVGSSQWPSEKSKPLK-HSTLCNDHLRLISKSSG------KKA  164

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V  A+++  DDV+RPDG+IHGIER+LIP
Sbjct  165  VDSAEIIRPDDVIRPDGVIHGIERLLIP  192



>gb|ABI95409.1| fasciclin-like protein FLA19 [Triticum aestivum]
Length=480

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 116/155 (75%), Gaps = 13/155 (8%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
             SGA +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV RHN+TIFAPRNEALERDLD
Sbjct  54   GSGAGVNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGRHNVTIFAPRNEALERDLD  113

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD----AGGEN  515
            PEFKRFLL+P NL+SLQ LLLFH++P R  +  WP  S      H TL  +    A G N
Sbjct  114  PEFKRFLLEPRNLKSLQTLLLFHVLPARHPAGSWPAAS------HPTLSGEDVELAAGAN  167

Query  516  LVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +    V+ A V   D V+RPDG+IHGIER+L+P
Sbjct  168  GSM---RVAHAAVTRPDAVLRPDGVIHGIERLLVP  199



>emb|CDY23209.1| BnaA04g05500D [Brassica napus]
Length=440

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 116/151 (77%), Gaps = 7/151 (5%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            +   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNEALER+LD
Sbjct  28   TGSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGQHNITIFAPRNEALERNLD  87

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFK FLLQP NL+SLQ LL+FH++P RI S   P+ S     +H +L  D    +L  +
Sbjct  88   PEFKSFLLQPKNLKSLQTLLMFHILPKRITS---PQLSASSVVSHRSLSND----HLHFT  140

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +V+ A +   DDV RPDGIIHGIER+LIP
Sbjct  141  AGKVNSAVITKPDDVTRPDGIIHGIERLLIP  171



>ref|XP_010685475.1| PREDICTED: fasciclin-like arabinogalactan protein 17 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 117/162 (72%), Gaps = 11/162 (7%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            P    S   QINSNSVLVALLDSHYTEL+ELVEKALLLQ LE+ V + NITIFAPRNEAL
Sbjct  28   PKTTSSQPGQINSNSVLVALLDSHYTELAELVEKALLLQKLEDVVGKQNITIFAPRNEAL  87

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGE  512
            ERDLD EFKRFLL+PGNLRSLQ L+L H++P R+ S  WP +  +  + HITL  D    
Sbjct  88   ERDLDAEFKRFLLEPGNLRSLQTLILSHIVPVRVNSDEWPTHENQ-PQKHITLSND----  142

Query  513  NLVVSEREVSGAKVVSL------DDVVRPDGIIHGIERVLIP  620
             + +   + SG K V L      +DVVRPDG+IHGIER+L+P
Sbjct  143  RVHLHTDKKSGQKTVDLTRVIRPNDVVRPDGVIHGIERLLVP  184



>emb|CDX95333.1| BnaC04g28250D [Brassica napus]
Length=440

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 116/151 (77%), Gaps = 7/151 (5%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            +   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNEALER+LD
Sbjct  28   TGSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGQHNITIFAPRNEALERNLD  87

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFK FLLQP NL+SLQ LL+FH++P RI S   P+ S     +H +L  D    +L  +
Sbjct  88   PEFKSFLLQPKNLKSLQTLLMFHILPKRITS---PQLSASSVVSHRSLSND----HLHFT  140

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +V+ A +   DDV RPDGIIHGIER+LIP
Sbjct  141  TGKVNSAVITKPDDVTRPDGIIHGIERLLIP  171



>ref|XP_009139464.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Brassica 
rapa]
Length=440

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 117/151 (77%), Gaps = 7/151 (5%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            +   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNEALER+LD
Sbjct  28   TGSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGQHNITIFAPRNEALERNLD  87

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFK FLLQP NL+SLQ LL+FH++P R+ S   P+ S     +H +L  D    +L ++
Sbjct  88   PEFKSFLLQPKNLKSLQTLLMFHILPKRVTS---PQLSASSVVSHRSLSND----HLHLT  140

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +V+ A +   DDV RPDGIIHGIER+LIP
Sbjct  141  AGKVNSAVITKPDDVTRPDGIIHGIERLLIP  171



>ref|XP_010685474.1| PREDICTED: fasciclin-like arabinogalactan protein 17 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=462

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 117/162 (72%), Gaps = 11/162 (7%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            P    S   QINSNSVLVALLDSHYTEL+ELVEKALLLQ LE+ V + NITIFAPRNEAL
Sbjct  28   PKTTSSQPGQINSNSVLVALLDSHYTELAELVEKALLLQKLEDVVGKQNITIFAPRNEAL  87

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGE  512
            ERDLD EFKRFLL+PGNLRSLQ L+L H++P R+ S  WP +  +  + HITL  D    
Sbjct  88   ERDLDAEFKRFLLEPGNLRSLQTLILSHIVPVRVNSDEWPTHENQ-PQKHITLSND----  142

Query  513  NLVVSEREVSGAKVVSL------DDVVRPDGIIHGIERVLIP  620
             + +   + SG K V L      +DVVRPDG+IHGIER+L+P
Sbjct  143  RVHLHTDKKSGQKTVDLTRVIRPNDVVRPDGVIHGIERLLVP  184



>ref|XP_006403811.1| hypothetical protein EUTSA_v10010381mg [Eutrema salsugineum]
 gb|ESQ45264.1| hypothetical protein EUTSA_v10010381mg [Eutrema salsugineum]
Length=441

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 117/151 (77%), Gaps = 6/151 (4%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            +   QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRNEALER+LD
Sbjct  27   TGSGQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGQHNITIFAPRNEALERNLD  86

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFK FLLQP NL+SLQ+LL+FH++P RI S     +S     +H TL  D    +L  +
Sbjct  87   PEFKSFLLQPKNLKSLQSLLMFHILPKRITSPQLSASS--AVVSHRTLSND----HLHFT  140

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              +V+ A++   DD+ RPDGIIHGIER+LIP
Sbjct  141  AGKVNSAEITRPDDLTRPDGIIHGIERLLIP  171



>gb|KEH24284.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=448

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 116/156 (74%), Gaps = 13/156 (8%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            ++  QINSNS+LVALLDSHYTEL+ELVEKALLLQ LEEAV  HNITIFAPRN+ALERDLD
Sbjct  27   TTTVQINSNSILVALLDSHYTELAELVEKALLLQKLEEAVGNHNITIFAPRNQALERDLD  86

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWP-----ENSRRGGRNHITLCRDAGGE  512
            PEFKRFLL+P NLRSLQ LL+ H++P+RI S HWP      ++    R H+T        
Sbjct  87   PEFKRFLLEPRNLRSLQTLLMSHILPSRIASHHWPPTHLHHHTLSNHRLHLTTNPTGA--  144

Query  513  NLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  + V  A+++  DDV+RPDG+IHGI+R++IP
Sbjct  145  ------KTVDSAEILKPDDVIRPDGVIHGIQRLIIP  174



>ref|NP_001130335.1| uncharacterized protein LOC100191430 precursor [Zea mays]
 gb|ACF78522.1| unknown [Zea mays]
 gb|ACL52516.1| unknown [Zea mays]
 gb|ACL54364.1| unknown [Zea mays]
 gb|ACL54392.1| unknown [Zea mays]
 gb|ACL54585.1| unknown [Zea mays]
 gb|ACL54630.1| unknown [Zea mays]
 gb|ACL54654.1| unknown [Zea mays]
Length=465

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 116/151 (77%), Gaps = 9/151 (6%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            ++   +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALERDLD
Sbjct  43   AAAVGVNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNVTIFAPRNEALERDLD  102

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFKRFLL+P NLRSLQ LLL+H++P+R+ S  WP  S      H TL   +G E  + +
Sbjct  103  PEFKRFLLEPRNLRSLQALLLYHVLPSRLPSDSWPAAS------HPTL---SGEEVELGA  153

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               V  A V   D V+RPDG+IHGIER+L+P
Sbjct  154  GMRVGHAAVTRPDAVLRPDGVIHGIERLLVP  184



>tpg|DAA51813.1| TPA: LOW QUALITY PROTEIN: fasciclin domain protein [Zea mays]
Length=464

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 116/151 (77%), Gaps = 9/151 (6%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            ++   +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALERDLD
Sbjct  43   AAAVGVNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNVTIFAPRNEALERDLD  102

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFKRFLL+P NLRSLQ LLL+H++P+R+ S  WP  S      H TL   +G E  + +
Sbjct  103  PEFKRFLLEPRNLRSLQALLLYHVLPSRLPSDSWPAAS------HPTL---SGEEVELGA  153

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               V  A V   D V+RPDG+IHGIER+L+P
Sbjct  154  GMRVGHAAVTRPDAVLRPDGVIHGIERLLVP  184



>ref|XP_002524094.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38304.1| conserved hypothetical protein [Ricinus communis]
Length=462

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 14/148 (9%)
 Frame = +3

Query  198  VLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQP  377
            VLVALLDSHYTEL+ELVEKALLLQTLEE+V +HNITIFAPRNEALER LDPEFKRFLL+P
Sbjct  47   VLVALLDSHYTELAELVEKALLLQTLEESVGKHNITIFAPRNEALERQLDPEFKRFLLEP  106

Query  378  GNLRSLQNLLLFHMIPTRIESKHWPENSRRG------GRNHITL-CRDAGGENLVVSERE  536
            GNL+SLQ LL+FH+IP R+ S  WP ++           NH+ L  RD+G       ++ 
Sbjct  107  GNLKSLQTLLMFHIIPKRVGSSDWPTDASNPTWHITLSNNHLHLDVRDSG-------KKV  159

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V  A++V  DDV+RPDG+IHGIER+LIP
Sbjct  160  VDSAELVRPDDVIRPDGVIHGIERLLIP  187



>ref|XP_004228680.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Solanum 
lycopersicum]
Length=439

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 120/156 (77%), Gaps = 13/156 (8%)
 Frame = +3

Query  159  RNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALER  338
            +  +   QINSNSVLVALLDSHYTELSELVEKALLLQ LEEAV++HNITIFAPRNEALE 
Sbjct  26   KTQTPSPQINSNSVLVALLDSHYTELSELVEKALLLQPLEEAVTKHNITIFAPRNEALEL  85

Query  339  DLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIE--SKHWPENSRRGGRNHITLCRDAGGE  512
            DLDPEFKRFLL+PGN++SLQNLLLFHM+P R++  S H   N+     NH TLC    GE
Sbjct  86   DLDPEFKRFLLEPGNIKSLQNLLLFHMVPARVDHSSLHHTRNN-----NHTTLCP---GE  137

Query  513  NLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               +S   ++   ++  +D+++ DGIIHGI++VLIP
Sbjct  138  TERLSGNNLN---IIHPNDIIKSDGIIHGIQKVLIP  170



>ref|XP_010515698.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 116/148 (78%), Gaps = 7/148 (5%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALE++LDPEF
Sbjct  26   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGQHNITIFAPRNDALEKNLDPEF  85

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLLQP NL+SLQ+LL+FH++P RI S H   ++     +H TL  D    +L  +  +
Sbjct  86   KSFLLQPKNLKSLQSLLMFHILPKRITSPHQFSSAV---VSHRTLSND----HLYFTNGK  138

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  139  VNSAVITKPDDLTRPDGVIHGIERLLIP  166



>ref|XP_010426853.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 116/148 (78%), Gaps = 7/148 (5%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALE++LDPEF
Sbjct  26   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGQHNITIFAPRNDALEKNLDPEF  85

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLLQP NL+SLQ+LL+FH++P RI S H   ++     +H TL  D    +L  +  +
Sbjct  86   KSFLLQPKNLKSLQSLLMFHILPKRITSPHQFSSAV---VSHRTLSND----HLYFTNGK  138

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  139  VNSAVITKPDDLTRPDGVIHGIERLLIP  166



>gb|ACG39696.1| fasciclin domain [Zea mays]
Length=469

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 117/156 (75%), Gaps = 15/156 (10%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            ++   +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALERDLD
Sbjct  43   AAAVGVNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNVTIFAPRNEALERDLD  102

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFKRFLL+P NLRSLQ LLL+H++P+R+ S  WP  S      H TL     GE + ++
Sbjct  103  PEFKRFLLEPRNLRSLQALLLYHVLPSRLPSDSWPAAS------HPTLS----GEEVELA  152

Query  528  EREVSG-----AKVVSLDDVVRPDGIIHGIERVLIP  620
                +G     A V   D V+RPDG+IHGIER+L+P
Sbjct  153  PAAGAGMRVGHAAVTRPDAVLRPDGVIHGIERLLVP  188



>ref|XP_010503981.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Camelina 
sativa]
Length=435

 Score =   184 bits (467),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 116/148 (78%), Gaps = 7/148 (5%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALE++LDPEF
Sbjct  26   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNDALEKNLDPEF  85

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLLQP NL+SLQ+LL+FH++P RI S H   ++     +H TL  D    +L  +  +
Sbjct  86   KSFLLQPKNLKSLQSLLMFHILPKRITSPHQFSSAV---VSHRTLSND----HLHFTNGK  138

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V+ A +   DD+ RPDG+IHGIER+LIP
Sbjct  139  VNSAVITKPDDLTRPDGVIHGIERLLIP  166



>ref|XP_004981498.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Setaria 
italica]
Length=467

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 113/145 (78%), Gaps = 9/145 (6%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALERDLDPEFKRF
Sbjct  51   NSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNVTIFAPRNEALERDLDPEFKRF  110

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVSG  545
            LL+P NL+SLQ LLL+H++P R+ S+ WP  S      H TL   +G E  + +   V  
Sbjct  111  LLEPRNLKSLQALLLYHVLPARLPSESWPAAS------HPTL---SGEEVELAAGMRVGS  161

Query  546  AKVVSLDDVVRPDGIIHGIERVLIP  620
            A V   D V+RPDG+IHGIER+L+P
Sbjct  162  AAVTRPDAVLRPDGVIHGIERLLVP  186



>ref|NP_190805.1| fasciclin-like arabinogalactan protein 15 [Arabidopsis thaliana]
 sp|Q9FT45.1|FLA15_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 15; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC07928.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42264.1| GPI-anchored protein [Arabidopsis thaliana]
 gb|ABG48483.1| At3g52370 [Arabidopsis thaliana]
 gb|AEE78939.1| fasciclin-like arabinogalactan protein 15 [Arabidopsis thaliana]
Length=436

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 115/148 (78%), Gaps = 8/148 (5%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALE++LDPEF
Sbjct  28   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGQHNITIFAPRNDALEKNLDPEF  87

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLLQP NL+SLQ+LL+FH++P RI S  +         +H TL  D    +L  +  +
Sbjct  88   KSFLLQPKNLKSLQSLLMFHILPKRITSPQF----SSAVVSHRTLSND----HLHFTNGK  139

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V+ A++   DD+ RPDGIIHGIER+LIP
Sbjct  140  VNSAEITKPDDLTRPDGIIHGIERLLIP  167



>ref|XP_002876139.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52398.1| beta-Ig-H3 domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 115/148 (78%), Gaps = 8/148 (5%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALE++LDPEF
Sbjct  27   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGQHNITIFAPRNDALEKNLDPEF  86

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLLQP NL+SLQ+LL+FH++P RI S  +         +H TL  D    +L  +  +
Sbjct  87   KSFLLQPKNLKSLQSLLMFHILPKRITSPQF----SSAVVSHRTLSND----HLHFTNGK  138

