BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF043H11

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11509.1|  unnamed protein product                                274   8e-84   Coffea canephora [robusta coffee]
gb|ACF17649.1|  putative cytochrome reductase                           273   1e-83   Capsicum annuum
gb|AAS92623.1|  NADPH:cytochrome P450-reductase                         271   6e-83   Centaurium erythraea
ref|XP_009630023.1|  PREDICTED: NADPH--cytochrome P450 reductase        271   8e-83   Nicotiana tomentosiformis
ref|XP_009786522.1|  PREDICTED: NADPH--cytochrome P450 reductase        271   9e-83   Nicotiana sylvestris
ref|XP_007018237.1|  NADPH--cytochrome P450 reductase isoform 4         264   7e-82   
ref|XP_006338052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    268   2e-81   Solanum tuberosum [potatoes]
ref|XP_004238001.1|  PREDICTED: NADPH--cytochrome P450 reductase        268   2e-81   Solanum lycopersicum
ref|XP_010086660.1|  NADPH--cytochrome P450 reductase                   265   2e-80   Morus notabilis
ref|XP_004501653.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    265   2e-80   
ref|XP_004501654.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    265   2e-80   Cicer arietinum [garbanzo]
ref|XP_007136327.1|  hypothetical protein PHAVU_009G036200g             265   3e-80   Phaseolus vulgaris [French bean]
ref|XP_007018234.1|  P450 reductase 1 isoform 1                         264   3e-80   
ref|XP_007018236.1|  NADPH--cytochrome P450 reductase isoform 3         265   4e-80   
gb|ADI49691.1|  cytochrome P450 reductase                               264   5e-80   Withania somnifera [ashwagandha]
gb|KJB58864.1|  hypothetical protein B456_009G229300                    261   8e-80   Gossypium raimondii
dbj|BAC41516.1|  NADPH-cytochrome P-450 reductase                       262   2e-79   Ophiorrhiza pumila
gb|KJB58865.1|  hypothetical protein B456_009G229300                    262   2e-79   Gossypium raimondii
gb|KJB58863.1|  hypothetical protein B456_009G229300                    262   3e-79   Gossypium raimondii
ref|XP_003602898.1|  NADPH cytochrome P450 reductase                    261   5e-79   Medicago truncatula
ref|XP_003522768.1|  PREDICTED: NADPH--cytochrome P450 reductase        261   5e-79   Glycine max [soybeans]
gb|ACN54323.1|  NADPH:cytochrome P450 reductase                         260   1e-78   Gossypium hirsutum [American cotton]
emb|CAA81211.1|  NADPH-ferrihemoprotein reductase                       259   2e-78   Vicia sativa [spring vetch]
ref|XP_009791726.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    259   3e-78   Nicotiana sylvestris
ref|XP_003526551.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    258   5e-78   Glycine max [soybeans]
gb|ACF35281.1|  cytochrome P450 reductase-like protein                  258   6e-78   Nothapodytes nimmoniana
ref|XP_002514049.1|  cytochrome P450, putative                          258   9e-78   Ricinus communis
gb|AAZ39648.1|  cytochrome P450 NADPH-reductase                         257   1e-77   Petunia x hybrida [garden petunia]
gb|EYU36460.1|  hypothetical protein MIMGU_mgv1a002296mg                256   4e-77   Erythranthe guttata [common monkey flower]
pir||A47298  NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung...    254   3e-76
ref|NP_001236742.1|  NADPH:P450 reductase                               254   3e-76   
gb|KHN39959.1|  NADPH--cytochrome P450 reductase                        253   3e-76   Glycine soja [wild soybean]
ref|XP_008338958.1|  PREDICTED: NADPH--cytochrome P450 reductase        253   5e-76   Malus domestica [apple tree]
gb|KDO81198.1|  hypothetical protein CISIN_1g005496mg                   251   5e-76   Citrus sinensis [apfelsine]
gb|KHG05124.1|  NADPH--cytochrome P450 reductase                        253   7e-76   Gossypium arboreum [tree cotton]
gb|KDO81197.1|  hypothetical protein CISIN_1g005496mg                   251   8e-76   Citrus sinensis [apfelsine]
sp|P37116.1|NCPR_VIGRR  RecName: Full=NADPH--cytochrome P450 redu...    252   1e-75   Vigna radiata var. radiata [golden gram]
gb|KDO81196.1|  hypothetical protein CISIN_1g005496mg                   251   2e-75   Citrus sinensis [apfelsine]
ref|XP_006472452.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    251   2e-75   Citrus sinensis [apfelsine]
gb|KDO81193.1|  hypothetical protein CISIN_1g005496mg                   251   3e-75   Citrus sinensis [apfelsine]
ref|XP_002265859.2|  PREDICTED: NADPH--cytochrome P450 reductase        251   3e-75   Vitis vinifera
ref|XP_009376208.1|  PREDICTED: NADPH--cytochrome P450 reductase        251   3e-75   Pyrus x bretschneideri [bai li]
ref|XP_006433816.1|  hypothetical protein CICLE_v10000469mg             250   6e-75   Citrus clementina [clementine]
ref|XP_010530279.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    248   5e-74   Tarenaya hassleriana [spider flower]
ref|XP_007226979.1|  hypothetical protein PRUPE_ppa002280mg             248   7e-74   Prunus persica
ref|XP_008219252.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    248   7e-74   Prunus mume [ume]
ref|XP_008219251.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    248   9e-74   
gb|AHB33949.1|  cytochrome P450 reductase                               243   3e-72   Santalum album
ref|XP_010520739.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    242   9e-72   Tarenaya hassleriana [spider flower]
ref|XP_004299743.1|  PREDICTED: NADPH--cytochrome P450 reductase        240   3e-71   Fragaria vesca subsp. vesca
gb|AIG15451.1|  NADPH-cytochrome P450 reductase 1                       236   1e-69   Azadirachta indica [Indian-lilac]
ref|XP_010692385.1|  PREDICTED: NADPH--cytochrome P450 reductase        236   2e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011016946.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    235   3e-69   Populus euphratica
ref|XP_010254555.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    234   1e-68   Nelumbo nucifera [Indian lotus]
ref|XP_011015338.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    233   2e-68   Populus euphratica
ref|XP_007141274.1|  hypothetical protein PHAVU_008G182200g             230   2e-67   Phaseolus vulgaris [French bean]
ref|XP_010277515.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    230   3e-67   Nelumbo nucifera [Indian lotus]
ref|XP_002307336.1|  NADPH-cytochrome P450 oxydoreductase isoform...    229   5e-67   
gb|KDP41487.1|  hypothetical protein JCGZ_15894                         229   8e-67   Jatropha curcas
ref|XP_006413419.1|  hypothetical protein EUTSA_v10024568mg             226   9e-66   Eutrema salsugineum [saltwater cress]
ref|NP_194183.1|  NADPH--cytochrome P450 reductase 1                    221   4e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867662.1|  hypothetical protein ARALYDRAFT_492391             220   1e-63   
emb|CDY03447.1|  BnaC01g16350D                                          220   1e-63   
ref|XP_010433757.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    219   2e-63   Camelina sativa [gold-of-pleasure]
gb|KJB14708.1|  hypothetical protein B456_002G138900                    219   3e-63   Gossypium raimondii
ref|XP_010448554.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    219   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010439016.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    219   4e-63   Camelina sativa [gold-of-pleasure]
gb|KJB14707.1|  hypothetical protein B456_002G138900                    218   5e-63   Gossypium raimondii
ref|XP_009138137.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    218   6e-63   Brassica rapa
emb|CAA46814.1|  NADPH-ferrihemoprotein reductase                       218   7e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDY70343.1|  BnaCnng67910D                                          216   1e-62   Brassica napus [oilseed rape]
ref|XP_009138145.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    218   1e-62   Brassica rapa
emb|CDY34288.1|  BnaA01g13910D                                          218   1e-62   Brassica napus [oilseed rape]
ref|XP_010277516.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    216   1e-62   
emb|CDY11017.1|  BnaA03g46760D                                          217   2e-62   Brassica napus [oilseed rape]
ref|NP_001190823.1|  NADPH--cytochrome P450 reductase 1                 216   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137450.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    216   3e-62   Brassica rapa
gb|AAS00459.1|  NADPH:cytochrome P450-reductase                         215   6e-62   Hypericum androsaemum
emb|CDX92639.1|  BnaC07g38970D                                          215   8e-62   
emb|CDY34287.1|  BnaA01g13900D                                          215   8e-62   Brassica napus [oilseed rape]
ref|XP_006285937.1|  hypothetical protein CARUB_v10007449mg             213   4e-61   Capsella rubella
gb|AFO64618.1|  cytochrome P450 reductase                               207   5e-59   Artemisia annua [sweet Annie]
gb|AGO03795.1|  cytochrome P450-like protein                            202   2e-58   Tanacetum cinerariifolium [pyrethrum]
gb|ABL09938.1|  cytochrome P450 reductase                               206   3e-58   Artemisia annua [sweet Annie]
gb|ABM88789.1|  cytochrome P450 reductase                               205   4e-58   Artemisia annua [sweet Annie]
gb|ABI98819.1|  cytochrome P450 reductase                               205   5e-58   Artemisia annua [sweet Annie]
gb|ABC47946.1|  cytochrome P450 reductase                               205   6e-58   Artemisia annua [sweet Annie]
gb|AHM95445.1|  cytochrome P450 reductase                               202   4e-57   Matricaria chamomilla var. recutita [German chamomile]
gb|AIL29328.1|  cytochrome P450 reductase                               201   2e-56   Pinus contorta
ref|XP_007227446.1|  hypothetical protein PRUPE_ppa002142mg             200   4e-56   Prunus persica
ref|XP_008223694.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      199   6e-56   Prunus mume [ume]
gb|AAC05021.1|  NADPH:ferrihemoprotein oxidoreductase                   199   7e-56   Papaver somniferum
gb|KJB22135.1|  hypothetical protein B456_004G0316001                   191   1e-55   Gossypium raimondii
gb|AIC73829.1|  cytochrome P450 reductase                               198   1e-55   Panax ginseng [Asiatic ginseng]
ref|XP_010688489.1|  PREDICTED: NADPH--cytochrome P450 reductase        198   2e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009382841.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    197   3e-55   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN54324.1|  NADPH:cytochrome P450 reductase                         197   4e-55   Gossypium hirsutum [American cotton]
ref|XP_010548619.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    195   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_010093854.1|  NADPH--cytochrome P450 reductase                   194   4e-54   Morus notabilis
ref|XP_004146317.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    194   4e-54   Cucumis sativus [cucumbers]
ref|XP_008453604.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      194   4e-54   Cucumis melo [Oriental melon]
dbj|BAJ33878.1|  unnamed protein product                                194   7e-54   Eutrema halophilum
ref|XP_006412733.1|  hypothetical protein EUTSA_v10024546mg             194   7e-54   Eutrema salsugineum [saltwater cress]
emb|CAA89837.3|  NADPH-cytochrome P450 reductase                        194   7e-54   Pseudotsuga menziesii
ref|XP_010929254.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    193   9e-54   Elaeis guineensis
ref|XP_004168990.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    182   2e-53   
emb|CDY51656.1|  BnaAnng10960D                                          192   2e-53   Brassica napus [oilseed rape]
ref|XP_009408053.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    192   3e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008776011.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    188   4e-53   
ref|XP_002869386.1|  hypothetical protein ARALYDRAFT_913457             191   7e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_009108997.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      191   9e-53   Brassica rapa
emb|CDX72222.1|  BnaC07g42440D                                          190   1e-52   
ref|XP_010259920.1|  PREDICTED: NADPH--cytochrome P450 reductase        190   1e-52   Nelumbo nucifera [Indian lotus]
ref|NP_849472.2|  NADPH--cytochrome P450 reductase 2                    190   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194750.1|  NADPH--cytochrome P450 reductase 2                    190   2e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CAA46815.1|  NADPH-ferrihemoprotein reductase                       190   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385909.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    189   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010914150.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    189   3e-52   Elaeis guineensis
ref|XP_009414761.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    189   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002534464.1|  cytochrome P450, putative                          189   3e-52   
ref|XP_008789667.1|  PREDICTED: NADPH--cytochrome P450 reductase        188   5e-52   Phoenix dactylifera
dbj|BAG68945.1|  cytochrome P450 reductase                              188   5e-52   Lotus japonicus
sp|Q05001.1|NCPR_CATRO  RecName: Full=NADPH--cytochrome P450 redu...    187   9e-52   Catharanthus roseus [chatas]
gb|KHG21257.1|  NADPH--cytochrome P450 reductase                        187   1e-51   Gossypium arboreum [tree cotton]
emb|CAN77401.1|  hypothetical protein VITISV_027794                     186   3e-51   Vitis vinifera
gb|AAT76449.1|  NADPH:cytochrome P450 reductase                         186   5e-51   Taxus cuspidata [ichii]
gb|AHA50098.1|  CYP450 reductase                                        186   6e-51   Panax ginseng [Asiatic ginseng]
ref|XP_002270732.2|  PREDICTED: NADPH--cytochrome P450 reductase        185   6e-51   Vitis vinifera
emb|CBI17838.3|  unnamed protein product                                185   7e-51   Vitis vinifera
ref|XP_007014268.1|  P450 reductase 2                                   185   9e-51   
ref|XP_006283224.1|  hypothetical protein CARUB_v10004254mg             185   9e-51   Capsella rubella
gb|ACF35282.1|  cytochrome P450 reductase-like protein                  184   1e-50   Nothapodytes nimmoniana
emb|CDY03543.1|  BnaC03g68020D                                          184   1e-50   
ref|XP_010438203.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      184   2e-50   Camelina sativa [gold-of-pleasure]
gb|AAX59902.1|  cytochrome P450 reductase                               184   2e-50   Taxus wallichiana var. chinensis [Chinese yew]
gb|KDO43872.1|  hypothetical protein CISIN_1g005072mg                   182   4e-50   Citrus sinensis [apfelsine]
gb|ABB88839.2|  NADPH cytochrome P450 reductase                         183   4e-50   Stevia rebaudiana
emb|CDY14183.1|  BnaA08g13140D                                          183   4e-50   Brassica napus [oilseed rape]
gb|KDO43873.1|  hypothetical protein CISIN_1g005072mg                   182   5e-50   Citrus sinensis [apfelsine]
gb|KDO43870.1|  hypothetical protein CISIN_1g005072mg                   182   7e-50   Citrus sinensis [apfelsine]
gb|KDO43868.1|  hypothetical protein CISIN_1g005072mg                   182   7e-50   Citrus sinensis [apfelsine]
gb|KDO43869.1|  hypothetical protein CISIN_1g005072mg                   182   7e-50   Citrus sinensis [apfelsine]
ref|XP_010433014.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    182   8e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006474185.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    182   9e-50   Citrus sinensis [apfelsine]
emb|CDP02981.1|  unnamed protein product                                182   1e-49   Coffea canephora [robusta coffee]
ref|XP_006453370.1|  hypothetical protein CICLE_v10007535mg             182   1e-49   
gb|AIG15452.1|  NADPH-cytochrome P450 reductase 2                       182   1e-49   Azadirachta indica [Indian-lilac]
ref|XP_010928663.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    181   1e-49   Elaeis guineensis
gb|KHG09184.1|  NADPH--cytochrome P450 reductase                        181   2e-49   Gossypium arboreum [tree cotton]
ref|XP_011010331.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    181   2e-49   Populus euphratica
emb|CDX68634.1|  BnaC01g08190D                                          181   2e-49   
gb|ACF35280.1|  cytochrome P450 reductase-like protein                  181   3e-49   Nothapodytes nimmoniana
gb|AAC05022.1|  NADPH:ferrihemoprotein oxidoreductase                   181   3e-49   Eschscholzia californica
ref|XP_011079296.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    180   4e-49   Sesamum indicum [beniseed]
ref|XP_010265447.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    180   4e-49   Nelumbo nucifera [Indian lotus]
gb|KJB53795.1|  hypothetical protein B456_009G005600                    180   4e-49   Gossypium raimondii
gb|KJB53796.1|  hypothetical protein B456_009G005600                    179   4e-49   Gossypium raimondii
ref|XP_009795589.1|  PREDICTED: NADPH--cytochrome P450 reductase        180   5e-49   Nicotiana sylvestris
gb|KJB53797.1|  hypothetical protein B456_009G005600                    180   5e-49   Gossypium raimondii
gb|KJB53794.1|  hypothetical protein B456_009G005600                    180   5e-49   Gossypium raimondii
ref|XP_008781895.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    180   6e-49   Phoenix dactylifera
gb|AAB97736.1|  NADPH cytochrome P450 reductase                         179   7e-49   Petroselinum crispum
ref|XP_010447751.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    179   9e-49   Camelina sativa [gold-of-pleasure]
gb|KDO43871.1|  hypothetical protein CISIN_1g005072mg                   179   2e-48   Citrus sinensis [apfelsine]
ref|NP_001063914.1|  Os09g0558900                                       178   2e-48   
gb|EAZ10065.1|  hypothetical protein OsI_32371                          178   2e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_006474186.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    178   2e-48   Citrus sinensis [apfelsine]
ref|XP_006453369.1|  hypothetical protein CICLE_v10007535mg             178   2e-48   
gb|EEE70211.1|  hypothetical protein OsJ_30318                          178   3e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008451695.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    177   3e-48   
ref|XP_007154761.1|  hypothetical protein PHAVU_003G145400g             177   4e-48   Phaseolus vulgaris [French bean]
emb|CDY28169.1|  BnaA01g06800D                                          177   4e-48   Brassica napus [oilseed rape]
ref|XP_004296434.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      177   5e-48   Fragaria vesca subsp. vesca
gb|KDP36395.1|  hypothetical protein JCGZ_08664                         177   5e-48   Jatropha curcas
dbj|BAJ41269.1|  NADPH-P450 reductase 2                                 177   5e-48   Zingiber officinale [ginger]
ref|XP_004148333.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    176   8e-48   Cucumis sativus [cucumbers]
ref|XP_004168364.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    176   8e-48   
emb|CAE01547.2|  OSJNBb0022F16.2                                        176   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002960044.1|  hypothetical protein SELMODRAFT_401997             175   1e-47   