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V+ A++   DD+ RPDGIIHGIER+LIP
Sbjct  139  VNSAEITKPDDLTRPDGIIHGIERLLIP  166



>ref|XP_006291159.1| hypothetical protein CARUB_v10017276mg [Capsella rubella]
 gb|EOA24057.1| hypothetical protein CARUB_v10017276mg [Capsella rubella]
Length=437

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 114/148 (77%), Gaps = 8/148 (5%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
             QINSNSVLVALLDSHYTEL+ELVEKALLLQTLEEAV +HNITIFAPRN+ALE++LDPEF
Sbjct  29   GQINSNSVLVALLDSHYTELAELVEKALLLQTLEEAVGKHNITIFAPRNDALEKNLDPEF  88

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLLQP NL+SLQ+LL+FH++P R+ S  +         +H TL  D     L ++  +
Sbjct  89   KSFLLQPKNLKSLQSLLMFHILPKRVTSPQF----SSAVVSHRTLSND----QLHLTNGK  140

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V+ A +   DD+ RPDGIIHGIER+LIP
Sbjct  141  VNSAHITKPDDLTRPDGIIHGIERLLIP  168



>ref|NP_001159324.1| uncharacterized protein LOC100304417 precursor [Zea mays]
 gb|ACN25805.1| unknown [Zea mays]
 gb|AFW67416.1| hypothetical protein ZEAMMB73_395863 [Zea mays]
Length=473

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 114/151 (75%), Gaps = 15/151 (10%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALERDLDPEFKR
Sbjct  52   VNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNVTIFAPRNEALERDLDPEFKR  111

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVS  542
            FLL+P NLRSLQ LLL+H++P+R+ S  WP         H TL     GE++ ++     
Sbjct  112  FLLEPRNLRSLQALLLYHVLPSRLPSGSWPAAP------HPTLS----GEDVELASAGAG  161

Query  543  G-----AKVVSLDDVVRPDGIIHGIERVLIP  620
            G     A V   D V+RPDG+IHGIER+L+P
Sbjct  162  GMRVGHAAVTRPDAVLRPDGVIHGIERLLVP  192



>ref|XP_004167872.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
Length=465

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 116/151 (77%), Gaps = 10/151 (7%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNS+LVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALER+LDPEFK
Sbjct  47   QINSNSILVALLDSHYTELAELVEKALLLQTLEDAVGKHNLTIFAPRNEALERELDPEFK  106

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRI----ESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            RFLL+P NL+SLQ LL+ H++P R+    E    P   R  G +H+ L     G+ +V S
Sbjct  107  RFLLEPRNLKSLQTLLMSHIVPKRVGFNQERSSSPVRHRTLGDSHLNLKNSDSGKIIVDS  166

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  A++V  DDVVRPDG+IHGIER+LIP
Sbjct  167  ------AEIVRPDDVVRPDGVIHGIERLLIP  191



>gb|ABI95416.1| fasciclin-like protein FLA26 [Triticum aestivum]
Length=460

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 115/157 (73%), Gaps = 15/157 (10%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N S+G  +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV RHN+TI APRNEALERD
Sbjct  34   NSSTG--VNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGRHNVTILAPRNEALERD  91

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD----AGG  509
            LDPEFKRFLL+P NL+SLQ LLLFH++P R  +  WP  S      H TL  +    A G
Sbjct  92   LDPEFKRFLLEPRNLKSLQTLLLFHVLPARHPAGSWPAAS------HPTLSGEDVELAAG  145

Query  510  ENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             N       V+ A V   D V+RP+G+IHGIER+L+P
Sbjct  146  AN---GSMRVAQAAVTRPDAVLRPEGVIHGIERILVP  179



>ref|NP_001051504.1| Os03g0788600 [Oryza sativa Japonica Group]
 gb|AAT75247.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99257.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13418.1| Os03g0788600 [Oryza sativa Japonica Group]
 dbj|BAG91233.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97579.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76302.1| hypothetical protein OsI_13823 [Oryza sativa Indica Group]
 gb|EEE60067.1| hypothetical protein OsJ_12880 [Oryza sativa Japonica Group]
Length=474

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 116/157 (74%), Gaps = 16/157 (10%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
             +G  INSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALERDLD
Sbjct  47   GAGTGINSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNVTIFAPRNEALERDLD  106

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFKRFLL+P NL+SLQ+LLLFH++P R+ S  W   S      H TL     GE + ++
Sbjct  107  PEFKRFLLEPRNLKSLQSLLLFHVLPARLPSGSWSAVS------HPTLS----GEEVELA  156

Query  528  ER------EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                     V+ A V   D V+RPDG+IHGIER+L+P
Sbjct  157  AAANDGAMRVAHAAVTRPDAVLRPDGVIHGIERLLVP  193



>gb|ABI95417.1| fasciclin-like protein FLA27 [Triticum aestivum]
Length=482

 Score =   182 bits (462),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 111/150 (74%), Gaps = 13/150 (9%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV RHN+TIFAPRNEALERDLDPEFKR
Sbjct  61   VNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGRHNVTIFAPRNEALERDLDPEFKR  120

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD----AGGENLVVSE  530
            FLL+P NL+SLQ LLLFH++P R  +  WP  S      H TL  +    A G N     
Sbjct  121  FLLEPRNLKSLQTLLLFHVLPARHPAGSWPAAS------HPTLSGEDVELAAGAN---GS  171

Query  531  REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              V+ A V   D V+ PDG+IHGIER+L+P
Sbjct  172  MRVAHAAVTRPDAVLSPDGVIHGIERLLVP  201



>gb|KFK34484.1| hypothetical protein AALP_AA5G151600 [Arabis alpina]
Length=430

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 110/151 (73%), Gaps = 14/151 (9%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            +   QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAV +HNITIFAPRNEALER+LD
Sbjct  25   TGSGQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVGKHNITIFAPRNEALERNLD  84

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            PEFK FLLQP NL+SLQ+LL+FH++P RI S            NH TL  D    N+   
Sbjct  85   PEFKSFLLQPKNLKSLQSLLMFHVLPKRITSPQLSTTV----VNHRTLSNDHLTGNV---  137

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                   ++   DD+ RPDGIIHGI+R+LIP
Sbjct  138  -------EITRPDDITRPDGIIHGIDRLLIP  161



>ref|XP_002463768.1| hypothetical protein SORBIDRAFT_01g005770 [Sorghum bicolor]
 gb|EER90766.1| hypothetical protein SORBIDRAFT_01g005770 [Sorghum bicolor]
Length=474

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 112/150 (75%), Gaps = 14/150 (9%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALERDLDPEFKRF
Sbjct  53   NSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNVTIFAPRNEALERDLDPEFKRF  112

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-----AGGENLVVSE  530
            LL+P NL+SLQ LLL+H++P+R+ S  WP  S      H TL  +     A G     + 
Sbjct  113  LLEPRNLKSLQALLLYHVLPSRLPSDAWPAAS------HPTLSGEEVELAAAGTG---TG  163

Query  531  REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              V  A V   D V+RPDG+IHGIER+L+P
Sbjct  164  MRVGHAAVTRPDAVLRPDGVIHGIERLLVP  193



>ref|XP_008442961.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Cucumis 
melo]
Length=465

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 116/151 (77%), Gaps = 10/151 (7%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNS+LVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALER+LDPEFK
Sbjct  47   QINSNSILVALLDSHYTELAELVEKALLLQTLEDAVGKHNLTIFAPRNEALERELDPEFK  106

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRI----ESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            RFLL+P NL+SLQ LL+ H++P R+    +    P   R  G +H+ L     G+ +V S
Sbjct  107  RFLLEPRNLKSLQTLLMSHIVPKRVGFNQDRSSSPVRHRTLGDSHLDLKNSDSGKIIVDS  166

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  A++V  +DVVRPDG+IHGIER+LIP
Sbjct  167  ------AEIVRPNDVVRPDGVIHGIERLLIP  191



>ref|XP_004136532.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cucumis 
sativus]
 gb|KGN59239.1| hypothetical protein Csa_3G783850 [Cucumis sativus]
Length=465

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 116/151 (77%), Gaps = 10/151 (7%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNS+LVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALER+LDPEFK
Sbjct  47   QINSNSILVALLDSHYTELAELVEKALLLQTLEDAVGKHNLTIFAPRNEALERELDPEFK  106

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENS----RRGGRNHITLCRDAGGENLVVS  527
            RFLL+P NL+SLQ LL+ H++P R+       +S    R  G +H+ L     G+ +V S
Sbjct  107  RFLLEPRNLKSLQTLLMSHIVPERVGFNQERSSSLVRHRTLGDSHLNLKNSDSGKIIVDS  166

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  A++V  DDVVRPDG+IHGIER+LIP
Sbjct  167  ------AEIVRPDDVVRPDGVIHGIERLLIP  191



>ref|XP_004494272.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Cicer arietinum]
Length=453

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 9/150 (6%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNS+LVALLDSHYTELSELVEKALLLQ LE+ +  HNITIFAP+N+ALERDLDPEFK
Sbjct  38   QINSNSILVALLDSHYTELSELVEKALLLQKLEQTLGNHNITIFAPKNQALERDLDPEFK  97

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGG--RNH-ITLCRDAGGENLVVSE  530
            RFLL+P NL+SLQ LL+ H++ +RIES HWP  +R      NH + L  +  G      +
Sbjct  98   RFLLEPRNLKSLQTLLMSHILLSRIESHHWPSVNRHHHTLSNHRLHLTTNPTG------K  151

Query  531  REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            + V  A+++  +DV+RPDG+IHGIER++IP
Sbjct  152  KTVDSAEILRPNDVIRPDGVIHGIERLIIP  181



>ref|XP_004494271.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Cicer arietinum]
Length=467

 Score =   179 bits (455),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 9/150 (6%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNS+LVALLDSHYTELSELVEKALLLQ LE+ +  HNITIFAP+N+ALERDLDPEFK
Sbjct  38   QINSNSILVALLDSHYTELSELVEKALLLQKLEQTLGNHNITIFAPKNQALERDLDPEFK  97

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGG--RNH-ITLCRDAGGENLVVSE  530
            RFLL+P NL+SLQ LL+ H++ +RIES HWP  +R      NH + L  +  G      +
Sbjct  98   RFLLEPRNLKSLQTLLMSHILLSRIESHHWPSVNRHHHTLSNHRLHLTTNPTG------K  151

Query  531  REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            + V  A+++  +DV+RPDG+IHGIER++IP
Sbjct  152  KTVDSAEILRPNDVIRPDGVIHGIERLIIP  181



>gb|KDO48671.1| hypothetical protein CISIN_1g013434mg [Citrus sinensis]
 gb|KDO48672.1| hypothetical protein CISIN_1g013434mg [Citrus sinensis]
Length=443

 Score =   179 bits (453),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 116/154 (75%), Gaps = 5/154 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N +   QINSNSVLVALLDSHYTELSELVEKALLLQ LE+AV +H+ITIFAP+NEALERD
Sbjct  49   NATHSGQINSNSVLVALLDSHYTELSELVEKALLLQPLEDAVGKHSITIFAPKNEALERD  108

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGG-ENL  518
            LDPEFKRFLL+PGNL+SLQ LLL H++ TRIE       S +    H TL  D+    + 
Sbjct  109  LDPEFKRFLLEPGNLKSLQTLLLHHIVSTRIELNRTATESTQ----HHTLSSDSVELTSH  164

Query  519  VVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               ++ +S +KV+  + V RPDG+IHGIER+LIP
Sbjct  165  DSGDKFISQSKVIHPNAVDRPDGVIHGIERLLIP  198



>gb|ABI95415.1| fasciclin-like protein FLA25 [Triticum aestivum]
Length=459

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 117/154 (76%), Gaps = 8/154 (5%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N S+G  +NSNSVLVALLDSHYTEL+ELVEKALLLQ+LE+AV R N+TIFAPRNEALERD
Sbjct  32   NSSTG--VNSNSVLVALLDSHYTELAELVEKALLLQSLEDAVGRGNVTIFAPRNEALERD  89

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIES-KHWPENSRRGGRNHITLCRDAGGENL  518
            LDPEF+ FLL+P NLRSLQ LLLFH++P+R+ S   WP ++ R   +   L   A G  +
Sbjct  90   LDPEFRAFLLEPRNLRSLQRLLLFHVLPSRLHSHSAWPASTARMTLSGEHLQLSADGHKM  149

Query  519  VVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +V   EV+       D VVRPDG+IHGIER+L+P
Sbjct  150  LVGTAEVT-----RPDAVVRPDGVIHGIERLLVP  178



>gb|KEH29726.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=466

 Score =   179 bits (454),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 116/153 (76%), Gaps = 12/153 (8%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNS+LVALLDSHYTEL+ELVEKA+LLQTLE+ V ++NITIFAP+N+ALERDLDP FK
Sbjct  41   QINSNSILVALLDSHYTELAELVEKAMLLQTLEDTVGKNNITIFAPKNQALERDLDPNFK  100

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE-  536
             FLL+P NL+SLQ LL+ H+IPTRI       +S+ G   H TL  +     +V+   E 
Sbjct  101  TFLLEPRNLKSLQTLLMSHIIPTRINGS---VSSKTGSTRHRTLSLE---HKIVIQSNET  154

Query  537  -----VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                 V+GAK+V L+DV RPDG+IHGIER+LIP
Sbjct  155  SQQWLVNGAKIVHLNDVTRPDGVIHGIERLLIP  187



>ref|XP_003554480.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Glycine 
max]
Length=455

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 9/144 (6%)
 Frame = +3

Query  198  VLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQP  377
            +LVALLDSHYTEL+ELVEKALLLQ LEEAV  HNITIFAPRN+ALERDLDPEFKRFLL+P
Sbjct  49   ILVALLDSHYTELAELVEKALLLQKLEEAVGNHNITIFAPRNQALERDLDPEFKRFLLEP  108

Query  378  GNLRSLQNLLLFHMIPTRIESKHWPENSRRG---GRNHITLCRDAGGENLVVSEREVSGA  548
             NLRSLQ LL+ H++PTRI S HWP +  R      + + L     G       R V  A
Sbjct  109  RNLRSLQTLLMSHILPTRIASHHWPSDDLRHRTLSDHRLHLASKPSG------HRTVDSA  162

Query  549  KVVSLDDVVRPDGIIHGIERVLIP  620
            +++  DDV+RPDG+IHGIER+++P
Sbjct  163  EILRADDVLRPDGVIHGIERLIVP  186



>ref|XP_006445815.1| hypothetical protein CICLE_v10015097mg [Citrus clementina]
 ref|XP_006485518.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
 gb|ESR59055.1| hypothetical protein CICLE_v10015097mg [Citrus clementina]
Length=476

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 116/154 (75%), Gaps = 5/154 (3%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N +   QINSNSVLVALLDSHYTELSELVEKALLLQ LE+AV +H+ITIFAP+NEALERD
Sbjct  49   NATHSGQINSNSVLVALLDSHYTELSELVEKALLLQPLEDAVGKHSITIFAPKNEALERD  108

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGG-ENL  518
            LDPEFKRFLL+PGNL+SLQ LLL H++ TRIE       S +    H TL  D+    + 
Sbjct  109  LDPEFKRFLLEPGNLKSLQTLLLHHIVSTRIELNRTATESTQ----HHTLSSDSVELTSH  164