ref|XP_003579401.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    176   1e-47   Brachypodium distachyon [annual false brome]
ref|XP_009607226.1|  PREDICTED: NADPH--cytochrome P450 reductase        176   2e-47   Nicotiana tomentosiformis
gb|EPS73891.1|  hypothetical protein M569_00858                         175   2e-47   Genlisea aurea
ref|XP_008391625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    175   2e-47   Malus domestica [apple tree]
emb|CCO62220.1|  putative cytochrome P450 reductase                     175   3e-47   Actaea racemosa
gb|ADG29353.1|  cytochrome P450 reductase                               175   3e-47   Withania somnifera [ashwagandha]
ref|XP_010525727.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      174   5e-47   Tarenaya hassleriana [spider flower]
gb|KFK29577.1|  nadph-ferrihemoprotein reductase                        174   5e-47   Arabis alpina [alpine rockcress]
ref|XP_008383105.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    174   7e-47   Malus domestica [apple tree]
ref|XP_008383106.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    174   7e-47   Malus domestica [apple tree]
ref|NP_001061346.1|  Os08g0243500                                       173   9e-47   
ref|XP_006845640.1|  hypothetical protein AMTR_s00019p00222550          174   9e-47   
gb|EPS67504.1|  hypothetical protein M569_07270                         173   1e-46   Genlisea aurea
gb|AAB97737.1|  NADPH cytochrome P450 reductase                         173   1e-46   Petroselinum crispum
ref|XP_006653834.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    172   2e-46   Oryza brachyantha
ref|XP_010526342.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    172   5e-46   Tarenaya hassleriana [spider flower]
gb|AGO03799.1|  cytochrome P450-like protein                            171   6e-46   Tanacetum cinerariifolium [pyrethrum]
ref|XP_002978784.1|  hypothetical protein SELMODRAFT_152770             170   1e-45   
gb|AAC09468.2|  putative NADPH-cytochrome P450 reductase                170   2e-45   Pisum sativum [garden pea]
ref|XP_004973052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    170   2e-45   Setaria italica
ref|NP_001146345.1|  uncharacterized protein LOC100279923               164   2e-45   
gb|EYU20907.1|  hypothetical protein MIMGU_mgv1a002097mg                170   2e-45   Erythranthe guttata [common monkey flower]
gb|AIO11759.1|  cytochrome p450 reductase                               169   3e-45   Croton stellatopilosus
ref|XP_004960246.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    169   4e-45   
ref|XP_006372087.1|  hypothetical protein POPTR_0018s09980g             167   4e-45   
ref|XP_004960247.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    169   4e-45   Setaria italica
ref|XP_011043963.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    168   7e-45   Populus euphratica
ref|XP_002984697.1|  hypothetical protein SELMODRAFT_234596             167   8e-45   
ref|XP_001785882.1|  predicted protein                                  167   9e-45   
gb|AAK15261.1|AF302498_1  NADPH-cytochrome P450 oxydoreductase is...    168   1e-44   Populus trichocarpa x Populus deltoides
ref|XP_006372088.1|  hypothetical protein POPTR_0018s09980g             166   1e-44   
ref|XP_010913661.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    166   3e-44   Elaeis guineensis
ref|XP_002324469.1|  putative NADPH-cytochrome P450 reductase fam...    166   3e-44   Populus trichocarpa [western balsam poplar]
ref|XP_009384791.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    166   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004957625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    166   4e-44   Setaria italica
ref|XP_008667833.1|  PREDICTED: uncharacterized protein LOC100279...    165   7e-44   Zea mays [maize]
ref|XP_008667834.1|  PREDICTED: uncharacterized protein LOC100279...    165   7e-44   
gb|AAS90127.1|  NADPH cytochrome P450 reductase                         165   1e-43   Ammi majus [ameo mayor]
gb|AHB33950.1|  cytochrome P450 reductase                               165   1e-43   Santalum album
ref|NP_001159331.1|  uncharacterized protein LOC100304425               164   1e-43   Zea mays [maize]
ref|XP_002986144.1|  hypothetical protein SELMODRAFT_157822             164   3e-43   
gb|KCW80968.1|  hypothetical protein EUGRSUZ_C02330                     163   5e-43   Eucalyptus grandis [rose gum]
ref|XP_003541616.1|  PREDICTED: NADPH--cytochrome P450 reductase        163   6e-43   Glycine max [soybeans]
ref|XP_010048643.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    162   7e-43   Eucalyptus grandis [rose gum]
gb|AGX85599.1|  NADPH:cytochrome P450 reductase                         162   7e-43   Scoparia dulcis [escobilla]
ref|XP_002447240.1|  hypothetical protein SORBIDRAFT_06g031110          162   9e-43   Sorghum bicolor [broomcorn]
ref|XP_006381796.1|  putative NADPH-cytochrome P450 reductase fam...    162   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_002984958.1|  hypothetical protein SELMODRAFT_181373             162   1e-42   
ref|XP_003549436.1|  PREDICTED: NADPH--cytochrome P450 reductase        162   1e-42   Glycine max [soybeans]
gb|KCW78708.1|  hypothetical protein EUGRSUZ_C00154                     161   2e-42   Eucalyptus grandis [rose gum]
gb|AEW43314.1|  NADPH cytochrome P450 reductase                         161   2e-42   Picrorhiza kurrooa
gb|KCW78707.1|  hypothetical protein EUGRSUZ_C00154                     161   2e-42   Eucalyptus grandis [rose gum]
ref|XP_010046982.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    161   2e-42   Eucalyptus grandis [rose gum]
gb|ACG27711.1|  NADPH--cytochrome P450 reductase                        161   3e-42   Zea mays [maize]
gb|KHN22700.1|  NADPH--cytochrome P450 reductase                        160   3e-42   Glycine soja [wild soybean]
gb|EPS66345.1|  hypothetical protein M569_08425                         160   4e-42   Genlisea aurea
gb|EYU42400.1|  hypothetical protein MIMGU_mgv1a002170mg                160   6e-42   Erythranthe guttata [common monkey flower]
ref|XP_011069915.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    160   7e-42   Sesamum indicum [beniseed]
gb|AAZ39649.1|  cytochrome P450 NADPH-reductase                         160   8e-42   Petunia x hybrida [garden petunia]
ref|XP_003610109.1|  NADPH cytochrome P450 reductase                    159   9e-42   Medicago truncatula
ref|XP_004242931.1|  PREDICTED: NADPH--cytochrome P450 reductase        159   1e-41   Solanum lycopersicum
ref|XP_003578634.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    159   1e-41   Brachypodium distachyon [annual false brome]
gb|AGC92176.1|  cytochrome P450 oxidoreductase                          159   1e-41   Ocimum basilicum [basil]
gb|KHN17598.1|  NADPH--cytochrome P450 reductase                        159   1e-41   Glycine soja [wild soybean]
dbj|BAJ99370.1|  predicted protein                                      158   2e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006661531.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    158   2e-41   
ref|XP_008676669.1|  PREDICTED: uncharacterized protein LOC100216...    159   2e-41   
dbj|BAJ41268.1|  NADPH-P450 reductase 1                                 158   2e-41   Zingiber officinale [ginger]
gb|AAG17471.1|AF123610_10  NADPH-cytochrome P450 reductase              158   3e-41   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004507857.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    155   4e-40   
ref|XP_004507858.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    155   4e-40   Cicer arietinum [garbanzo]
gb|AGL46979.1|  cytochrome P450 reductase                               153   2e-39   Salvia miltiorrhiza [Chinese salvia]
gb|ADC94831.1|  cytochrome P450 reductase                               153   2e-39   Perilla frutescens [beefsteak-mint]
gb|ACG28940.1|  NADPH--cytochrome P450 reductase                        152   3e-39   Zea mays [maize]
ref|XP_002462826.1|  hypothetical protein SORBIDRAFT_02g032640          152   5e-39   Sorghum bicolor [broomcorn]
ref|XP_008661364.1|  PREDICTED: uncharacterized protein LOC100192...    150   1e-38   
ref|XP_002444097.1|  hypothetical protein SORBIDRAFT_07g007640          150   3e-38   Sorghum bicolor [broomcorn]
emb|CAQ37789.1|  NADPH:cytochrome P450 reductase                        149   4e-38   Plectranthus scutellarioides
emb|CBX24555.1|  NADPH:cytochrome P450 reductase                        149   5e-38   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010234513.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    149   6e-38   Brachypodium distachyon [annual false brome]
ref|XP_008653023.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    148   1e-37   Zea mays [maize]
gb|EEE68301.1|  hypothetical protein OsJ_26563                          147   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008337575.1|  PREDICTED: uncharacterized protein LOC103400688    142   4e-36   
ref|XP_001758838.1|  predicted protein                                  143   6e-36   
emb|CAC83301.1|  cytochrome P450 reductase                              142   2e-35   Triticum aestivum [Canadian hard winter wheat]
gb|EMS66177.1|  NADPH--cytochrome P450 reductase                        141   3e-35   Triticum urartu
emb|CAA81209.1|  NADPH-ferrihemoprotein reductase                       139   1e-34   Helianthus tuberosus [Jerusalem artichoke]
gb|EMT19472.1|  NADPH--cytochrome P450 reductase                        139   1e-34   
gb|EMT14573.1|  NADPH--cytochrome P450 reductase                        139   2e-34   
ref|XP_001779575.1|  predicted protein                                  138   3e-34   
ref|XP_009130253.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    135   3e-33   Brassica rapa