Query  519  VVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               ++ +S +KV+  + V RPDG+IHGIER+LIP
Sbjct  165  DSGDKFISQSKVIHPNAVDRPDGVIHGIERLLIP  198



>ref|XP_003559349.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Brachypodium 
distachyon]
Length=483

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 115/154 (75%), Gaps = 12/154 (8%)
 Frame = +3

Query  171  SGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDP  350
            SGA I+SNSVLVALLDSHYTELSELVEKALLLQTLE+AV RHN+TIFAPRNEALERDLDP
Sbjct  55   SGAGISSNSVLVALLDSHYTELSELVEKALLLQTLEDAVGRHNVTIFAPRNEALERDLDP  114

Query  351  EFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD----AGGENL  518
            EFKRFLL+P NL+SLQ+LLLFH++P+R    H    S      H TL  +    A G N 
Sbjct  115  EFKRFLLEPRNLKSLQSLLLFHVLPSR----HP-AASWPASAAHPTLSGEDLELAAGSN-  168

Query  519  VVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  V+ A V   D V+RPDG+IHGIER+L+P
Sbjct  169  --GSMRVAHASVTRPDAVLRPDGVIHGIERLLVP  200



>gb|ABK25415.1| unknown [Picea sitchensis]
Length=464

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 115/156 (74%), Gaps = 6/156 (4%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            PS + SS   INSNSVLVALLDSHYTEL+ELVEKALLLQTLEE V   N+TIFAP+N+ L
Sbjct  33   PSNSSSSQVAINSNSVLVALLDSHYTELAELVEKALLLQTLEEVVGSSNVTIFAPQNDIL  92

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGE  512
            ER LDPEFKRFL +PGNL++LQ LL+FH++P RI ++ W    R G   H TL +D    
Sbjct  93   ERKLDPEFKRFLHEPGNLKALQKLLMFHVVPRRIVAEDW----RNG--THQTLAKDRLKL  146

Query  513  NLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            ++   ++ +  A V   + VVRPDG+IHGI+R+LIP
Sbjct  147  SMKGDKKTIDLASVAHPNAVVRPDGVIHGIDRMLIP  182



>ref|XP_002515862.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46531.1| conserved hypothetical protein [Ricinus communis]
Length=464

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 117/152 (77%), Gaps = 11/152 (7%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            Q+NSNSVLVALLDSHYTE++EL+EKALLLQTLE+AV+RHN+TIFAPRNEALERDLDP FK
Sbjct  42   QVNSNSVLVALLDSHYTEVAELLEKALLLQTLEQAVARHNLTIFAPRNEALERDLDPHFK  101

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHIT-----LCRDAGGENLVV  524
            RFLL+PGN++SLQ+L+LFH+IPTR+ S  WP  S     N ++     L     G     
Sbjct  102  RFLLEPGNIKSLQDLILFHIIPTRVSSAQWPSLSESTVHNSLSDHPLNLTSHKSG-----  156

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             +R V  A+VV  D V RPDGIIHGIERVLIP
Sbjct  157  -QRIVGLARVVQPDSVTRPDGIIHGIERVLIP  187



>ref|XP_006826417.1| hypothetical protein AMTR_s00004p00159330 [Amborella trichopoda]
 gb|ERM93654.1| hypothetical protein AMTR_s00004p00159330 [Amborella trichopoda]
Length=470

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 6/154 (4%)
 Frame = +3

Query  168  SSG---AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALER  338
            SSG   + INSNSVLVALLDSHYTEL+EL+EKALLLQTLEEAV +HNITIFAPRNEALER
Sbjct  42   SSGFNSSPINSNSVLVALLDSHYTELAELLEKALLLQTLEEAVGKHNITIFAPRNEALER  101

Query  339  DLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENL  518
            DLDPEFKRFLL+PGNL+SLQ+L+LFH+IP RI +K+WPE+      +H TL  D      
Sbjct  102  DLDPEFKRFLLEPGNLKSLQSLILFHVIPRRIPAKNWPESD---AHSHDTLSSDRLTLTC  158

Query  519  VVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                R+V  A ++  D +VRPDG+IHGIER+LIP
Sbjct  159  KNRVRKVDLASLIHPDSIVRPDGVIHGIERLLIP  192



>dbj|BAJ97817.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 118/155 (76%), Gaps = 9/155 (6%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N+S+G  +NSNSVLVALLDSHYTEL+ELVEKALLLQ+LE+AV R N+TIFAP+NEALERD
Sbjct  34   NISTG--VNSNSVLVALLDSHYTELAELVEKALLLQSLEDAVGRGNVTIFAPQNEALERD  91

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKH--WPENSRRGGRNHITLCRDAGGEN  515
            LDPEF+ FLL+P NL SLQ LLLFH++P+R+ S    WP ++ R   +   L   A G+ 
Sbjct  92   LDPEFRAFLLEPRNLCSLQRLLLFHVLPSRLHSASAVWPASTARMTLSGEHLELSADGQK  151

Query  516  LVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            ++V   EV+       D VVRPDG+IHGIER+L+P
Sbjct  152  MLVGTVEVT-----RPDAVVRPDGVIHGIERLLVP  181



>gb|EPS68119.1| hypothetical protein M569_06649, partial [Genlisea aurea]
Length=370

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/153 (61%), Positives = 109/153 (71%), Gaps = 9/153 (6%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            +I+S SVLVALLDS YT  SE+VEK LLLQ LE AVS  N+T+FAPRNEALE DLDPEFK
Sbjct  1    EIDSGSVLVALLDSRYTAFSEMVEKGLLLQELERAVSERNVTVFAPRNEALEEDLDPEFK  60

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAG------GENLV  521
            RFL +P N+ SL+NLLLFH+I  RIE + WP  +  G   H +L  D        G+N  
Sbjct  61   RFLSEPRNVGSLRNLLLFHVISGRIEGRSWPGEASDGVCYHASLADDEEEIPLRRGKN--  118

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              ER VS A+V   DDVVRPDGI+HGIER+LIP
Sbjct  119  -GERIVSTARVFRPDDVVRPDGIVHGIERLLIP  150



>ref|XP_004487436.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Cicer 
arietinum]
Length=454

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 113/148 (76%), Gaps = 3/148 (2%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
            +QINSNSVL+ALLDSHYTEL+EL+EKA+LLQTLE+ V+ HNITIFAP N+ALER+LDP+F
Sbjct  31   SQINSNSVLLALLDSHYTELAELIEKAMLLQTLEQTVATHNITIFAPNNQALERNLDPDF  90

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K+FLLQPGN+ SLQ+LLLFH+IPT I SK    ++R    ++  +  D    N+   E  
Sbjct  91   KQFLLQPGNIHSLQSLLLFHVIPTNIGSKKQTGSTRFKTLSNHNINVDT---NITTGELT  147

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V   K+V  D + RPDG+IHGI+ +LIP
Sbjct  148  VEQIKIVHPDFITRPDGVIHGIQNLLIP  175



>gb|KDO48944.1| hypothetical protein CISIN_1g043668mg [Citrus sinensis]
Length=415

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 117/162 (72%), Gaps = 21/162 (13%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
            + NPS      +QINSNSVL+ALLDSHYTEL+ELVEKALLLQTLE+AV+ HN+TIFAP+N
Sbjct  30   YSNPS------SQINSNSVLLALLDSHYTELAELVEKALLLQTLEQAVATHNVTIFAPKN  83

Query  324  EALERD-LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIE--SKHWPENSRRGGRNHITLC  494
            EA ERD LDPEFKRFLLQP N++SLQNLLLFH+IP +I   S+ W   S R    H TL 
Sbjct  84   EAFERDLLDPEFKRFLLQPANIKSLQNLLLFHIIPRKIAFGSEEW---SAR----HKTLA  136

Query  495  RDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             D   E        ++ AKVV  D + RPDG IHGI ++++P
Sbjct  137  GDGVDELF-----PLNLAKVVHPDSITRPDGTIHGISQLMVP  173



>ref|XP_004506247.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Cicer 
arietinum]
Length=459

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/151 (62%), Positives = 112/151 (74%), Gaps = 11/151 (7%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNS+LVALLDSHYTEL+ELVEKA+LLQTLE+ V ++NITIFAP+NEALERDLDP FK
Sbjct  36   QINSNSILVALLDSHYTELAELVEKAMLLQTLEDTVGKNNITIFAPKNEALERDLDPNFK  95

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS----  527
             FLL+P NL+SLQ LL+ H+IP RI       NS  G   H TL       NL+++    
Sbjct  96   TFLLEPRNLKSLQTLLMSHIIPIRITGS----NSVTGSTRHKTLSLQ---HNLILNGTGQ  148

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +  V GAK++  D V RPDG+IHGIER+LIP
Sbjct  149  QWTVDGAKILHTDAVTRPDGVIHGIERLLIP  179



>gb|EAZ38767.1| hypothetical protein OsJ_23169 [Oryza sativa Japonica Group]
Length=460

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 112/148 (76%), Gaps = 8/148 (5%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV + N+TIFAPRNEALERDLDPEF+R
Sbjct  50   VNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKGNVTIFAPRNEALERDLDPEFRR  109

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGE--NLVVSERE  536
            FLL+P NLRSLQ LLLFH++P R+ +     +S     +H TL     GE  +L  S   
Sbjct  110  FLLEPRNLRSLQRLLLFHVLPARLHASD--SSSPDFPSSHPTLS----GERVDLSASPMR  163

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V  A V   D VVRPDG+IHGIER+L+P
Sbjct  164  VGAAAVTRPDAVVRPDGVIHGIERLLVP  191



>ref|XP_010557991.1| PREDICTED: fasciclin-like arabinogalactan protein 17 [Tarenaya 
hassleriana]
Length=469

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 92/145 (63%), Positives = 109/145 (75%), Gaps = 7/145 (5%)
 Frame = +3

Query  198  VLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQP  377
            VLVALLDS YTEL+ELVEKALLLQTLE+ V RHNITIFAP NEALER LDP+FKRFLL+P
Sbjct  54   VLVALLDSRYTELAELVEKALLLQTLEDTVGRHNITIFAPCNEALERGLDPDFKRFLLEP  113

Query  378  GNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLV----VSEREVSG  545
            GNL+SLQ LL+FH++P R+ S  WP+    G   H TL  D    +LV      ++ V  
Sbjct  114  GNLKSLQTLLVFHILPKRVGSHQWPDED-SGQVRHETLGED--NVHLVNAKKTGKKMVDS  170

Query  546  AKVVSLDDVVRPDGIIHGIERVLIP  620
            A+V+  DDV RPDG+IHGIER+LIP
Sbjct  171  AEVIRPDDVTRPDGVIHGIERLLIP  195



>ref|NP_001058941.1| Os07g0160600 [Oryza sativa Japonica Group]
 dbj|BAC79642.1| GPI-anchored protein -like [Oryza sativa Japonica Group]
 dbj|BAF20855.1| Os07g0160600 [Oryza sativa Japonica Group]
 dbj|BAG89338.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93771.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 112/148 (76%), Gaps = 8/148 (5%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV + N+TIFAPRNEALERDLDPEF+R
Sbjct  50   VNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKGNVTIFAPRNEALERDLDPEFRR  109

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGE--NLVVSERE  536
            FLL+P NLRSLQ LLLFH++P R+ +     +S     +H TL     GE  +L  S   
Sbjct  110  FLLEPRNLRSLQRLLLFHVLPARLHASD--SSSPDFPSSHPTLS----GERVDLSASPMR  163

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V  A V   D VVRPDG+IHGIER+L+P
Sbjct  164  VGAAAVTRPDAVVRPDGVIHGIERLLVP  191



>dbj|BAJ98684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=464

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 118/155 (76%), Gaps = 9/155 (6%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            N+S+G  +NSNSVLVALLDSHYTEL+ELVEKALLLQ+LE+AV R ++TIFAP+NEALERD
Sbjct  34   NISTG--VNSNSVLVALLDSHYTELAELVEKALLLQSLEDAVGRGDVTIFAPQNEALERD  91

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKH--WPENSRRGGRNHITLCRDAGGEN  515
            LDPEF+ FLL+P NL SLQ LLLFH++P+R+ S    WP ++ R   +   L   A G+ 
Sbjct  92   LDPEFRAFLLEPRNLCSLQRLLLFHVLPSRLHSASAVWPASTARMTLSGEHLELSADGQK  151

Query  516  LVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            ++V   EV+       D VVRPDG+IHGIER+L+P
Sbjct  152  MLVGTVEVT-----RPDAVVRPDGVIHGIERLLVP  181



>ref|XP_006424052.1| hypothetical protein CICLE_v10030024mg [Citrus clementina]
 gb|ESR37292.1| hypothetical protein CICLE_v10030024mg [Citrus clementina]
Length=442

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 116/162 (72%), Gaps = 21/162 (13%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
            + NPS       QINSNSVL+ALLDSHYTEL+ELVEKALLLQTLE+AV+ HN+TIFAP+N
Sbjct  30   YSNPS------TQINSNSVLLALLDSHYTELAELVEKALLLQTLEQAVATHNVTIFAPKN  83

Query  324  EALERD-LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIE--SKHWPENSRRGGRNHITLC  494
            EA ERD LDPEFKRFLLQP N++SLQNLLLFH+IP +I   S+ W   S R    H TL 
Sbjct  84   EAFERDLLDPEFKRFLLQPANIKSLQNLLLFHIIPRKIAFGSEEW---SAR----HKTLA  136

Query  495  RDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             D   E        ++ AKVV  D + RPDG IHGI ++++P
Sbjct  137  GDGVDELF-----PLNLAKVVHPDSITRPDGTIHGISQLMVP  173



>dbj|BAE71191.1| hypothetical protein [Trifolium pratense]
Length=454

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 110/149 (74%), Gaps = 7/149 (5%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNSVLVALLDSHYTEL+EL+EKA+LLQTLE  V+ HNITIFAP NEALER+LD +FK
Sbjct  30   QINSNSVLVALLDSHYTELAELIEKAMLLQTLENTVANHNITIFAPNNEALERNLDSDFK  89

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGG--ENLVVSER  533
            +FLL+PGN+ SLQ LLLFH+IPTRIES      S R    H TL         N+   E 
Sbjct  90   QFLLEPGNIHSLQTLLLFHVIPTRIES-----GSTRHQHQHKTLSDHHLHLETNITTGEW  144

Query  534  EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             V+ AKV   + + RPDG+IHGI+R+LIP
Sbjct  145  TVNQAKVTHPNILTRPDGVIHGIQRLLIP  173



>gb|EEC81554.1| hypothetical protein OsI_24980 [Oryza sativa Indica Group]
Length=484

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 112/148 (76%), Gaps = 8/148 (5%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            +NSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV + N+TIFAPRNEALERDLDPEF+R
Sbjct  77   VNSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKGNVTIFAPRNEALERDLDPEFRR  136

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGE--NLVVSERE  536
            FLL+P NLRSLQ LLLFH++P R+ +     +S     +H TL     GE  +L  S   
Sbjct  137  FLLEPRNLRSLQRLLLFHVLPDRLHASD--SSSPDFPSSHPTLS----GERVDLSASPMR  190

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V  A V   D VVRPDG+IHGIER+L+P
Sbjct  191  VGAAAVTRPDAVVRPDGVIHGIERLLVP  218



>ref|XP_003557575.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Brachypodium 
distachyon]
Length=489