gb|EEE61817.1|  hypothetical protein OsJ_16444                          134   8e-33   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD05443.1|  putative cytochrome P450 reductase                     130   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659239.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    127   1e-30   
gb|EMS53484.1|  NADPH--cytochrome P450 reductase                        127   1e-30   Triticum urartu
ref|XP_001770150.1|  predicted protein                                  127   2e-30   
gb|KIY99765.1|  hypothetical protein MNEG_8195                          122   4e-28   Monoraphidium neglectum
ref|XP_002953937.1|  hypothetical protein VOLCADRAFT_76078              120   7e-28   Volvox carteri f. nagariensis
gb|KIZ02441.1|  NADPH-cytochrome P450 reductase                         119   2e-27   Monoraphidium neglectum
ref|XP_006386427.1|  hypothetical protein POPTR_0002s10680g             117   5e-27   
ref|XP_001690130.1|  NADPH-cytochrome P450 reductase                    117   1e-26   
gb|KDO81194.1|  hypothetical protein CISIN_1g005496mg                   116   1e-26   
ref|XP_005645698.1|  NADPH-cytochrome P450 reductase                    108   2e-23   
ref|XP_009137451.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    107   2e-23   
gb|KDO43874.1|  hypothetical protein CISIN_1g005072mg                   107   3e-23   
gb|ETO01351.1|  NADPH-cytochrome-P450 oxidoreductase                    105   2e-22   
gb|KDO43875.1|  hypothetical protein CISIN_1g005072mg                   103   8e-22   
gb|KFM58328.1|  NADPH--cytochrome P450 reductase                      99.4    9e-21   
ref|XP_007515695.1|  predicted protein                                  100   1e-20   
gb|AID61461.1|  cytochrome P450                                       99.8    2e-20   
gb|EWM29292.1|  nadph--cytochrome p450 reductase                      98.6    4e-20   
ref|XP_646400.1|  NADPH-cytochrome-P450 oxidoreductase                98.6    4e-20   
ref|XP_001945312.1|  PREDICTED: NADPH--cytochrome P450 reductase      97.8    1e-19   
ref|XP_003056042.1|  predicted protein                                97.4    1e-19   
ref|XP_002612108.1|  hypothetical protein BRAFLDRAFT_288748           97.4    1e-19   
ref|XP_005988651.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  97.4    1e-19   
ref|XP_011187815.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  97.1    1e-19   
ref|XP_009114362.1|  PREDICTED: uncharacterized protein LOC103839613  91.7    1e-19   
ref|XP_001355866.1|  GA11069                                          97.1    2e-19   
ref|XP_009022160.1|  hypothetical protein HELRODRAFT_113572           97.1    2e-19   
ref|XP_011399053.1|  NADPH-cytochrome P450 reductase                  96.7    2e-19   
ref|XP_005454398.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  96.7    2e-19   
ref|XP_009900576.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  97.1    2e-19   
ref|XP_003449358.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  97.1    2e-19   
ref|XP_001951585.2|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.0    2e-19   
ref|XP_002065280.1|  GK14755                                          96.3    3e-19   
emb|CDJ82588.1|  Flavodoxin nitric oxide synthase and FAD-binding...  95.9    3e-19   
gb|KDN51453.1|  hypothetical protein K437DRAFT_272947                 95.9    4e-19   
emb|CAA63639.1|  NADPH--ferrihemoprotein reductase                    95.9    5e-19   
ref|XP_011214554.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  95.5    5e-19   
ref|NP_477158.1|  cytochrome P450 reductase, isoform A                95.5    5e-19   
ref|NP_001273818.1|  NADPH--cytochrome P450 reductase                 95.5    6e-19   
ref|XP_006799993.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  95.5    6e-19   
ref|XP_002038080.1|  GM18621                                          95.1    7e-19   
ref|XP_001970000.1|  GG10405                                          95.1    7e-19   
ref|XP_002088202.1|  GE13802                                          95.1    7e-19   
ref|XP_006155694.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  95.1    8e-19   
emb|CCT69332.1|  probable NCP1-NADPH-cytochrome P450 reductase        95.1    8e-19   
ref|XP_007883606.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.4    8e-19   
ref|XP_009969485.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.4    9e-19   
gb|ELW56432.1|  NADPH--cytochrome P450 reductase                      95.1    9e-19   
gb|KFV56704.1|  NADPH--cytochrome P450 reductase                      92.0    1e-18   
ref|XP_010222279.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  90.5    1e-18   
gb|ELT87080.1|  hypothetical protein CAPTEDRAFT_173459                94.4    1e-18   
ref|XP_011481096.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  94.0    1e-18   
ref|XP_008308055.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  94.0    2e-18   
ref|XP_002002669.1|  GI11531                                          94.0    2e-18   
ref|XP_004523898.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  94.0    2e-18   
ref|XP_004075861.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  94.0    2e-18   
ref|XP_008308056.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  94.0    2e-18   
emb|CBQ72454.1|  probable NADPH-cytochrome P450 reductase             94.0    2e-18   
ref|XP_007599476.1|  NADP/FAD dependent oxidoreductase                94.0    2e-18   
ref|XP_010191751.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  94.0    2e-18   
ref|XP_011388283.1|  putative NADPH-cytochrome P450 reductase         94.0    2e-18   
ref|XP_004336241.1|  nadph cytochrome P450, putative                  94.0    2e-18   
gb|KFQ20093.1|  NADPH--cytochrome P450 reductase                      93.6    2e-18   
ref|XP_005155225.1|  PREDICTED: LOW QUALITY PROTEIN: P450 (cytoch...  93.6    2e-18   
gb|AAF89958.1|AF195659_1  NADPH-dependent cytochrome P450 oxidore...  93.6    2e-18   
emb|CDS03498.1|  hypothetical protein LRAMOSA00900                    93.6    2e-18   
ref|XP_005010692.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  93.6    2e-18   
ref|XP_007564214.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  93.6    2e-18   
ref|XP_005818737.1|  hypothetical protein GUITHDRAFT_149086           93.6    2e-18   
emb|CCF48513.1|  probable NADPH-cytochrome P450 reductase             93.6    3e-18   
ref|XP_005010691.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  93.6    3e-18   
ref|XP_001988124.1|  GH10739                                          93.6    3e-18   
ref|XP_007433824.1|  PREDICTED: NADPH--cytochrome P450 reductase      93.6    3e-18   
ref|XP_006569767.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  93.6    3e-18   
ref|XP_007564212.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  93.2    3e-18   
gb|ESA02196.1|  hypothetical protein GLOINDRAFT_337546                93.2    3e-18   
ref|XP_005425451.1|  PREDICTED: NADPH--cytochrome P450 reductase      93.2    3e-18   
ref|XP_005240527.1|  PREDICTED: NADPH--cytochrome P450 reductase      93.2    3e-18   
ref|XP_009092939.1|  PREDICTED: NADPH--cytochrome P450 reductase      93.2    3e-18   
ref|XP_005495092.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.8    3e-18   
ref|XP_001875808.1|  predicted protein                                93.2    3e-18   
gb|KIK03320.1|  hypothetical protein K443DRAFT_676802                 93.2    4e-18   
ref|XP_002051335.1|  GJ12806                                          93.2    4e-18   
dbj|GAC94958.1|  NADPH--cytochrome P450 reductase                     93.2    4e-18   
ref|XP_007884244.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.8    4e-18   
ref|XP_005439856.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.8    4e-18   
ref|XP_005933201.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.8    4e-18   
ref|XP_009946393.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.4    4e-18   
gb|KFP97479.1|  NADPH--cytochrome P450 reductase                      92.4    4e-18   
dbj|BAN82201.1|  hypothetical protein                                 92.8    4e-18   
ref|XP_005746975.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.8    4e-18   
ref|XP_005746976.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.8    4e-18   
ref|XP_010197040.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.4    5e-18   
gb|KFP30463.1|  NADPH--cytochrome P450 reductase                      92.4    5e-18   
gb|AFU86429.1|  cytochrome P450 reductase 1                           90.1    5e-18   
ref|XP_006608682.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.8    5e-18   
ref|XP_001424085.1|  hypothetical protein                             92.4    5e-18   
emb|CDH48577.1|  nadph-cytochrome p450 reductase                      92.8    5e-18   
ref|XP_001962292.1|  GF14516                                          92.8    5e-18   
gb|KFV05180.1|  NADPH--cytochrome P450 reductase                      92.8    5e-18   
ref|XP_008638658.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.4    5e-18   
ref|XP_008139684.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.4    5e-18   
ref|XP_009984473.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.4    5e-18   
gb|KFW68510.1|  NADPH--cytochrome P450 reductase                      92.4    5e-18   
gb|ETW55181.1|  hypothetical protein PFUGPA_03001                     91.3    6e-18   
ref|XP_009941230.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  92.4    6e-18   
ref|XP_010004325.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.4    6e-18   
ref|XP_001744757.1|  hypothetical protein                             92.4    6e-18   
gb|KFP52012.1|  NADPH--cytochrome P450 reductase                      92.0    6e-18   
ref|XP_002397027.1|  hypothetical protein MPER_02624                  89.0    6e-18   
ref|XP_005879216.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.4    6e-18   
ref|XP_010014691.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.4    6e-18   