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 111/153 (73%), Gaps = 17/153 (11%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            +NSNSVLVALLDS YTELSELVEKALLLQ LE+AV R N+TIFAPRNEALERDLDPEF+ 
Sbjct  60   VNSNSVLVALLDSRYTELSELVEKALLLQQLEDAVGRGNVTIFAPRNEALERDLDPEFRA  119

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVS  542
            FLLQP NLRSLQ LLLFH++P+R+ S  W        R+  +L     GE+L +S  + S
Sbjct  120  FLLQPRNLRSLQRLLLFHVLPSRLSSSQW--------RSAASLT--LSGEHLELSLSDSS  169

Query  543  -------GAKVVSLDDVVRPDGIIHGIERVLIP  620
                    A V   D VVRPDG+IHGIE++LIP
Sbjct  170  TTAMLAGSAAVTHPDAVVRPDGVIHGIEKLLIP  202



>ref|XP_011076879.1| PREDICTED: fasciclin-like arabinogalactan protein 15 [Sesamum 
indicum]
Length=464

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 111/152 (73%), Gaps = 8/152 (5%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            I+SNS+L+ALL+SHYTELSELVEKALLL TLE A++RHN+TIFAP+N+ALE  LDPEFKR
Sbjct  34   ISSNSILIALLESHYTELSELVEKALLLHTLEAALTRHNLTIFAPKNDALELHLDPEFKR  93

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGR------NHITLCRDAGGENLVV  524
            FLL+PGN++SLQ L+L H++P ++   +WP N  R  R      +H+     A  +    
Sbjct  94   FLLEPGNIKSLQTLILHHILPVKLSHGNWPGNPTRSSRQAALSNDHLEFSCSAISDG--S  151

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              + V   KVV  + VVRPDGIIHGIE+V+IP
Sbjct  152  CSKYVGEVKVVHFNSVVRPDGIIHGIEKVIIP  183



>gb|EMT22481.1| hypothetical protein F775_14603 [Aegilops tauschii]
Length=294

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 107/143 (75%), Gaps = 6/143 (4%)
 Frame = +3

Query  171  SGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDP  350
            S   +NSNSVLVALLDSHYTEL+ELVEKALLLQ+LE+AV R N+TIFAPRNEALERDLDP
Sbjct  35   SSTGVNSNSVLVALLDSHYTELAELVEKALLLQSLEDAVGRGNVTIFAPRNEALERDLDP  94

Query  351  EFKRFLLQPGNLRSLQNLLLFHMIPTRIES-KHWPENSRRGGRNHITLCRDAGGENLVVS  527
            EF+ FLL+P NLRSLQ LLLFH++P+R+ S   WP ++ R   +   L   A G+ ++V 
Sbjct  95   EFRAFLLEPRNLRSLQRLLLFHVLPSRLHSHSAWPASTARMTLSGEHLQLSADGQKMLVG  154

Query  528  EREVSGAKVVSLDDVVRPDGIIH  596
                  A+V   D VVRPDG+IH
Sbjct  155  T-----AEVTRPDAVVRPDGVIH  172



>ref|XP_007132513.1| hypothetical protein PHAVU_011G100600g [Phaseolus vulgaris]
 gb|ESW04507.1| hypothetical protein PHAVU_011G100600g [Phaseolus vulgaris]
Length=450

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 114/155 (74%), Gaps = 6/155 (4%)
 Frame = +3

Query  171  SGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDP  350
            S  QINSNS+LVALLDSHYTE++ELVEKA+LLQTLE  V  HNITIFAPRNEALERDLDP
Sbjct  23   SQGQINSNSILVALLDSHYTEVAELVEKAMLLQTLENTVMNHNITIFAPRNEALERDLDP  82

Query  351  EFKRFLLQPGNLRSLQNLLLFHMIPTRI-ESKHWP--ENSRRGGRNHITLCRDA--GGEN  515
            +FKRFLL+P NL+SLQ LL+ H++P RI + K+ P   NS R  R H TL ++     + 
Sbjct  83   DFKRFLLEPRNLQSLQTLLMSHIVPKRITKPKYQPGLSNSGRPTR-HKTLAQNQHLSLQT  141

Query  516  LVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +  +   V  ++V   D + RPDG+IHGI+ +LIP
Sbjct  142  VNSTHWNVDSSRVTHPDSLTRPDGVIHGIDTLLIP  176



>ref|XP_003540278.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Glycine 
max]
Length=454

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 109/153 (71%), Gaps = 13/153 (8%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S  AQINSNS+LVALLDSHYTEL+ELVEKA+LLQ LE+ V+ HNITIFAP NEAL+R+LD
Sbjct  33   SPTAQINSNSILVALLDSHYTELAELVEKAMLLQKLEDTVATHNITIFAPTNEALDRNLD  92

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            P+FKRFLL+P NL SLQ LLL H+ P +I SK            H+T   D    NL +S
Sbjct  93   PDFKRFLLEPANLHSLQTLLLSHITPAQIGSKTL--------TRHVTSLSD---HNLKLS  141

Query  528  E--REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            E    V  AKV   D V RPDG+IHGI+R+L+P
Sbjct  142  ENLTTVDEAKVTHPDVVTRPDGVIHGIDRLLLP  174



>ref|XP_006487826.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Citrus 
sinensis]
Length=452

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 115/162 (71%), Gaps = 21/162 (13%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRN  323
            + NPS      +QINSNSVL+ALLDS YTEL+ELVEKALLLQTLE+AV+ HN+TIFAP++
Sbjct  30   YSNPS------SQINSNSVLLALLDSQYTELAELVEKALLLQTLEQAVATHNVTIFAPKD  83

Query  324  EALERD-LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIE--SKHWPENSRRGGRNHITLC  494
            EA ERD LDPEFKRFLLQ  N++SLQNLLLFH+IP +I   S+ W   S R    H TL 
Sbjct  84   EAFERDLLDPEFKRFLLQAANIKSLQNLLLFHIIPRKIAFGSEEW---SAR----HKTLA  136

Query  495  RDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             D   E        ++ AKVV  D + RPDG IHGI ++++P
Sbjct  137  GDGVDELF-----PLNLAKVVHPDSITRPDGTIHGISQLMVP  173



>ref|XP_004955500.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Setaria 
italica]
Length=489

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 110/151 (73%), Gaps = 14/151 (9%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            ++SNSVLVALLDS YTEL+ELVEKALLLQ LE+AV R N+TIFAPRNEALERDLDPEF R
Sbjct  62   VSSNSVLVALLDSRYTELAELVEKALLLQALEDAVGRGNVTIFAPRNEALERDLDPEFHR  121

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSER---  533
            FLL+P NLR+LQ+LLLFH++P+R+       +      +H TL     GE L ++     
Sbjct  122  FLLEPRNLRALQSLLLFHVLPSRVHKLSSSSSQ-----SHQTLA----GEPLELATAPDG  172

Query  534  --EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               V GA V   D VVRPDG+IHGIER+L+P
Sbjct  173  AVRVGGAAVTHPDAVVRPDGVIHGIERLLVP  203



>ref|XP_010677585.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Beta vulgaris 
subsp. vulgaris]
Length=448

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 113/150 (75%), Gaps = 4/150 (3%)
 Frame = +3

Query  171  SGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDP  350
            S  QINSNS+LVALLDS YTEL+EL+EKALLLQ LE+ V +HN+TIFAP+NEALE+DL+P
Sbjct  32   STVQINSNSILVALLDSSYTELAELIEKALLLQYLEDMVGKHNLTIFAPKNEALEQDLNP  91

Query  351  EFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSE  530
            EFKRFLL+P NL+SLQ+L+L H++P+R+      E +R+   ++  L      + +VV E
Sbjct  92   EFKRFLLEPRNLKSLQSLILHHIVPSRVNLTKQAEFTRKRALSNHHLRLSLNNKRMVVEE  151

Query  531  REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  +V+  + +++PDG+IHGI+RVL+P
Sbjct  152  ----SVEVIDKNSIIKPDGLIHGIDRVLVP  177



>ref|XP_003527510.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
 ref|XP_006582372.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Glycine max]
Length=447

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 112/156 (72%), Gaps = 12/156 (8%)
 Frame = +3

Query  171  SGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAV--SRHNITIFAPRNEALERDL  344
            S  QINSNS+LVALLDSHYTEL+ELVEKA+LLQTLE  V  + +NITIFAPRNEALERDL
Sbjct  23   SQGQINSNSILVALLDSHYTELAELVEKAMLLQTLENTVMNNSNNITIFAPRNEALERDL  82

Query  345  DPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRR----GGRNHITLCRDAGGE  512
            DP+FKRFLL+P NL SLQ LLL H++P RI    +   S R       +H+TL      +
Sbjct  83   DPDFKRFLLEPRNLHSLQTLLLSHIVPKRITKPEFKTGSTRHRTLASHHHLTL------Q  136

Query  513  NLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             L ++   V  ++V++ + V RPDG+IHGI+ +LIP
Sbjct  137  ALNLTHWNVESSRVINPNSVTRPDGVIHGIDTLLIP  172



>gb|EYU19863.1| hypothetical protein MIMGU_mgv1a006599mg [Erythranthe guttata]
Length=437

 Score =   163 bits (413),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 108/152 (71%), Gaps = 10/152 (7%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            I+S+S+L+ALLDSHYT+LSEL+EKALLLQTLE A++   I +FAP N+ALERDLDPEF R
Sbjct  50   ISSDSILIALLDSHYTQLSELLEKALLLQTLENAIANGTIIVFAPTNKALERDLDPEFNR  109

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPEN------SRRGGRNHITLCRDAGGENLVV  524
            FLL+PGN++SLQ LLL H++P ++    WP +      +RR   +H  L    GG     
Sbjct  110  FLLEPGNIKSLQTLLLHHILPAKLSRGGWPTDPTRSTPTRRRALSHDYLEFTYGGN----  165

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             E  V  AKVV  + +VR DGIIHG+E+V++P
Sbjct  166  GEPYVGAAKVVQFNSIVRHDGIIHGVEKVIVP  197



>ref|XP_010917919.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Elaeis 
guineensis]
Length=544

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 111/152 (73%), Gaps = 14/152 (9%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
            +QINSNSVLVALLDSHYTEL+ELVEKALLL+ LE+AV RHN+TIFAPRN+A    LDPEF
Sbjct  130  SQINSNSVLVALLDSHYTELAELVEKALLLRALEDAVGRHNLTIFAPRNDA----LDPEF  185

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTR-IESKHW---PENSRRGGRNHITLCRDAGGENLVV  524
            K FLL+PGNL+SLQ L+L+H+IP+R + S+ W   P + R    + + L  D        
Sbjct  186  KHFLLEPGNLKSLQTLILYHVIPSRVVASESWAAEPVDQRTLSGDRLRLSGDG------T  239

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            + + V    V+  D VVRPDG+IHGIER+L+P
Sbjct  240  AVKRVGTTVVIHPDAVVRPDGVIHGIERMLVP  271



>ref|XP_006651891.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 16-like [Oryza brachyantha]
Length=464

 Score =   164 bits (414),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 109/146 (75%), Gaps = 18/146 (12%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            I SNSVLVALLDSHYTE++ELVEKALLL TLE+AV++H++TI APRNEALE  L+PEFKR
Sbjct  55   IISNSVLVALLDSHYTEMAELVEKALLLPTLEDAVAKHSVTILAPRNEALELGLNPEFKR  114

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVS  542
            FLL+P NL+SLQ+LLLFH++P R+ S  WP      G +H TL     GE     E E++
Sbjct  115  FLLEPRNLKSLQSLLLFHVLPARLPSGSWP------GGSHPTLS----GE-----EVELA  159

Query  543  GAKVVSLDDVVRPDGIIHGIERVLIP  620
             A V      +RPDG+IHGIER+L+P
Sbjct  160  AAAVTR---XLRPDGVIHGIERLLVP  182



>gb|KHN36515.1| Fasciclin-like arabinogalactan protein 16 [Glycine soja]
Length=365

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 106/153 (69%), Gaps = 13/153 (8%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S   QINSNS+LVALLDSHYTEL+ELVEKA+LLQ LE+ V+ HNITIFAP NEAL R+LD
Sbjct  35   SPTGQINSNSILVALLDSHYTELAELVEKAMLLQKLEDTVATHNITIFAPTNEALYRNLD  94

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            P+FKRFLLQP NL SLQ LLL H+ P  I S+            H+T   D    NL +S
Sbjct  95   PDFKRFLLQPANLHSLQTLLLSHITPALIGSQTL--------TRHVTTLSD---HNLKLS  143

Query  528  E--REVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            E    V  A+V   + V RPDG+IHGI+R+L+P
Sbjct  144  ENLTTVDQARVTHPNVVTRPDGVIHGIDRLLLP  176



>ref|XP_003596932.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
 gb|AES67183.1| fasciclin-like arabinogalactan protein 16 precursor [Medicago 
truncatula]
Length=446

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 104/148 (70%), Gaps = 7/148 (5%)
 Frame = +3

Query  177  AQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEF  356
            +QINSNS+L+ALLDSHYTEL+ L+EKA LLQTLE  VS+HNITIFAP N ALER+LDP+F
Sbjct  27   SQINSNSILIALLDSHYTELTYLIEKANLLQTLENTVSKHNITIFAPNNVALERNLDPDF  86

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSERE  536
            K FLLQPGN+ SLQ LLL H+IPTRI+S      S      H+         N    E  
Sbjct  87   KHFLLQPGNILSLQTLLLSHVIPTRIQSGSTRFKSISDYHLHLE-------TNTTTGEFM  139

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            V+   V   +D+ RPDG+IHGI+++LIP
Sbjct  140  VNQENVTHPNDITRPDGVIHGIQKILIP  167



>ref|XP_003543398.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X1 [Glycine max]
 ref|XP_006594907.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like isoform 
X2 [Glycine max]
Length=455

 Score =   160 bits (406),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/153 (58%), Positives = 106/153 (69%), Gaps = 13/153 (8%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S   QINSNS+LVALLDSHYTEL+ELVEKA+LLQ LE+ V+ HNITIFAP NEAL R+LD
Sbjct  35   SPTGQINSNSILVALLDSHYTELAELVEKAMLLQKLEDTVATHNITIFAPTNEALYRNLD  94

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
            P+FKRFLLQP NL SLQ LLL H+ P  I S+            H+T   D    NL +S
Sbjct  95   PDFKRFLLQPANLHSLQTLLLSHITPALIGSQTL--------TRHVTTLSD---HNLKLS  143

Query  528  ER--EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            E    V  A+V   + V RPDG+IHGI+R+L+P
Sbjct  144  ENLTTVDQARVTHPNVVTRPDGVIHGIDRLLLP  176



>ref|XP_008790162.1| PREDICTED: fasciclin-like arabinogalactan protein 16 [Phoenix 
dactylifera]
Length=549

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 112/162 (69%), Gaps = 14/162 (9%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            EN     +   QINSNSVLVALLDS YTEL+ELVEKALLL+ LE+AV RHN+TIFAPRNE
Sbjct  125  ENADVRPTLAPQINSNSVLVALLDSRYTELAELVEKALLLRALEDAVGRHNLTIFAPRNE  184

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTR-IESKHW---PENSRRGGRNHITLC  494
            A    LDPEFKRFLL+P NL SLQ L+L+H+IP+R + S+ W   P + R    + + L 
Sbjct  185  A----LDPEFKRFLLEPRNLNSLQTLILYHVIPSRVVASESWAAVPVDQRTLSGDRLRLS  240

Query  495  RDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             D        +E+ V    V+  D VVRPDG+IHGIE++L+P
Sbjct  241  GDG------TAEKRVDTTVVIHPDAVVRPDGVIHGIEQMLVP  276



>ref|XP_006651890.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like [Oryza 
brachyantha]
Length=413

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            INSNSVLVALLDSHYTEL+ELVEKALLLQTLE+AV +HN+TIFAPRNEALERDLDPEFKR
Sbjct  65   INSNSVLVALLDSHYTELAELVEKALLLQTLEDAVGKHNVTIFAPRNEALERDLDPEFKR  124

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENS  461
            FLL+P NL+SLQ+LLLFH++P R+ S  WP  S
Sbjct  125  FLLEPRNLKSLQSLLLFHVLPARLPSGSWPAAS  157



>ref|XP_007150000.1| hypothetical protein PHAVU_005G117500g [Phaseolus vulgaris]
 gb|ESW21994.1| hypothetical protein PHAVU_005G117500g [Phaseolus vulgaris]
Length=457

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 105/151 (70%), Gaps = 9/151 (6%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            S  AQINSNS+LVALLDS YTEL+ELVEKA+LL+ LEE V+ HNITIFAP N+AL+R+LD
Sbjct  37   SPTAQINSNSILVALLDSQYTELAELVEKAMLLEKLEETVATHNITIFAPTNQALDRNLD  96

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVS  527
             +FKRFLLQP NL SLQ LLL H+IPT+I S+    +      + I L       NL   
Sbjct  97   ADFKRFLLQPANLHSLQTLLLSHIIPTQIGSQTLIRHVTTLSNHQIRLS-----ANLTA-  150

Query  528  EREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               V  A+V   D + RPDG+IH I+R+L+P
Sbjct  151  ---VDQARVTHPDVLTRPDGVIHAIDRLLLP  178



>ref|XP_004154697.1| PREDICTED: fasciclin-like arabinogalactan protein 17-like, partial 
[Cucumis sativus]
Length=399

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 94/130 (72%), Gaps = 11/130 (8%)
 Frame = +3

Query  246  VEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIP  425
            +EKALLLQ LE+AV  HN+TIFAPRNEALERDLDPEFKRFLL+P NL+SLQ LL FH+IP
Sbjct  1    IEKALLLQILEDAVGNHNLTIFAPRNEALERDLDPEFKRFLLEPRNLKSLQTLLTFHVIP  60

Query  426  TRIESKHWPENSR----RGGRNHIT-LCRDAGGENLVVSEREVSGAKVVSLDDVVRPDGI  590
            TRI S  WP++S     +   NH+  L   + G      ER V  AKV+  D + RPDG+
Sbjct  61   TRIGSTEWPKHSESTRHQTLSNHVLRLTHHSTG------ERTVDLAKVIQPDAITRPDGV  114

Query  591  IHGIERVLIP  620
            IHGIER+LIP
Sbjct  115  IHGIERLLIP  124



>gb|AAT75258.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99261.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=460

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 109/152 (72%), Gaps = 15/152 (10%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            I SNSVLVALLDS YTE++ELVEKALLLQ LE+AV+ HN+TI APRNEALERD+DPEFKR
Sbjct  63   IVSNSVLVALLDSRYTEMAELVEKALLLQALEDAVAEHNVTILAPRNEALERDIDPEFKR  122

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVS  542
            FLL+P NL SLQ+LLLFH++P R+ S  WP         H TL     GE++ ++  +  
Sbjct  123  FLLEPRNLNSLQSLLLFHVLPARLPSGSWP-----AAATHPTLA----GEDVELAAADGG  173

Query  543  G------AKVVSLDDVVRPDGIIHGIERVLIP  620
            G      A V   D VVR DG+IHGI+R+L+P
Sbjct  174  GGMRVAHAAVSRPDAVVRTDGVIHGIDRLLVP  205



>ref|XP_010090522.1| hypothetical protein L484_017146 [Morus notabilis]
 gb|EXB39671.1| hypothetical protein L484_017146 [Morus notabilis]
Length=459

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 111/152 (73%), Gaps = 11/152 (7%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFK  359
            QINSNSVLVALLDSHYTEL+EL+EKALLLQTLE+ V  HN+TIFAPRNEAL+R LDP+FK
Sbjct  40   QINSNSVLVALLDSHYTELAELLEKALLLQTLEDLVGSHNLTIFAPRNEALDRALDPDFK  99

Query  360  RFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENS-----RRGGRNHITLCRDAGGENLVV  524
            RFLL+P NL SLQN++LFH+IP +I S+ W   S     +    + I L R   G+  V 
Sbjct  100  RFLLEPRNLVSLQNIILFHVIPNKIGSQQWKLQSGSTRLKTLSNDEIRLERGDSGDWTVD  159

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            S      A+V   D V RPDG+IHGIER+L+P
Sbjct  160  S------ARVTHPDSVTRPDGVIHGIERMLVP  185



>ref|XP_006592365.1| PREDICTED: fasciclin-like arabinogalactan protein 16-like [Glycine 
max]
Length=453

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 19/163 (12%)
 Frame = +3

Query  171  SGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDP  350
            S  QINSNS+LVALLDSHYTE++ELVEKA+LLQTLE  V  +NITIFAPRNEALERDLDP
Sbjct  23   SQGQINSNSILVALLDSHYTEVAELVEKAMLLQTLENTVMNNNITIFAPRNEALERDLDP  82

Query  351  EFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRN-------------HITL  491
            +FKRFLL+P NL+SLQ LLL H++P RI    +   +   GR+             H+TL
Sbjct  83   DFKRFLLEPRNLQSLQTLLLSHIVPKRIIKPEYLTGTGNPGRSNNPTRHRTLAPNHHLTL  142

Query  492  CRDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                  ++L ++   V  ++V++ D V RPDG+IHGI+ +LIP
Sbjct  143  ------QSLNLTHWNVDSSRVMNPDSVTRPDGVIHGIDTLLIP  179



>ref|NP_001051505.1| Os03g0788700 [Oryza sativa Japonica Group]
 gb|AAT75257.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99260.1| beta-Ig-H3 domain-containing protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13419.1| Os03g0788700 [Oryza sativa Japonica Group]
 dbj|BAG93670.1| unnamed protein product [Oryza sativa Japonica Group]
Length=479

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 110/152 (72%), Gaps = 15/152 (10%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            I SNSVLVALLDS YTE++ELVEKALLLQ LE+AV+ HN+TI APRNEALERD+DPEFKR
Sbjct  63   IVSNSVLVALLDSRYTEMAELVEKALLLQALEDAVAEHNVTILAPRNEALERDIDPEFKR  122

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVS  542
            FLL+P NL SLQ+LLLFH++P R+ S  WP  +      H TL     GE++ ++  +  
Sbjct  123  FLLEPRNLNSLQSLLLFHVLPARLPSGSWPAAA-----THPTLA----GEDVELAAADGG  173

Query  543  G------AKVVSLDDVVRPDGIIHGIERVLIP  620
            G      A V   D VVR DG+IHGI+R+L+P
Sbjct  174  GGMRVAHAAVSRPDAVVRTDGVIHGIDRLLVP  205



>gb|EAY92117.1| hypothetical protein OsI_13824 [Oryza sativa Indica Group]
Length=494

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 109/152 (72%), Gaps = 15/152 (10%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            I SNSVLVALLDS YTE++ELVEKALLLQ LE+AV+ HN+TI APRNEALERD+DPEFKR
Sbjct  63   IVSNSVLVALLDSRYTEMAELVEKALLLQALEDAVAEHNVTILAPRNEALERDIDPEFKR  122

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVS  542
            FLL+P NL SLQ+LLLFH++P R+ S  WP         H TL     GE++ ++  +  
Sbjct  123  FLLEPRNLNSLQSLLLFHVLPARLPSGSWP-----AAATHPTLA----GEDVELAAADGG  173

Query  543  G------AKVVSLDDVVRPDGIIHGIERVLIP  620
            G      A V   D VVR DG+IHGI+R+L+P
Sbjct  174  GGMRVAHAAVSRPDAVVRTDGVIHGIDRLLVP  205



>gb|AAO24903.1| putative arabinogalactan-protein [Oryza sativa Japonica Group]
 gb|EAZ28848.1| hypothetical protein OsJ_12883 [Oryza sativa Japonica Group]
Length=494

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 109/152 (72%), Gaps = 15/152 (10%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            I SNSVLVALLDS YTE++ELVEKALLLQ LE+AV+ HN+TI APRNEALERD+DPEFKR
Sbjct  63   IVSNSVLVALLDSRYTEMAELVEKALLLQALEDAVAEHNVTILAPRNEALERDIDPEFKR  122

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVS  542
            FLL+P NL SLQ+LLLFH++P R+ S  WP         H TL     GE++ ++  +  
Sbjct  123  FLLEPRNLNSLQSLLLFHVLPARLPSGSWP-----AAATHPTLA----GEDVELAAADGG  173

Query  543  G------AKVVSLDDVVRPDGIIHGIERVLIP  620
            G      A V   D VVR DG+IHGI+R+L+P
Sbjct  174  GGMRVAHAAVSRPDAVVRTDGVIHGIDRLLVP  205



>ref|XP_002461483.1| hypothetical protein SORBIDRAFT_02g003410 [Sorghum bicolor]
 gb|EER98004.1| hypothetical protein SORBIDRAFT_02g003410 [Sorghum bicolor]
Length=471

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 102/141 (72%), Gaps = 11/141 (8%)
 Frame = +3

Query  198  VLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQP  377
            VLVALLDS YTELSELVEKALLLQ LE AV R N+TI APRNEALERDLDPEF+RFLL+P
Sbjct  58   VLVALLDSRYTELSELVEKALLLQPLETAVGRGNVTILAPRNEALERDLDPEFRRFLLEP  117

Query  378  GNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVSGAKVV  557
             NL SLQ+LLLFH++P R+ +      S    R+H TL     GE L +    VS A V 
Sbjct  118  RNLPSLQSLLLFHVLPARLHAA-----SLLSRRHHPTLA----GEPLELGP-AVSRA-VT  166

Query  558  SLDDVVRPDGIIHGIERVLIP  620
              D VVR DG+IHG++R+L+P
Sbjct  167  RPDAVVRADGVIHGVDRLLVP  187



>ref|XP_006658293.1| PREDICTED: fasciclin-like arabinogalactan protein 15-like [Oryza 
brachyantha]
Length=412

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 88/118 (75%), Gaps = 5/118 (4%)
 Frame = +3

Query  168  SSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            ++   +NSNSVLVALLDSHYTEL+ELVEKALLLQ LE+AV R N+TIFAPRNEALERDLD
Sbjct  45   ATATGVNSNSVLVALLDSHYTELAELVEKALLLQALEDAVGRGNVTIFAPRNEALERDLD  104

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIE-----SKHWPENSRRGGRNHITLCRDAG  506
            PEF+RFLL+P NLRSLQ LLLFH++P RI      +   P +       H+ L R  G
Sbjct  105  PEFRRFLLEPRNLRSLQQLLLFHVLPARIHASDAAASSLPSSHPTLSGEHVELARGDG  162



>gb|KHN41248.1| Fasciclin-like arabinogalactan protein 16 [Glycine soja]
Length=265

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 3/102 (3%)
 Frame = +3

Query  153  PSRNLS-SGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAV--SRHNITIFAPRN  323
            P+   S S  QINSNS+LVALLDSHYTEL+ELVEKA+LLQTLE  V  + +NITIFAPRN
Sbjct  16   PTLTFSISQGQINSNSILVALLDSHYTELAELVEKAMLLQTLENTVMNNSNNITIFAPRN  75

Query  324  EALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHW  449
            EALERDLDP+FKRFLL+P NL SLQ LLL H++P RI    +
Sbjct  76   EALERDLDPDFKRFLLEPRNLHSLQTLLLSHIVPKRITKPEF  117



>gb|KHN21208.1| Fasciclin-like arabinogalactan protein 18 [Glycine soja]
Length=223

 Score =   127 bits (318),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +3

Query  162  NLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERD  341
            +LS G QINSNS+LVALLDSHYTE++ELVEKA+LLQTLE  V  +NITIFAPRNEALERD
Sbjct  21   SLSQG-QINSNSILVALLDSHYTEVAELVEKAMLLQTLENTVMNNNITIFAPRNEALERD  79

Query  342  LDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGR  476
            LDP+FKRFLL+P NL+SLQ LLL H++P RI    +   +   GR
Sbjct  80   LDPDFKRFLLEPRNLQSLQTLLLSHIVPKRIIKPEYLTGTGNPGR  124



>ref|XP_002992031.1| hypothetical protein SELMODRAFT_23020, partial [Selaginella moellendorffii]
 gb|EFJ06880.1| hypothetical protein SELMODRAFT_23020, partial [Selaginella moellendorffii]
Length=372

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 92/149 (62%), Gaps = 9/149 (6%)
 Frame = +3

Query  183  INSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKR  362
            + S SVL ALL+S  TE+ ELVE+A +L+ LE A  RHN+TIFAPR+E LE   D +F+R
Sbjct  3    VASKSVLAALLESPATEMMELVEQAGMLEALELAADRHNLTIFAPRDEFLELHFDADFRR  62

Query  363  FLLQPGNLRSLQNLLLFHMIPTRIESKHWPEN---SRRGGRNHITLCRDAGGENLVVSER  533
            FLL PGN+R LQ L++FH++P RI +  W      S  G R+ + L  D   + L V   
Sbjct  63   FLLLPGNVRFLQELVMFHVLPIRITASQWRSGRFQSLSGSRDEVLLHWDK-KQRLAVDRS  121

Query  534  EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             V        D +VR DG++H I+ +L+P
Sbjct  122  TVDWP-----DMIVRSDGVVHRIDGLLVP  145



>ref|XP_002964493.1| hypothetical protein SELMODRAFT_64323, partial [Selaginella moellendorffii]
 gb|EFJ34826.1| hypothetical protein SELMODRAFT_64323, partial [Selaginella moellendorffii]
Length=400

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 95/161 (59%), Gaps = 9/161 (6%)
 Frame = +3

Query  147  ENPSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNE  326
            ++P    S    +   SVL ALL+S  TE+ ELVE+A +L+ LE A  RHN+TIFAPR+E
Sbjct  21   DHPPAPSSGAGNVALKSVLAALLESPATEMMELVEQAGMLEALELAADRHNLTIFAPRDE  80

Query  327  ALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPEN---SRRGGRNHITLCR  497
             LE   D +F+RFLL PGN+R LQ L++FH++P RI +  W      S  G R+ + L  
Sbjct  81   FLELHFDADFRRFLLLPGNVRFLQELVMFHVLPIRITASQWRSGRFQSLSGSRDEVLLHW  140

Query  498  DAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +   + L V    V        D +VR DG++H I+ +L+P
Sbjct  141  NK-KQRLAVDRSTVDWP-----DMIVRSDGVVHRIDGLLVP  175



>gb|KHN43596.1| Fasciclin-like arabinogalactan protein 15 [Glycine soja]
Length=298

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  198  VLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQP  377
            +LVALLDSHYTEL+ELVEKALLLQ LEEAV  HNITIFAPRN+ALERDLDPEFKRFLL+P
Sbjct  49   ILVALLDSHYTELAELVEKALLLQKLEEAVGNHNITIFAPRNQALERDLDPEFKRFLLEP  108