ref|XP_009324341.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.4    7e-18   
gb|KFQ51301.1|  NADPH--cytochrome P450 reductase                      92.4    7e-18   
emb|CDQ65983.1|  unnamed protein product                              92.4    7e-18   
emb|CDJ91386.1|  Flavodoxin nitric oxide synthase and FAD-binding...  92.0    7e-18   
ref|XP_006773444.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.4    7e-18   
gb|KFO89861.1|  NADPH--cytochrome P450 reductase                      92.4    7e-18   
gb|ETS59841.1|  hypothetical protein PaG_06145                        92.4    7e-18   
ref|XP_006088353.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.4    7e-18   
gb|KFM01563.1|  NADPH--cytochrome P450 reductase                      92.4    7e-18   
ref|XP_010116183.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    7e-18   
ref|XP_009285713.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    7e-18   
dbj|GAC71576.1|  NADP/FAD dependent oxidoreductase                    92.4    7e-18   
gb|KFQ02140.1|  NADPH--cytochrome P450 reductase                      92.0    7e-18   
gb|EPQ15742.1|  NADPH--cytochrome P450 reductase                      92.4    7e-18   
gb|KFV49728.1|  NADPH--cytochrome P450 reductase                      92.0    7e-18   
dbj|GAK67767.1|  NADPH-dependent cytochrome P450 oxidoreductase       92.4    7e-18   
ref|XP_009805371.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    7e-18   
ref|XP_009805370.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    7e-18   
ref|XP_005846436.1|  hypothetical protein CHLNCDRAFT_36035            92.0    7e-18   
ref|XP_005879217.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    7e-18   
ref|XP_005803425.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.0    7e-18   
gb|KFO75627.1|  NADPH--cytochrome P450 reductase                      92.0    7e-18   
gb|AAG23833.1|AF290425_1  NADPH cytochrome P450 oxidoreductase is...  92.0    8e-18   
ref|XP_010302188.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  92.0    8e-18   
ref|XP_009915053.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    8e-18   
gb|AAB48964.1|  NADPH-cytochrome P450 reductase                       92.0    8e-18   
ref|XP_006773443.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    8e-18   
ref|XP_010134664.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    8e-18   
ref|XP_009805372.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    8e-18   
ref|XP_010004324.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    8e-18   
ref|XP_005525894.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    8e-18   
emb|CDS11152.1|  hypothetical protein LRAMOSA03415                    92.0    8e-18   
gb|KFZ58717.1|  NADPH--cytochrome P450 reductase                      92.0    8e-18   
ref|XP_008120878.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    8e-18   
ref|XP_010116182.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    8e-18   
gb|KJE97834.1|  NADPH-cytochrome P450 reductase, variant              91.7    8e-18   
ref|XP_010400796.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    8e-18   
gb|AGM20565.1|  NADPH-cytochrome P450 reductase                       92.0    8e-18   
gb|KFP40755.1|  NADPH--cytochrome P450 reductase                      92.0    8e-18   
ref|XP_004343008.1|  NADPH-cytochrome P450 reductase                  92.0    8e-18   
ref|XP_009558457.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    8e-18   
ref|NP_001171276.1|  NADPH--cytochrome P450 reductase                 92.0    8e-18   
ref|XP_010720070.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    8e-18   
gb|KFU95881.1|  NADPH--cytochrome P450 reductase                      92.0    8e-18   
ref|XP_009079365.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    8e-18   
ref|XP_005620955.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    8e-18   
gb|KFR01269.1|  NADPH--cytochrome P450 reductase                      92.0    8e-18   
ref|XP_008493329.1|  PREDICTED: NADPH--cytochrome P450 reductase      91.7    8e-18   
gb|KFP86946.1|  NADPH--cytochrome P450 reductase                      92.0    8e-18   
ref|XP_009477365.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    9e-18   
ref|XP_005620956.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    9e-18   
gb|KIO20302.1|  hypothetical protein M407DRAFT_81708                  91.7    9e-18   
gb|KFQ49850.1|  NADPH--cytochrome P450 reductase                      92.0    9e-18   
ref|XP_009883428.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    9e-18   
ref|XP_005056571.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    9e-18   
ref|XP_010571848.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    9e-18   
ref|XP_010166755.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    9e-18   
ref|XP_009467234.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    9e-18   
gb|KGL93369.1|  NADPH--cytochrome P450 reductase                      92.0    9e-18   
gb|KFV98908.1|  NADPH--cytochrome P450 reductase                      92.0    9e-18   
gb|KFW86392.1|  NADPH--cytochrome P450 reductase                      92.0    9e-18   
ref|XP_009695858.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    9e-18   
ref|XP_010073609.1|  PREDICTED: NADPH--cytochrome P450 reductase      91.7    9e-18   
gb|KFW92215.1|  NADPH--cytochrome P450 reductase                      92.0    9e-18   
ref|XP_009505171.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    9e-18   
ref|XP_008928644.1|  PREDICTED: NADPH--cytochrome P450 reductase      92.0    9e-18   
ref|NP_001182725.1|  NADPH--cytochrome P450 reductase                 91.7    9e-18   
gb|KFV08500.1|  NADPH--cytochrome P450 reductase                      91.7    9e-18   
ref|XP_005620957.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  92.0    1e-17   
ref|XP_009585830.1|  PREDICTED: NADPH--cytochrome P450 reductase      91.7    1e-17   
emb|CEL62439.1|  NADPH-ferrihemoprotein reductase                     92.0    1e-17   
ref|XP_010291109.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  91.7    1e-17   
gb|ENH80862.1|  nadph-cytochrome p450 reductase                       92.0    1e-17   
emb|CCO34427.1|  NADPH-ferrihemoprotein reductase                     92.0    1e-17   
gb|KFV61779.1|  NADPH--cytochrome P450 reductase                      91.7    1e-17   
ref|XP_001384111.2|  hypothetical protein PICST_77786                 91.7    1e-17   
ref|XP_010720066.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  91.7    1e-17   
gb|EKC21191.1|  NADPH--cytochrome P450 reductase                      92.0    1e-17   
ref|XP_003705535.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.0    1e-17   
ref|XP_008280827.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  91.7    1e-17   
gb|AAR26515.1|  antennal oxidoreductase                               91.7    1e-17   
ref|XP_003705534.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  92.0    1e-17   
ref|XP_007280991.1|  NADPH-cytochrome p450 reductase                  91.7    1e-17   
gb|EST07036.1|  NADPH--cytochrome P450 reductase                      91.7    1e-17   
ref|XP_008423675.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  91.3    1e-17   
ref|XP_004350080.1|  NADPH-cytochrome-P450 oxidoreductase             91.7    1e-17   
ref|XP_006608683.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  91.7    1e-17   
ref|XP_006569769.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  91.7    1e-17   
gb|ETE65154.1|  NADPH-cytochrome reductase                            91.3    1e-17   
gb|AIJ00849.1|  NADPH-dependent cytochrome P450 reductase             91.3    1e-17   
ref|XP_008280826.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  91.3    1e-17   
gb|EFX85471.1|  hypothetical protein DAPPUDRAFT_300447                91.3    1e-17   
ref|XP_006608684.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  91.3    1e-17   
gb|EHJ63867.1|  NADPH cytochrome P450 reductase                       91.3    1e-17   
gb|EDK40469.2|  hypothetical protein PGUG_04567                       91.3    1e-17   
ref|XP_011345086.1|  PREDICTED: NADPH--cytochrome P450 reductase      91.3    1e-17   
ref|XP_005502019.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  91.3    1e-17   
ref|XP_003047478.1|  hypothetical protein NECHADRAFT_53872            91.3    1e-17   
gb|ADX95746.1|  NADPH cytochrome P450 reductase                       91.3    1e-17   
gb|EQB58337.1|  hypothetical protein CGLO_01425                       91.3    1e-17   
gb|AFP20584.1|  NADPH cytochrome P450 oxidoreductase                  91.3    1e-17   
ref|XP_001483838.1|  hypothetical protein PGUG_04567                  91.3    1e-17   
ref|XP_009643419.1|  PREDICTED: NADPH--cytochrome P450 reductase      91.3    1e-17   
gb|EMC77066.1|  NADPH--cytochrome P450 reductase                      91.3    1e-17   
emb|CDH57302.1|  nadph cytochrome p450 reductase                      91.3    2e-17   
ref|XP_008423672.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  91.3    2e-17   
gb|KFP21139.1|  NADPH--cytochrome P450 reductase                      91.3    2e-17   
ref|XP_008423671.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  91.3    2e-17   
gb|AAX37331.1|  NADPH-cytochrome P450 oxidoreductase                  91.3    2e-17   
ref|NP_956120.2|  P450 (cytochrome) oxidoreductase b                  88.2    2e-17   
ref|XP_002808949.1|  flavodoxin-like protein                          91.3    2e-17   
gb|EYE96374.1|  hypothetical protein EURHEDRAFT_475758                91.3    2e-17   
emb|CDS12045.1|  hypothetical protein LRAMOSA04240                    91.3    2e-17   
gb|EXA44105.1|  hypothetical protein FOVG_05609                       91.3    2e-17   
ref|XP_011427038.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  90.9    2e-17   
ref|XP_003416645.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  90.9    2e-17   