Query  378  GNLR  389
             NLR
Sbjct  109  RNLR  112



>gb|EMT06107.1| Fasciclin-like arabinogalactan protein 16 [Aegilops tauschii]
Length=205

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 94/154 (61%), Gaps = 22/154 (14%)
 Frame = +3

Query  174  GAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPE  353
            GA++NSNSVLVALL+S  TEL   VEK L+L TLE A S +NITIFAP N+   RDL+  
Sbjct  51   GARVNSNSVLVALLNSQCTEL---VEKTLMLLTLEGARSCNNITIFAPWNDVFVRDLE--  105

Query  354  FKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-----AGGENL  518
              RFLL+  NLRSLQ+L LFH++P +  +  W   S      H TL  +     AG +  
Sbjct  106  --RFLLELRNLRSLQSLFLFHVLPAQHPAGSWSAAS------HHTLFGEEVKLTAGADGT  157

Query  519  VVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +     V+ A V   + V RP+G IHG ER+L+P
Sbjct  158  M----RVAHAAVTLQNTVHRPEGAIHGTERLLVP  187



>gb|AEW07983.1| hypothetical protein 0_16121_01, partial [Pinus radiata]
 gb|AFG49325.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49326.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49327.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49329.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49331.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49332.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49333.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49334.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49336.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49338.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49339.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49340.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49341.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
Length=145

 Score =   103 bits (257),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 10/118 (8%)
 Frame = +3

Query  276  EEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPE  455
            EE VS +NITI AP+N  LE++LDPEFKRF+ +PGNL SLQ LL  H+IP RI ++ W  
Sbjct  1    EEMVSNNNITIVAPQNAHLEKNLDPEFKRFMGEPGNLNSLQRLLQAHIIPRRITAEEWSN  60

Query  456  NSRRGGRNHITLCRDAGGENLVVSEREVSGAKVVSL---DDVVRPDGIIHGIERVLIP  620
            N+      H  L +DA      V E  V    +  L   +  VRPDG+IHGI+R+L+P
Sbjct  61   NA-----THEALSKDA--LQFSVKENNVKTVDLAVLTHPNAAVRPDGVIHGIDRLLVP  111



>gb|AFG49337.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
Length=145

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 10/118 (8%)
 Frame = +3

Query  276  EEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPE  455
            EE VS +NITI AP+N  LE++LDPEFKRF+ +PGNL SLQ LL  H+IP RI ++ W  
Sbjct  1    EEMVSNNNITIVAPQNAHLEKNLDPEFKRFMGEPGNLNSLQRLLQAHIIPRRITAEEWSN  60

Query  456  NSRRGGRNHITLCRDAGGENLVVSEREVSGAKVVSL---DDVVRPDGIIHGIERVLIP  620
            N+      H  L +DA      V E  V    +  L   +  VRPDG+IHGI+R+L+P
Sbjct  61   NA-----THEALSKDA--LQFSVKENNVKTVDLAVLTHPNAAVRPDGVIHGIDRLLVP  111



>gb|AFG49328.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
Length=145

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 74/118 (63%), Gaps = 10/118 (8%)
 Frame = +3

Query  276  EEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPE  455
            EE VS +NITI AP+N  LE++LDPEFKRF+ +PGNL SLQ LL  H+IP RI ++ W  
Sbjct  1    EEMVSNNNITIVAPQNAHLEKNLDPEFKRFMGEPGNLNSLQRLLQAHIIPRRITAEEWSN  60

Query  456  NSRRGGRNHITLCRDAGGENLVVSEREVSGAKVVSL---DDVVRPDGIIHGIERVLIP  620
            N+ R       L +DA      V E  V    +  L   +  VRPDG+IHGI+R+L+P
Sbjct  61   NATREA-----LSKDA--LQFSVKENNVKTVDLAVLTHPNAAVRPDGVIHGIDRLLVP  111



>ref|XP_002990854.1| hypothetical protein SELMODRAFT_44414, partial [Selaginella moellendorffii]
 gb|EFJ08127.1| hypothetical protein SELMODRAFT_44414, partial [Selaginella moellendorffii]
Length=381

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 88/141 (62%), Gaps = 6/141 (4%)
 Frame = +3

Query  198  VLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQP  377
            VL AL++S YTEL EL+  A +L+ LE+ V + +ITIFAPRN  +E+ +D EFK FLL+P
Sbjct  21   VLAALMESQYTELMELMGHAGMLEPLEKVVGKGSITIFAPRNAYMEQQVDSEFKHFLLEP  80

Query  378  GNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVSGAKVV  557
            GN++ L+ +L  H++P +I S+ W   + R             G N V    E+S  +V 
Sbjct  81   GNIKHLRQVLKHHIVPGKIMSEDWSNRTVRTLSTETVRIHSHRGINRV----ELS--EVT  134

Query  558  SLDDVVRPDGIIHGIERVLIP  620
            S +D+ + DG++HG+  +L+P
Sbjct  135  SPNDINKKDGVVHGVNGLLVP  155



>ref|XP_002974338.1| hypothetical protein SELMODRAFT_54466, partial [Selaginella moellendorffii]
 gb|EFJ24560.1| hypothetical protein SELMODRAFT_54466, partial [Selaginella moellendorffii]
Length=381

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 88/141 (62%), Gaps = 6/141 (4%)
 Frame = +3

Query  198  VLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQP  377
            VL AL++S YTEL EL+  A +L+ LE+ V + +ITIFAPRN  +E+ +D EFK FLL+P
Sbjct  21   VLAALMESQYTELMELMGHAGMLEPLEKVVGKGSITIFAPRNAYMEQQVDSEFKHFLLEP  80

Query  378  GNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGENLVVSEREVSGAKVV  557
            GN++ L+ +L  H++P +I S+ W   + R             G N V    E+S  +V 
Sbjct  81   GNIKHLRQVLKHHIVPGKIMSEDWSNRTVRTLSTETVRIHSHRGINRV----ELS--EVT  134

Query  558  SLDDVVRPDGIIHGIERVLIP  620
            S +D+ + DG++HG+  +L+P
Sbjct  135  SPNDINKKDGVVHGVNGLLVP  155



>gb|AFG49330.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
 gb|AFG49335.1| hypothetical protein 0_16121_01, partial [Pinus taeda]
Length=145

 Score =   100 bits (250),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 73/118 (62%), Gaps = 10/118 (8%)
 Frame = +3

Query  276  EEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPE  455
            EE VS +NITI AP+N  L ++LDPEFKRF+ +PGNL SLQ LL  H+IP RI ++ W  
Sbjct  1    EEMVSNNNITIVAPQNAHLGKNLDPEFKRFMGEPGNLNSLQRLLQAHIIPRRITAEEWSN  60

Query  456  NSRRGGRNHITLCRDAGGENLVVSEREVSGAKVVSL---DDVVRPDGIIHGIERVLIP  620
            N+      H  L +DA      V E  V    +  L   +  VRPDG+IHGI+R+L+P
Sbjct  61   NA-----THEALSKDA--LQFSVKENNVKTVDLAVLTHPNAAVRPDGVIHGIDRLLVP  111



>ref|XP_001766851.1| predicted protein [Physcomitrella patens]
 gb|EDQ68253.1| predicted protein, partial [Physcomitrella patens]
Length=373

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 88/149 (59%), Gaps = 8/149 (5%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLE-EAVSRHNITIFAPRNEALERDLDPEF  356
            ++ + SVL ALLDS Y+E+   ++KA +L+ LE E + R  IT+FAP+N  LE+ +D + 
Sbjct  1    RLGTGSVLQALLDSQYSEMVLYLDKADMLEELEREVLRRGAITVFAPKNSYLEQQVDADL  60

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRG-GRNHITLCRDAGGENLVVSER  533
             RFL++PG+   L+ LL  H+IP R+E   +   +       ++   R  G       +R
Sbjct  61   WRFLMRPGHEAYLRTLLKHHVIPGRVEGADFQNRTVETLASGNVVGLRSHG------LKR  114

Query  534  EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             V  A+V S + +VR DGI+HG++  +IP
Sbjct  115  YVESARVFSPNSIVRKDGIVHGLDGFMIP  143



>ref|XP_001784356.1| predicted protein [Physcomitrella patens]
 gb|EDQ50825.1| predicted protein [Physcomitrella patens]
Length=400

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 90/152 (59%), Gaps = 9/152 (6%)
 Frame = +3

Query  180  QINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHN-ITIFAPRNEALERDLDPEF  356
            ++ + SVL ALLDS Y+E+   ++KA +L+ LE  V R   IT+FAP+N  LE+ LD + 
Sbjct  27   RLGTGSVLQALLDSQYSEMVLYLDKADMLEELEREVLRQKAITLFAPKNSHLEQ-LDADL  85

Query  357  KRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCR-DAGGENLVVSER  533
             RFL++PG+   L+ +L +H+IP R+E   +        R   TL + D  G      +R
Sbjct  86   GRFLMRPGHEEYLRTVLRYHVIPGRVEGADFQN------RTVETLSKGDVVGLRTYGLKR  139

Query  534  EVSGAKVVSLDDVVRPDGIIHGIERVLIPSRC  629
             V   +V S + +VR DGI+HG++ +++P + 
Sbjct  140  YVGLLRVFSPNSIVRKDGIVHGVDGLMVPPKV  171



>ref|XP_006388223.1| hypothetical protein POPTR_0276s00200g, partial [Populus trichocarpa]
 gb|ERP47137.1| hypothetical protein POPTR_0276s00200g, partial [Populus trichocarpa]
Length=273

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 59/92 (64%), Gaps = 18/92 (20%)
 Frame = +3

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRD-------AGGENLVV  524
            +L+PGNL+SLQ LLL+H++P RI   H   NS    ++H TLCRD         GE L+ 
Sbjct  29   VLEPGNLKSLQTLLLYHIVPNRINPSH---NSSL--QHHRTLCRDRVKLSSQESGEKLID  83

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            S      AK++ ++ V RPDG+IHGIER+LIP
Sbjct  84   S------AKIIQVNAVERPDGVIHGIERLLIP  109



>ref|WP_027101725.1| fasciclin [Comamonadaceae bacterium URHA0028]
Length=204

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 75/140 (54%), Gaps = 12/140 (9%)
 Frame = +3

Query  225  YTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNL  404
            +T L   V+ A L+ TL+ A      T+FAP NEA    L       LL+P N  +L  +
Sbjct  69   HTTLVAAVKAAGLVDTLKGA---GPFTVFAPTNEAFAA-LPAGTVDTLLKPENKGTLAKV  124

Query  405  LLFHMIPTRIESKHWPENSRRGGRNHI-------TLCRDAGGENLVVSEREVSGAKVVSL  563
            L +H++P RI++K   +  + GG   I       TL     G N+++++ +  GA  V++
Sbjct  125  LTYHVVPGRIDAKALAQQIQAGGGKAILKTASGGTLTATMSGSNVLITDGK-GGAATVTI  183

Query  564  DDVVRPDGIIHGIERVLIPS  623
             DV + +G+IH + +VL+P+
Sbjct  184  ADVYQSNGVIHVVNKVLLPA  203



>ref|WP_039118704.1| fasciclin [Flavobacterium sp. JRM]
 gb|KIC01588.1| fasciclin [Flavobacterium sp. JRM]
Length=185

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 83/154 (54%), Gaps = 12/154 (8%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            N N +  A+    +T L   V+ A L++TLE   S+   T+FAP NEA  + L       
Sbjct  36   NKNIIENAVNSKDHTTLVAAVKAAGLVETLE---SKGPFTVFAPTNEAFNK-LPKGTVET  91

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHI-------TLCRDAGGENLVV  524
            LL+P N+++LQN+L +H++  ++ +    +  + GG           TL     G++L +
Sbjct  92   LLKPENIKTLQNILTYHVVAGKMNAADIAKAIKMGGGKATLKTVSGGTLTAWMKGKDLYI  151

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIPSR  626
            S+   + AK V++ DV + +G+IH I+ VL+P +
Sbjct  152  SDESGNKAK-VTIADVNQSNGVIHVIDTVLLPKK  184



>ref|WP_039115355.1| fasciclin [Flavobacterium sp. KMS]
 gb|KIA95027.1| fasciclin [Flavobacterium sp. KMS]
Length=184

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 83/154 (54%), Gaps = 12/154 (8%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            N N +  A+    +T L   V+ A L++TLE   S+   T+FAP NEA  + L       
Sbjct  36   NKNIIENAVNSKDHTTLVAAVKAAGLVETLE---SKGPFTVFAPTNEAFNK-LPKGTVET  91

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHI-------TLCRDAGGENLVV  524
            LL+P N+++LQN+L +H++  ++ +    +  + GG           TL     G++L +
Sbjct  92   LLKPENIKTLQNILTYHVVAGKMNAADIAKAIKMGGGKATLKTVSGGTLTAWMKGKDLYI  151

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIPSR  626
            S+   + AK V++ DV + +G+IH I+ VL+P +
Sbjct  152  SDESGNKAK-VTIADVNQSNGVIHVIDTVLLPKK  184



>ref|WP_035621627.1| fasciclin [Flavobacterium hydatis]
 gb|KFF16610.1| fasciclin [Flavobacterium hydatis]
Length=184

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 47/154 (31%), Positives = 81/154 (53%), Gaps = 12/154 (8%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            N N +  A+    +T L   V+ A L++TLE    +   T+FAP NEA  + L       
Sbjct  36   NKNIIENAVNSKDHTTLVAAVKAAGLVETLE---GKGPFTVFAPTNEAFNK-LPKGTVES  91

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHI-------TLCRDAGGENLVV  524
            LL+P N++ LQN+L +H++  ++ +    +  + GG   +       TL     G++L +
Sbjct  92   LLKPENIKMLQNILTYHVVAGKMNASDIAKAIKAGGGKAMLKTVSGGTLTAWMKGKDLYI  151

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIPSR  626
            S+   + AK V++ DV + +G+IH I  VL+P +
Sbjct  152  SDESGNKAK-VTIADVNQSNGVIHVINTVLLPKK  184



>ref|WP_025139515.1| fasciclin [Achromobacter sp. DH1f]
Length=181

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 80/163 (49%), Gaps = 22/163 (13%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            PS+N+ + A +NS         + +T L   V+ A L+ TL+    +   T+FAP N A 
Sbjct  33   PSKNIVANA-VNS---------ADHTTLVAAVKAAGLVDTLQ---GKGPFTVFAPTNAAF  79

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA---  503
             + L P     L++P N  +L  +L +H++P +++       +++GG   +T        
Sbjct  80   NK-LPPGTVDTLVKPENKATLTKILTYHVVPGKLDFDALAAKAKKGGVTELTTASGGKLW  138

Query  504  ----GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                G  NL V + E  G   +S  DV + +G+IH I+ VL+P
Sbjct  139  VMMNGKHNLTVKD-EKGGVANISTYDVYQSNGVIHVIDSVLMP  180



>ref|WP_035173683.1| hypothetical protein, partial [Calothrix sp. PCC 7103]
Length=208

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 81/162 (50%), Gaps = 17/162 (10%)
 Frame = +3

Query  153  PSRNLSSGAQI-----NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAP  317
            PS N S+ A+      N N + VA     +T L++ VE A L  TL +     N TIFAP
Sbjct  57   PSTNQSTPAKTPTNAANENLLQVAQSSGTFTTLAQAVEAAGLSNTLSDG----NFTIFAP  112

Query  318  RNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCR  497
             ++A    L     +FLL+P N   L+ +L +H++  R+ +      S +     + + +
Sbjct  113  TDQAFSSSLPQGALQFLLEPQNKDLLRQVLSYHVVAGRVPANKLRSGSVKTLGGGVAVRK  172

Query  498  DAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIPS  623
               GE ++V++  V+ A      D+   +G+IH + RVL+PS
Sbjct  173  T--GEKVIVNDASVTQA------DIKASNGVIHAVNRVLLPS  206



>ref|WP_042566888.1| fasciclin [Flavobacterium sp. MEB061]
 gb|KIQ14523.1| fasciclin [Flavobacterium sp. MEB061]
Length=184

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 84/153 (55%), Gaps = 14/153 (9%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            N N V  A+    +T L   V+ A L++TL+   S+   T+FAP N A ++ L       
Sbjct  36   NKNIVENAVNSKDHTTLVAAVKAAGLVETLQ---SKGPFTVFAPTNAAFDK-LPAGTVET  91

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAG--------GENLV  521
            LL+P N+++LQ +L +H++  ++ +    + + + G+   TL   +G        G++L 
Sbjct  92   LLKPENIKTLQTVLTYHVVAGKMNASDIAK-AIKAGKGKATLKTVSGGTLTAWMDGKDLY  150

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +S+   S AK V++ DV + +G+IH ++ VL+P
Sbjct  151  ISDESGSKAK-VTIADVNQSNGVIHVVDTVLLP  182



>ref|WP_035643556.1| fasciclin [Flavobacterium sp. Fl]
Length=184

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/154 (30%), Positives = 82/154 (53%), Gaps = 12/154 (8%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            N N V  A+    +T L   V+ A L++TL+   S+   T+FAP NEA E+ L       
Sbjct  36   NKNIVENAVNSKDHTTLVAAVKAAGLVETLQ---SKGPFTVFAPTNEAFEK-LPKGTVET  91

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHI-------TLCRDAGGENLVV  524
            LL+P N++ LQ +L +H++  ++ +    +  + G    +       TL     G++L +
Sbjct  92   LLKPENIKMLQTILTYHVVAGKMNASDIAKAIKMGKGKAVLKTVSGGTLTAWMDGKDLYI  151

Query  525  SEREVSGAKVVSLDDVVRPDGIIHGIERVLIPSR  626
            S+   + AKV ++ DV + +G+IH ++ VL+P +
Sbjct  152  SDESGNKAKV-TIADVNQSNGVIHVVDTVLLPKK  184



>ref|WP_035625480.1| fasciclin [Flavobacterium hydatis]
 gb|KFF12641.1| fasciclin [Flavobacterium hydatis]
Length=184

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 82/153 (54%), Gaps = 14/153 (9%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            N N +  A+    +T L   V+ A L++TL+   S+   T+FAP NEA  + L       
Sbjct  36   NKNIIENAVNSKDHTTLVAAVKAAGLVETLQ---SKGPFTVFAPTNEAFNK-LPAGTVET  91

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAG--------GENLV  521
            LL+P N++SLQ +L +H++  ++ S    + + + G+    L   +G        G++L 
Sbjct  92   LLKPENIKSLQTILTYHVVAGKMNSSDIAK-AIKAGKGKAALKTVSGGTLTAWMDGKDLY  150

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +S+   + AKV +  DV + +G+IH ++ VL+P
Sbjct  151  ISDESGNKAKVTT-SDVNQSNGVIHVVDTVLLP  182



>ref|WP_035688618.1| fasciclin [Flavobacterium reichenbachii]
 gb|KFF03232.1| fasciclin [Flavobacterium reichenbachii]
Length=184

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 83/153 (54%), Gaps = 14/153 (9%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            N N +  A+    +T L   V+ A L++TL+    +   T+FAP NEA  + L       
Sbjct  36   NKNIIENAVNSKDHTTLVAAVKAAGLVETLQ---GKGPFTVFAPTNEAFSK-LPAGTVET  91

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAG--------GENLV  521
            LL+P N+++LQ +L +H++  ++ S    + + + G+   TL   +G        G++L 
Sbjct  92   LLKPENIKTLQTILTYHVVSGKMNSSDIAK-AIKAGKGKATLKTVSGGTLTAWMDGKDLY  150

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +S+   + AK V++ DV + +G+IH ++ VL+P
Sbjct  151  ISDESGNKAK-VTISDVNQSNGVIHVVDTVLLP  182



>gb|AEG94766.1| Conserved hypothetical protein [Ramlibacter tataouinensis TTB310]
Length=198

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 71/139 (51%), Gaps = 12/139 (9%)
 Frame = +3

Query  225  YTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNL  404
            +T L   V+ A L+ TL+   S    T+FAP N A    L       LL+P N  +L  +
Sbjct  64   HTTLVAAVKAAGLVDTLK---SPGPFTVFAPTNAAFSA-LPAGTVDTLLKPENKATLTKV  119

Query  405  LLFHMIPTRIESKHWPENSRRGGRNHI-------TLCRDAGGENLVVSEREVSGAKVVSL  563
            L +H++P R+++       + GG   +       TL     G N+++++ +  GA  V++
Sbjct  120  LTYHVVPGRVDAAALARQIQAGGGKAMLKTASGGTLTATMSGPNVLITDDK-GGAATVTI  178

Query  564  DDVVRPDGIIHGIERVLIP  620
             DV + +G+IH + +VL+P
Sbjct  179  ADVYQSNGVIHVVNKVLLP  197



>ref|WP_041676596.1| fasciclin [Ramlibacter tataouinensis]
Length=178

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 71/139 (51%), Gaps = 12/139 (9%)
 Frame = +3

Query  225  YTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQNL  404
            +T L   V+ A L+ TL+   S    T+FAP N A    L       LL+P N  +L  +
Sbjct  44   HTTLVAAVKAAGLVDTLK---SPGPFTVFAPTNAAFSA-LPAGTVDTLLKPENKATLTKV  99

Query  405  LLFHMIPTRIESKHWPENSRRGGRNHI-------TLCRDAGGENLVVSEREVSGAKVVSL  563
            L +H++P R+++       + GG   +       TL     G N+++++ +  GA  V++
Sbjct  100  LTYHVVPGRVDAAALARQIQAGGGKAMLKTASGGTLTATMSGPNVLITDDK-GGAATVTI  158

Query  564  DDVVRPDGIIHGIERVLIP  620
             DV + +G+IH + +VL+P
Sbjct  159  ADVYQSNGVIHVVNKVLLP  177



>ref|WP_040326723.1| beta-Ig-H3/fasciclin [Aurantimonas manganoxydans]
Length=180

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 81/164 (49%), Gaps = 18/164 (11%)
 Frame = +3

Query  165  LSSGAQINSNSVLV--ALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALER  338
            +  GA+++    +V  A   S+ T L   V+ A L +TL         T+FAP NEA E+
Sbjct  23   MVGGAEMSPEKTIVENASAASNLTTLVAAVKAAGLAETLS---GEGPFTVFAPTNEAFEK  79

Query  339  DLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNH---------ITL  491
              D      LL+P N   L  +L +H++P +  S+   +     G  H         ITL
Sbjct  80   LPDGTVDD-LLKPENKEKLAKILTYHVVPAKASSEAAMKMIEDDGGKHPAPTVAGENITL  138

Query  492  CRDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIPS  623
              D  G+N+VV +   + A V+   DV++ +G++H I+ VL+PS
Sbjct  139  GMD--GDNIVVMDAAGNTATVIQA-DVMQSNGVVHVIDTVLMPS  179



>ref|WP_031527389.1| fasciclin [Dyadobacter crusticola]
Length=317

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/144 (33%), Positives = 73/144 (51%), Gaps = 10/144 (7%)
 Frame = +3

Query  204  VALLDSHYTELSELVEKA--LLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQP  377
            +A  D+++TEL  LV  A   +   L  A S   +T+FAP N A         K  LL P
Sbjct  179  IAQADTNFTELVSLVLAADPAVATALSSATS--GLTVFAPTNAAFRELYRTTPKATLLAP  236

Query  378  GNLRSLQNLLLFHMIPTRIESKHWPENSR--RGGRNHITLCRD-AGGENLVVSEREVSGA  548
             N   L ++LL+H++P R+ S   P  +        + TL  D AGG  +V      SGA
Sbjct  237  ANRALLTSVLLYHVLPNRVFSTDLPNVTAPVTTANTNGTLTFDLAGGAKVV---GATSGA  293

Query  549  KVVSLDDVVRPDGIIHGIERVLIP  620
              ++  +++  +G+IH I++VL+P
Sbjct  294  SNITAANILATNGVIHVIDKVLMP  317



>ref|WP_035694679.1| beta-Ig-H3/fasciclin [Aurantimonas coralicida]
Length=180

 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 80/161 (50%), Gaps = 18/161 (11%)
 Frame = +3

Query  174  GAQINSNSVLV--ALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLD  347
            GA+++    +V  A   S+ T L   V+ A L +TL         T+FAP NEA E+  D
Sbjct  26   GAEMSPEKTIVENASAASNLTTLVAAVKAAGLAETLS---GEGPFTVFAPTNEAFEKLPD  82

Query  348  PEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNH---------ITLCRD  500
                  LL+P N   L  +L +H++P +  S+   +     G  H         ITL  D
Sbjct  83   GTVDD-LLKPENKEKLAKILTYHVVPAKASSEAAMKMIEDDGGKHPAPTVAGENITLGMD  141

Query  501  AGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIPS  623
              G+N+VV +   + A V+   DV++ +G++H I+ VL+PS
Sbjct  142  --GDNIVVMDAAGNTATVIQA-DVMQSNGVVHVIDTVLMPS  179



>gb|EAS49051.1| conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1]
Length=190

 Score = 64.7 bits (156),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 81/164 (49%), Gaps = 18/164 (11%)
 Frame = +3

Query  165  LSSGAQINSNSVLV--ALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALER  338
            +  GA+++    +V  A   S+ T L   V+ A L +TL         T+FAP NEA E+
Sbjct  33   MVGGAEMSPEKTIVENASAASNLTTLVAAVKAAGLAETLS---GEGPFTVFAPTNEAFEK  89

Query  339  DLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNH---------ITL  491
              D      LL+P N   L  +L +H++P +  S+   +     G  H         ITL
Sbjct  90   LPDGTVDD-LLKPENKEKLAKILTYHVVPAKASSEAAMKMIEDDGGKHPAPTVAGENITL  148

Query  492  CRDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIPS  623
              D  G+N+VV +   + A V+   DV++ +G++H I+ VL+PS
Sbjct  149  GMD--GDNIVVMDAAGNTATVIQA-DVMQSNGVVHVIDTVLMPS  189



>ref|WP_013930336.1| fasciclin [Runella slithyformis]
 gb|AEI51047.1| beta-Ig-H3/fasciclin [Runella slithyformis DSM 19594]
Length=315

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 75/148 (51%), Gaps = 13/148 (9%)
 Frame = +3

Query  198  VLVALLDSHYTELSELVEKA-LLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQ  374
            V VA  +++++EL  LV  A   + T   + S + +T+FAP N A         K  LL 
Sbjct  174  VQVAQGNTNFSELVSLVLAADPAVATALASASANGLTVFAPTNAAFTELYKTTPKATLLA  233

Query  375  PGNLRSLQNLLLFHMIPTRIESKHWP------ENSRRGGRNHITLCRDAGGENLVVSERE  536
            P N   L N+LL+H++P R+ S   P        +   G+    L   +GG  +V    +
Sbjct  234  PANKALLTNVLLYHVVPGRVFSTDLPNVSGEVTTANPAGKLTFNL---SGGAKVV---GK  287

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             SGA  ++  +++  +G++H I++VLIP
Sbjct  288  TSGASNITAANILATNGVVHVIDKVLIP  315



>ref|WP_011470727.1| fasciclin [Rhodopseudomonas palustris]
 gb|ABD85819.1| beta-Ig-H3/fasciclin [Rhodopseudomonas palustris BisB18]
Length=195

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 81/157 (52%), Gaps = 15/157 (10%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            PS+N+   A +NS           +T L   V+ A L++TLE   S+   T+FAP N A 
Sbjct  53   PSKNIVQNA-VNSK---------DHTTLVAAVKAAGLVETLE---SKGPFTVFAPTNAAF  99

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGE  512
             + L       L++P N  +L  +L +H++P ++E+    +  +       TL   A G 
Sbjct  100  AK-LPAGTVDNLIKPANKATLSKILTYHVVPGKLEAADLTDGKKLTTVEGETLTVKAAGG  158

Query  513  NLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIPS  623
             +++++ +  G   V++ +V + +G+IH ++ VL+P+
Sbjct  159  KVMLTDAK-GGTSTVTIANVNQSNGVIHVVDTVLMPA  194



>ref|WP_026985001.1| fasciclin [Flavobacterium sp. URHB0058]
Length=184

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 84/153 (55%), Gaps = 14/153 (9%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            N N V  A+    +T L   V+ A L++TL+   S+   T+FAP N A ++ L       
Sbjct  36   NKNIVENAVNSKDHTTLVAAVKAAGLVETLQ---SKGPFTVFAPTNAAFDK-LPAGTVET  91

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAG--------GENLV  521
            LL+P N+++LQ +L +H++  ++ S    + + + G+   TL   +G        G++L 
Sbjct  92   LLKPENIKTLQTILTYHVVAGKMNSSDIAK-AIKMGKGKATLKTVSGGTLTAWMDGKDLY  150

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +S+   + +K V++ DV + +G+IH ++ VL+P
Sbjct  151  ISDESGNKSK-VTIADVNQSNGVIHVVDTVLLP  182



>ref|WP_039348353.1| hypothetical protein [Chryseobacterium jeonii]
 gb|KIA90791.1| hypothetical protein OA86_01335 [Chryseobacterium jeonii]
Length=186

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 81/161 (50%), Gaps = 14/161 (9%)
 Frame = +3

Query  165  LSSGAQI--NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALER  338
            +  GAQ+  + N V  A+    +T L   V+ A L+ TLE   S+   T+FAP NEA  +
Sbjct  31   MVGGAQMYPSKNIVENAMNSKDHTTLVAAVKAAGLVGTLE---SKGPFTVFAPTNEAFAK  87

Query  339  DLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHIT-------LCR  497
             L       LL P N   L  +L +H++P +I SK      ++ G  ++        L  
Sbjct  88   -LPAGTVETLLMPENKEMLNKILTYHVVPGKISSKDLMTWIKKNGGKYMAKTVQGEELTF  146

Query  498  DAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
               G N+ V + + + AK+ ++ DV + +G+IH I+ VL+P
Sbjct  147  WMKGMNMYVKDAKGNSAKI-TIADVNQSNGVIHVIDTVLMP  186



>ref|WP_006383916.1| fasciclin [Achromobacter xylosoxidans]
 gb|EFV87715.1| beta-Ig-H3/fasciclin repeat containing protein [Achromobacter 
xylosoxidans C54]
 gb|AIR53262.1| fasciclin [Achromobacter xylosoxidans C54]
Length=181

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/163 (29%), Positives = 79/163 (48%), Gaps = 22/163 (13%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            P+RN+ + A +NS         + +T L   V+ A L+ TL+    +   T+FAP N A 
Sbjct  33   PARNIVANA-VNS---------ADHTTLVAAVKAAGLVDTLQ---GKGPFTVFAPTNAAF  79

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA---  503
             + L       L++P N  +L  +L +H++P +++       +R+GG   +         
Sbjct  80   AK-LPAGTVDNLVKPENKATLAKILTYHVVPGKLDFDALAARARKGGVTELATASGGKLW  138