>emb|CDP11509.1| unnamed protein product [Coffea canephora]
Length=691

 Score =   274 bits (700),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 184/204 (90%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGND--tvvvllttslavivGLLVFIWKRSGDRSKEVKPVVV  204
            MES  EL+RS+ESALGVSLG D   V+++LTTSLA IVGLLVF+WKRS DRSKE KP+V+
Sbjct  1    MESKLELIRSIESALGVSLGEDGNQVLLVLTTSLAAIVGLLVFLWKRSSDRSKETKPLVI  60

Query  205  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
             K  T+ PEE+   VDP KVKVT+FFGTQTGTAEGFAKAL EEI+ARYEKAVVKVVD+DD
Sbjct  61   TKLNTSVPEEEEDDVDPSKVKVTIFFGTQTGTAEGFAKALGEEIKARYEKAVVKVVDLDD  120

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIF  558
            YAADDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF+EG ++R PWLQQLTYG+F
Sbjct  121  YAADDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFSEGLKDREPWLQQLTYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
            GLGNRQYEHFNKIGKVIDE+LSEQ
Sbjct  181  GLGNRQYEHFNKIGKVIDEQLSEQ  204



>gb|ACF17649.1| putative cytochrome reductase [Capsicum annuum]
 gb|AFV95075.1| cytochrome P450 reductase [Capsicum annuum]
Length=686

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            MES+SELVRS+ESA+GVSLG+D V++LLTTS AVIVGL+VF  KRS DRSKEVKPVV PK
Sbjct  1    MESSSELVRSIESAIGVSLGSDAVLMLLTTSFAVIVGLVVFFLKRSSDRSKEVKPVVFPK  60

Query  211  AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaa  390
            ++  +PEE+  V+PGKVKVTVFFGTQTGTAEGFAKAL+EEI+ARYEKAVVKVVDMDDYAA
Sbjct  61   SLNVEPEEEIEVEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAA  120

Query  391  dddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGN  570
            DDD YEEKLKKET+AFFMVATYGDGEPTDNAARFYKWFTEG+ER  WLQ LTYG+FGLGN
Sbjct  121  DDDLYEEKLKKETIAFFMVATYGDGEPTDNAARFYKWFTEGQERGVWLQHLTYGVFGLGN  180

Query  571  RQYEHFNKIGKVIDEKLSEQ  630
            RQYEHFNKIGKVIDE+LSEQ
Sbjct  181  RQYEHFNKIGKVIDEQLSEQ  200



>gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium erythraea]
Length=692

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 184/205 (90%), Gaps = 5/205 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGND---tvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            ME+  ELVRS+ESALGVSLG D    V+++LTTSLAVIVGL+VF+WKRS DRS+E K VV
Sbjct  1    METKLELVRSIESALGVSLGEDGDKVVILVLTTSLAVIVGLVVFLWKRSSDRSRETKSVV  60

Query  202  VPKAMTA--DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdm  375
            VPK +TA  + EE+  +DP KVKVTVFFGTQTGTAEGFAKALAEEI+ RYEKAVVKVVD+
Sbjct  61   VPKLVTALQEEEEEVDLDPSKVKVTVFFGTQTGTAEGFAKALAEEIKTRYEKAVVKVVDL  120

Query  376  ddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGI  555
            DDYAADDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF+E +ER PWLQQLTYG+
Sbjct  121  DDYAADDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFSEVKEREPWLQQLTYGV  180

Query  556  FGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FGLGNRQYEHFNKIGKVID++L EQ
Sbjct  181  FGLGNRQYEHFNKIGKVIDDQLIEQ  205



>ref|XP_009630023.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=686

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 165/200 (83%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            M+S+SELVRS+ESALGVSLG+DTV+VLLTTS AVIVGL+V   KRS DRSKEVKP+V PK
Sbjct  1    MDSSSELVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSDRSKEVKPIVFPK  60

Query  211  AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaa  390
            ++  + EE+  ++PGKVKVTVFFGTQTGTAEGFAKAL+EEI+A YEKAVVKVVDMDDYAA
Sbjct  61   SLHVESEEEIELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKASYEKAVVKVVDMDDYAA  120

Query  391  dddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGN  570
            DDD YEEKLKKET+AFFMVATYGDGEPTDNAARFYKWFTEG+ER  WLQ LTYG+FGLGN
Sbjct  121  DDDLYEEKLKKETVAFFMVATYGDGEPTDNAARFYKWFTEGQERGTWLQHLTYGVFGLGN  180

Query  571  RQYEHFNKIGKVIDEKLSEQ  630
            RQYEHFNKIGKVIDE+LSEQ
Sbjct  181  RQYEHFNKIGKVIDEQLSEQ  200



>ref|XP_009786522.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=686

 Score =   271 bits (692),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 168/200 (84%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            MES+SELVRS+ESALGVSLG+DTV+VLLTTS AVIVGL+V   KRS DRSKEVKP+V PK
Sbjct  1    MESSSELVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSDRSKEVKPIVFPK  60

Query  211  AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaa  390
            ++  +PEE+  ++PGKVKVTVFFGTQTGTAEGFAKAL+EEI+ARYEKAVVKVVDMDDYAA
Sbjct  61   SLHVEPEEEIELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAA  120

Query  391  dddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGN  570
            DDD YEEKLKKET+AFFMVATYGDGEPTDNAARFYKWFTEG+ER  WLQ LTYG+FGLGN
Sbjct  121  DDDLYEEKLKKETVAFFMVATYGDGEPTDNAARFYKWFTEGQERGTWLQHLTYGVFGLGN  180

Query  571  RQYEHFNKIGKVIDEKLSEQ  630
            RQYEHFNKIGKVIDE+LSEQ
Sbjct  181  RQYEHFNKIGKVIDEQLSEQ  200



>ref|XP_007018237.1| NADPH--cytochrome P450 reductase isoform 4 [Theobroma cacao]
 gb|EOY15462.1| NADPH--cytochrome P450 reductase isoform 4 [Theobroma cacao]
Length=517

 Score =   264 bits (675),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 180/206 (87%), Gaps = 6/206 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPV  198
            M S+S+LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S  +RS ++KP+
Sbjct  1    MSSSSDLVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSASERSHDIKPL  60

Query  199  VVPKAMTA--DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V PK ++   D ++DAV+  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD
Sbjct  61   VTPKPISLKDDEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVD  120

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG ER PWLQQLTYG
Sbjct  121  LDDYALDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNEREPWLQQLTYG  180

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+DE+ SEQ
Sbjct  181  VFGLGNRQYEHFNKIAKVLDEQFSEQ  206



>ref|XP_006338052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Solanum tuberosum]
Length=686

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            MES+SEL+RS+ESALGVSLG+DTV+VLLTTS AVIVGL+VF  KRS DRSKEVKPVV PK
Sbjct  1    MESSSELLRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVFFLKRSSDRSKEVKPVVFPK  60

Query  211  AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaa  390
            ++  +PEE+  ++PGKVKVTVFFGTQTGTAEGFAKAL+EEI+ARYEKAVVKVVDMDDYAA
Sbjct  61   SLHVEPEEETELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAA  120

Query  391  dddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGN  570
            DDD YEEKLKKET+AFFMVATYGDGEPTDNAARFYKWFTEG+ER  WLQ L+YG+F LGN
Sbjct  121  DDDIYEEKLKKETVAFFMVATYGDGEPTDNAARFYKWFTEGQERGAWLQNLSYGVFALGN  180

Query  571  RQYEHFNKIGKVIDEKLSEQ  630
            RQYEHFNKIGKVIDE++SEQ
Sbjct  181  RQYEHFNKIGKVIDEQMSEQ  200



>ref|XP_004238001.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=686

 Score =   268 bits (684),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 167/200 (84%), Positives = 185/200 (93%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            MES+ EL+RS+ESALGVSLG+DTV+VLLTTS AVIVGL+VF  KRS DRSKEVKPVV PK
Sbjct  1    MESSLELLRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVFFLKRSSDRSKEVKPVVFPK  60

Query  211  AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaa  390
            ++  +PEE+  ++PGKVKVTVFFGTQTGTAEGFAKAL+EEI+ARYEKAVVKVVDMDDYAA
Sbjct  61   SLHVEPEEETELEPGKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAA  120

Query  391  dddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGN  570
            DDD YEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG+ER  WLQ L+YG+F LGN
Sbjct  121  DDDIYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGQERGAWLQNLSYGVFALGN  180

Query  571  RQYEHFNKIGKVIDEKLSEQ  630
            RQYEHFNKIGKVIDE+LSEQ
Sbjct  181  RQYEHFNKIGKVIDEQLSEQ  200



>ref|XP_010086660.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB22547.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=687

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 178/201 (89%), Gaps = 2/201 (1%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            M S SELVR+LES LGV +  D+V+V+ TT++A+I+GLLV +W+RS DRS+EVKPVVVPK
Sbjct  1    MSSNSELVRTLESLLGVPV-TDSVIVIATTAVALILGLLVLVWRRSSDRSREVKPVVVPK  59

Query  211  AMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddya  387
             +    E++ V +  GK KVTVF+GTQTGTAEGFAKALAEEIRARYEKAVVKVVDMDDYA
Sbjct  60   PLLVKDEDNEVELASGKTKVTVFYGTQTGTAEGFAKALAEEIRARYEKAVVKVVDMDDYA  119

Query  388  adddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLG  567
             DDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG+ ++ WLQQL YG+FGLG
Sbjct  120  VDDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGDNKASWLQQLRYGVFGLG  179

Query  568  NRQYEHFNKIGKVIDEKLSEQ  630
            NRQYEHFNKIGKVIDE+LSEQ
Sbjct  180  NRQYEHFNKIGKVIDEQLSEQ  200



>ref|XP_004501653.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Cicer 
arietinum]
Length=700

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 180/202 (89%), Gaps = 4/202 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVP  207
            S+S+LVR++ES LGVSLG+   D++++++TTS AV++GLLVF+WK+S DRS E+KPV+VP
Sbjct  4    SSSDLVRTIESVLGVSLGDSVSDSLILIVTTSAAVVIGLLVFLWKKSSDRSNELKPVIVP  63

Query  208  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddya  387
            K++  + ++D  V  GK KVTV FGTQTGTAEGFAKALAEEI+ARYEKAVVKVVD+DDYA
Sbjct  64   KSLVKEEDDDIDVGDGKTKVTVLFGTQTGTAEGFAKALAEEIKARYEKAVVKVVDLDDYA  123

Query  388  adddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIFGL  564
             DDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG +ER  WLQ LTYG+FGL
Sbjct  124  MDDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGKDERGTWLQHLTYGVFGL  183

Query  565  GNRQYEHFNKIGKVIDEKLSEQ  630
            GNRQYEHFNKIGK++D+ LSEQ
Sbjct  184  GNRQYEHFNKIGKIVDDDLSEQ  205



>ref|XP_004501654.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=692

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 180/202 (89%), Gaps = 4/202 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVP  207
            S+S+LVR++ES LGVSLG+   D++++++TTS AV++GLLVF+WK+S DRS E+KPV+VP
Sbjct  4    SSSDLVRTIESVLGVSLGDSVSDSLILIVTTSAAVVIGLLVFLWKKSSDRSNELKPVIVP  63