Query  504  ----GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                G  NLVV + E  G   +S  DV + +G+IH I+ VL+P
Sbjct  139  VMMNGKHNLVVKD-EKGGVANISTYDVYQSNGVIHVIDTVLMP  180



>emb|CCH55845.1| beta-Ig-H3/fasciclin [Fibrisoma limi BUZ 3]
Length=179

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 80/164 (49%), Gaps = 24/164 (15%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            PS+N+   A +NS           +T L   V+ A L++TL+ A      T+FAP N+A 
Sbjct  30   PSKNIVDNA-VNSKD---------HTTLVAAVKAAELVETLQGA---GPFTVFAPTNKAF  76

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGE  512
            ++ L       LL+P N   LQ +L +H++P RI ++   +  + G  N     + A G 
Sbjct  77   DK-LPKGTVETLLKPENKSQLQGVLTYHVVPGRISAEDLMKMIKDG--NGKATLKTAAGG  133

Query  513  NLVVSER--------EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             L  + +        E  G   V++ DV + +G+IH ++ VL+P
Sbjct  134  TLTATMKGKKVEIVDENGGMSTVTIADVFQSNGVIHVVDTVLLP  177



>ref|WP_006390658.1| fasciclin [Achromobacter insuavis]
 gb|EGP47986.1| hypothetical protein AXXA_03052 [Achromobacter insuavis AXX-A]
Length=181

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 70/141 (50%), Gaps = 12/141 (9%)
 Frame = +3

Query  219  SHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGNLRSLQ  398
            + +T L   V+ A L+ TL+    +   T+FAP N A  + L       L++P N  +L 
Sbjct  45   ADHTTLVAAVKAAGLVDTLQ---GKGPFTVFAPTNAAFAK-LPAGTVDTLVKPENKATLT  100

Query  399  NLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA-------GGENLVVSEREVSGAKVV  557
             +L +H++P +++       +++GG   +T            G  NL+V + E  G   +
Sbjct  101  KILTYHVVPGKLDFDALAAKAKKGGVTELTTASGGKLWVMMNGKHNLIVKD-EKGGVANI  159

Query  558  SLDDVVRPDGIIHGIERVLIP  620
            S  DV + +G+IH I+ VL+P
Sbjct  160  STYDVYQSNGVIHVIDSVLMP  180



>ref|WP_008187750.1| fasciclin [Rhodobacteraceae bacterium HTCC2150]
 gb|EBA02093.1| hypothetical protein RB2150_00270 [Rhodobacterales bacterium 
HTCC2150]
Length=171

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 79/162 (49%), Gaps = 17/162 (10%)
 Frame = +3

Query  156  SRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALE  335
            S  LS+ A    N V +A  D+ ++ L   V+ A L +TL         T+FAP N+A  
Sbjct  13   SMALSACAAQADNIVEIAANDARFSTLVAAVQAAGLAETLS---GPGPFTVFAPLNDAFA  69

Query  336  RDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHIT-------LC  494
              L       LL+P N   L N+LL+H+   ++ S   P      G N+         LC
Sbjct  70   A-LPEGTVETLLKPENKGQLTNVLLYHVDDRKLTSNMIPT-----GSNYFKPILASERLC  123

Query  495  RDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              AG E + +++     AKVV + D++  +G+IH +++VL+P
Sbjct  124  ITAGAEGVSIADGTGDMAKVV-IADIIADNGVIHVVDKVLLP  164



>ref|WP_021005218.1| fascilin domain-containing protein [Variovorax paradoxus]
 gb|AGU47656.1| fascilin domain-containing protein [Variovorax paradoxus B4]
Length=190

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 80/169 (47%), Gaps = 14/169 (8%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLV--ALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAP  317
            +  PS  +  GA +     +V  A+    +T L   V+ A L+ TL+   S    T+FAP
Sbjct  27   NATPSNPMVGGAAMYPTKDIVDNAVNSKDHTTLVAAVKAADLVGTLK---SPGPFTVFAP  83

Query  318  RNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHI----  485
             N A    L       LL+P N  +L  +L +H++P R++        + GG        
Sbjct  84   TNAAFAA-LPAGTVDSLLRPENKPTLAKVLTYHVVPGRMDGAALMSAIKAGGGKATLKTA  142

Query  486  ---TLCRDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIPS  623
               TL     G N+VVS+ +  G   V++ +V + +G+IH +++VL+P 
Sbjct  143  SGGTLTATMSGGNVVVSDAK-GGTATVTIANVYQSNGVIHVVDKVLLPG  190



>ref|WP_040006463.1| fasciclin [Fibrisoma limi]
Length=185

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 80/164 (49%), Gaps = 24/164 (15%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            PS+N+   A +NS           +T L   V+ A L++TL+ A      T+FAP N+A 
Sbjct  36   PSKNIVDNA-VNSKD---------HTTLVAAVKAAELVETLQGA---GPFTVFAPTNKAF  82

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGE  512
            ++ L       LL+P N   LQ +L +H++P RI ++   +  + G  N     + A G 
Sbjct  83   DK-LPKGTVETLLKPENKSQLQGVLTYHVVPGRISAEDLMKMIKDG--NGKATLKTAAGG  139

Query  513  NLVVSER--------EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             L  + +        E  G   V++ DV + +G+IH ++ VL+P
Sbjct  140  TLTATMKGKKVEIVDENGGMSTVTIADVFQSNGVIHVVDTVLLP  183



>ref|WP_013930695.1| fasciclin [Runella slithyformis]
 gb|AEI51417.1| beta-Ig-H3/fasciclin [Runella slithyformis DSM 19594]
Length=182

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/165 (28%), Positives = 82/165 (50%), Gaps = 24/165 (15%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            PS+N+   A +NS           +T L   V+ A L++TL+ A      T+FAP NEA 
Sbjct  31   PSKNIIENA-VNSKD---------HTTLVAAVKAADLVETLQGA---GPFTVFAPANEAF  77

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAG--  506
            ++ L       L++P N ++L ++L +H++  +++SK   E  + GG          G  
Sbjct  78   DK-LPKGTVETLVKPENKKTLTSILTYHVVAGKMDSKTMAEAIKAGGGTAAFKTVQGGTL  136

Query  507  ------GENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIPS  623
                  G+ ++  E+   G   V++ DV + +G+IH I+ V++P 
Sbjct  137  KAMMKDGQLVLTDEK--GGMAAVTIKDVYQSNGVIHVIDSVVMPG  179



>ref|WP_009034009.1| fasciclin [Indibacter alkaliphilus]
 gb|EOZ96648.1| beta-Ig-H3/fasciclin [Indibacter alkaliphilus LW1]
Length=188

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 83/164 (51%), Gaps = 24/164 (15%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            PS+N+   A +NS           +T L   V+ A L++TL+ A      T+FAP N A 
Sbjct  39   PSKNIVENA-VNSKD---------HTTLVAAVQAAGLVETLQSA---GPFTVFAPTNAAF  85

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAGGE  512
            E+ L       L++P N  +L N+L +H++  +  SK   E  ++ G    T    +GGE
Sbjct  86   EK-LPAGTVETLVKPENKNTLTNILTYHVVAGKFGSKEIAEAIKK-GNGKATFKTVSGGE  143

Query  513  --------NLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                    +L +S+   + +K V++ DV + +G+IH I+ V++P
Sbjct  144  LTAWMKGKDLYISDESGNQSK-VTIGDVFQSNGVIHVIDTVVLP  186



>ref|WP_031455382.1| fasciclin [Flavobacterium chungangense]
Length=184

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 86/153 (56%), Gaps = 14/153 (9%)
 Frame = +3

Query  186  NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            N N +  A+    +T L   V+ A L++TL+   S+   T+FAP N+A ++ L     + 
Sbjct  36   NKNIIENAVNSKDHTTLVAAVKAAGLVETLQ---SKGPFTVFAPTNKAFDK-LPEGTVQT  91

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDAG--------GENLV  521
            LL+P N+++LQ +L +H++  ++ +    + + + G+   TL   +G        G++L 
Sbjct  92   LLKPENIKTLQTILTYHVVAGKMNASDIAK-AIKMGKGKATLKTVSGGTLTAWMDGKDLY  150

Query  522  VSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
            +S+   + +K V++ DV + +G+IH ++ VL+P
Sbjct  151  ISDESGNKSK-VTIADVNQSNGVIHVVDTVLLP  182



>ref|WP_026993752.1| fasciclin [Flectobacillus major]
Length=311

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 73/149 (49%), Gaps = 11/149 (7%)
 Frame = +3

Query  192  NSVLVALLDSHYTELSELVEKA--LLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRF  365
            N V +A  +S+++EL  LV  A   +   L +A S + +T+FAP N A         K  
Sbjct  168  NLVTIAAENSNFSELVSLVTAADPAVATALSQA-SANGLTVFAPTNAAFTELYKTVPKAT  226

Query  366  LLQPGNLRSLQNLLLFHMIPTRIESKHWP----ENSRRGGRNHITLCRDAGGENLVVSER  533
            LL P N   L N+LL+H++P R+ S   P    E +       +T     G +       
Sbjct  227  LLSPANRTLLTNVLLYHVVPGRVFSTDLPNVSGEVATANASAKLTFNLVGGAK----VNG  282

Query  534  EVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              SGA  ++  +++  +G+IH I++VL+P
Sbjct  283  TSSGASNITSANILATNGVIHVIDKVLLP  311



>ref|WP_044397596.1| hypothetical protein [Lacinutrix sp. Hel_I_90]
Length=192

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 84/163 (52%), Gaps = 22/163 (13%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            PS+N+   A +NS           +T L   V+ A L+  L   VS    T+FAP N+A 
Sbjct  43   PSKNIVENA-VNSK---------DHTTLVAAVKAAELVDVL---VSEGPFTVFAPTNDAF  89

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRG-GRNHITLCRDA--  503
             +  D   +  LL+P N ++LQ +L +H++  ++ +K   +  ++G G+  I        
Sbjct  90   AKLPDGTVET-LLKPENKKTLQTVLTYHVVSGKLSAKSILKQIKKGNGKAEIKTVSGGVI  148

Query  504  ----GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                 GE++ +S+   + AK V++ DV + +G+IH I+ VL+P
Sbjct  149  MAWLKGEDVYISDENGNSAK-VTIADVNQSNGVIHVIDTVLLP  190



>gb|ETZ19558.1| fasciclin [Pedobacter sp. V48]
Length=183

 Score = 62.0 bits (149),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/168 (27%), Positives = 90/168 (54%), Gaps = 17/168 (10%)
 Frame = +3

Query  144  HENPSRNLSSGAQINSNSVLV--ALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAP  317
             +NP   +  GA + ++  +V  A+    +T L   V+ A L++TL++   +   T+FAP
Sbjct  23   QKNP---MVGGAAMYASKDIVDNAVNSKDHTTLVAAVKAAGLVETLKD---KGPFTVFAP  76

Query  318  RNEALERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGG-RNHITLC  494
             N A ++ L       +L+P N  +L  +L +H++  +++SK   +  + GG ++ +T  
Sbjct  77   TNAAFDK-LPAGTVDMVLKPENKATLTKILTYHVVAGKMDSKAIAKAIKMGGGKSELTTV  135

Query  495  RDAG------GENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                      G+ L++++ E  G   V++ DV++ +G+IH I+ VL+P
Sbjct  136  AGGKLWAWMEGDKLMLND-EKGGMATVTIADVMQKNGVIHVIDTVLMP  182



>ref|WP_035128417.1| beta-Ig-H3/fasciclin [Flavobacterium aquatile]
 gb|KGD67196.1| beta-Ig-H3/fasciclin [Flavobacterium aquatile LMG 4008]
Length=164

 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 76/148 (51%), Gaps = 16/148 (11%)
 Frame = +3

Query  204  VALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALERDLDPEFKRFLLQPGN  383
            VA+ + ++T L   V+ A L +TL         T+FAP N A E+ L       LL+P N
Sbjct  23   VAVGNPNFTTLVAAVKAAGLAETLS---GEGPFTVFAPTNAAFEK-LPAGTVDGLLKPEN  78

Query  384  LRSLQNLLLFHMIPTRIESKHWPENSRRG-GRNHITLCRDAGGE--------NLVVSERE  536
            L  L+ LL +H++  + ++    +   +G G+  +T  +  GG+        N+V+++  
Sbjct  79   LEKLKGLLTYHVVAGKFDAAAVTDAITKGNGKYTVTTVQ--GGKIDLSLKDGNVVLTDAN  136

Query  537  VSGAKVVSLDDVVRPDGIIHGIERVLIP  620
             S    V++ DV   +G+IH I+ V++P
Sbjct  137  GS-TSTVAIADVAASNGVIHAIDTVVMP  163



>ref|WP_026628687.1| fasciclin [Dyadobacter alkalitolerans]
Length=184

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 87/163 (53%), Gaps = 18/163 (11%)
 Frame = +3

Query  165  LSSGAQI--NSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEALER  338
            +  GA++  N N +  A+    +T L   V+ A L++TL         T+FAP N A + 
Sbjct  29   MVGGAEMYPNKNIIENAVNSKDHTTLVAAVKAAGLVETLS---GTGPFTVFAPFNAAFDA  85

Query  339  DLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRG-GR--------NHITL  491
             L       LL+P N  +L ++L +H+IP +++SK   +  + G G+          +T 
Sbjct  86   -LPAGTVDNLLKPENKATLTSVLTYHVIPGKVDSKSVAKMIKDGKGKAMAKTAQGAELTF  144

Query  492  CRDAGGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
              D  G++L+V++ + +  K V++ DV + +G+IH I++VL+P
Sbjct  145  TMD--GKDLIVTDAKGNKGK-VTIADVYQSNGVIHVIDKVLMP  184



>ref|WP_020926856.1| Transforming growth factor-beta induced protein IG-H3 precursor 
[Achromobacter xylosoxidans]
 ref|YP_008030723.1| Transforming growth factor-beta induced protein IG-H3 precursor 
[Achromobacter xylosoxidans NH44784-1996]
 emb|CCH07601.1| Transforming growth factor-beta induced protein IG-H3 precursor 
[Achromobacter xylosoxidans NH44784-1996]
Length=181

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 79/163 (48%), Gaps = 22/163 (13%)
 Frame = +3

Query  153  PSRNLSSGAQINSNSVLVALLDSHYTELSELVEKALLLQTLEEAVSRHNITIFAPRNEAL  332
            P+R++ + A INS         + +T L   V+ A L+ TL+    +   T+FAP N A 
Sbjct  33   PARDIVANA-INS---------ADHTTLVAAVKAAGLVDTLQ---GKGPFTVFAPTNAAF  79

Query  333  ERDLDPEFKRFLLQPGNLRSLQNLLLFHMIPTRIESKHWPENSRRGGRNHITLCRDA---  503
             + L       L++P N  +L  +L +H++P +++       +R+GG   +         
Sbjct  80   AK-LPVGTVDNLVKPENKATLTKILTYHVVPGKLDFDALAARARKGGVTELATASGGKLW  138

Query  504  ----GGENLVVSEREVSGAKVVSLDDVVRPDGIIHGIERVLIP  620
                G  NL+V + E  G   +S  DV + +G+IH I+ VL+P
Sbjct  139  VMMNGKHNLIVKD-EKGGVANISTYDVYQSNGVIHVIDTVLMP  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875