Query  208  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddya  387
            K++  + ++D  V  GK KVTV FGTQTGTAEGFAKALAEEI+ARYEKAVVKVVD+DDYA
Sbjct  64   KSLVKEEDDDIDVGDGKTKVTVLFGTQTGTAEGFAKALAEEIKARYEKAVVKVVDLDDYA  123

Query  388  adddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIFGL  564
             DDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG +ER  WLQ LTYG+FGL
Sbjct  124  MDDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGKDERGTWLQHLTYGVFGL  183

Query  565  GNRQYEHFNKIGKVIDEKLSEQ  630
            GNRQYEHFNKIGK++D+ LSEQ
Sbjct  184  GNRQYEHFNKIGKIVDDDLSEQ  205



>ref|XP_007136327.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
 gb|ESW08321.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
Length=692

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 180/205 (88%), Gaps = 5/205 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S S+LVR++ES LGVSLG+   D+++++ TTS AV++GL+VF+WK+S DRSKEVKPV+
Sbjct  1    MASNSDLVRTVESLLGVSLGDSVSDSLLLIATTSAAVVIGLIVFLWKKSSDRSKEVKPVI  60

Query  202  VPKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmd  378
            VPK +  + E+D V V  GK KVTVFFGTQTGTAEGFAKALAEEI+ARYEKA VKV+D+D
Sbjct  61   VPKDLLMEEEDDEVDVGAGKTKVTVFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLD  120

Query  379  dyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGI  555
            DYA DDDQYEEKLKKETLAFFM+ATYGDGEPTDNAARFYKWFTEG +ER  WLQ+L YG+
Sbjct  121  DYAPDDDQYEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGIDERGTWLQKLAYGV  180

Query  556  FGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FGLGNRQYEHFNKIGKV+DE L+EQ
Sbjct  181  FGLGNRQYEHFNKIGKVVDEALTEQ  205



>ref|XP_007018234.1| P450 reductase 1 isoform 1 [Theobroma cacao]
 gb|EOY15459.1| P450 reductase 1 isoform 1 [Theobroma cacao]
Length=693

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 180/206 (87%), Gaps = 6/206 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPV  198
            M S+S+LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S  +RS ++KP+
Sbjct  1    MSSSSDLVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSASERSHDIKPL  60

Query  199  VVPKAMTA--DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V PK ++   D ++DAV+  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD
Sbjct  61   VTPKPISLKDDEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVD  120

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG ER PWLQQLTYG
Sbjct  121  LDDYALDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNEREPWLQQLTYG  180

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+DE+ SEQ
Sbjct  181  VFGLGNRQYEHFNKIAKVLDEQFSEQ  206



>ref|XP_007018236.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
 gb|EOY15461.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
Length=736

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 180/206 (87%), Gaps = 6/206 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPV  198
            M S+S+LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S  +RS ++KP+
Sbjct  1    MSSSSDLVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSASERSHDIKPL  60

Query  199  VVPKAMTA--DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V PK ++   D ++DAV+  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD
Sbjct  61   VTPKPISLKDDEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVD  120

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG ER PWLQQLTYG
Sbjct  121  LDDYALDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNEREPWLQQLTYG  180

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+DE+ SEQ
Sbjct  181  VFGLGNRQYEHFNKIAKVLDEQFSEQ  206



>gb|ADI49691.1| cytochrome P450 reductase [Withania somnifera]
Length=686

 Score =   264 bits (674),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 162/200 (81%), Positives = 183/200 (92%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            ME +SELVRS+ES++GVSLG+D V++LLTTS AVIVGL+VF  KRS D+ KEVKPVV+PK
Sbjct  1    MELSSELVRSIESSIGVSLGSDMVLMLLTTSFAVIVGLVVFFLKRSSDQRKEVKPVVLPK  60

Query  211  AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaa  390
            ++  +PEE+  ++PGK+KVTVFFGTQTGTAEGFAKAL+EEI+ARYEKAVVKVVDMDDYAA
Sbjct  61   SLHLEPEEETEIEPGKIKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVVKVVDMDDYAA  120

Query  391  dddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGN  570
            DDD YEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG ER  WLQ LTYG+FGLGN
Sbjct  121  DDDLYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGHERGVWLQHLTYGVFGLGN  180

Query  571  RQYEHFNKIGKVIDEKLSEQ  630
            RQYEHFNKIG VIDE+LSEQ
Sbjct  181  RQYEHFNKIGNVIDEQLSEQ  200



>gb|KJB58864.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=586

 Score =   261 bits (666),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 180/206 (87%), Gaps = 6/206 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSL---GNDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPV  198
            M S+S+LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF+WK+SG +RS++VKP+
Sbjct  1    MSSSSDLVGFVESVLGVSLEGSVTDSMIVVATTSLAVILGLLVFLWKKSGSERSRDVKPL  60

Query  199  VVPKAMTADPEED--AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V PK ++   EED  AV+  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD
Sbjct  61   VAPKPVSLKDEEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVD  120

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG ER PWLQQLTYG
Sbjct  121  LDDYAMDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNERQPWLQQLTYG  180

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+DE+LSEQ
Sbjct  181  VFGLGNRQYEHFNKIAKVLDEQLSEQ  206



>dbj|BAC41516.1| NADPH-cytochrome P-450 reductase [Ophiorrhiza pumila]
Length=690

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 176/203 (87%), Gaps = 3/203 (1%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvv--vllttslavivGLLVFIWKRSGDRSKEVKPVVV  204
            M++  EL+RS+ESALGVSLG+D     ++LTTSLAVIVGLL+F+WKRSGDR KE+KPV  
Sbjct  1    MDTKLELIRSIESALGVSLGDDVNQILLVLTTSLAVIVGLLMFLWKRSGDRGKEIKPVGC  60

Query  205  PKAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
             +       EE   VDP KVKVTVFFGTQTGTAEGFAKAL+EEI+ARYEKAV KV D+DD
Sbjct  61   SQGCALLVEEEKEEVDPTKVKVTVFFGTQTGTAEGFAKALSEEIKARYEKAVFKVFDLDD  120

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YAADDDQYEEKLKKETLAFFM+ATYGDGEPTDNAARFYKWFTEG+ER PWLQQLTYG+FG
Sbjct  121  YAADDDQYEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGKEREPWLQQLTYGVFG  180

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIG VI E+LSEQ
Sbjct  181  LGNRQYEHFNKIGNVIHEQLSEQ  203



>gb|KJB58865.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=694

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 180/206 (87%), Gaps = 6/206 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPV  198
            M S+S+LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF+WK+SG +RS++VKP+
Sbjct  1    MSSSSDLVGFVESVLGVSLEGSVTDSMIVVATTSLAVILGLLVFLWKKSGSERSRDVKPL  60

Query  199  VVPKAMTADPEED--AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V PK ++   EED  AV+  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD
Sbjct  61   VAPKPVSLKDEEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVD  120

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG ER PWLQQLTYG
Sbjct  121  LDDYAMDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNERQPWLQQLTYG  180

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+DE+LSEQ
Sbjct  181  VFGLGNRQYEHFNKIAKVLDEQLSEQ  206



>gb|KJB58863.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=693

 Score =   262 bits (669),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 180/206 (87%), Gaps = 6/206 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPV  198
            M S+S+LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF+WK+SG +RS++VKP+
Sbjct  1    MSSSSDLVGFVESVLGVSLEGSVTDSMIVVATTSLAVILGLLVFLWKKSGSERSRDVKPL  60

Query  199  VVPKAMTADPEED--AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V PK ++   EED  AV+  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD
Sbjct  61   VAPKPVSLKDEEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVD  120

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG ER PWLQQLTYG
Sbjct  121  LDDYAMDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNERQPWLQQLTYG  180

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+DE+LSEQ
Sbjct  181  VFGLGNRQYEHFNKIAKVLDEQLSEQ  206



>ref|XP_003602898.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES73149.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=692

 Score =   261 bits (667),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 183/202 (91%), Gaps = 4/202 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVP  207
            S S+LVR++ES LGVSLG+   D+VV+++TTS AVI+GLLVF+WK+S DRSKE+KPV+VP
Sbjct  4    SNSDLVRTIESVLGVSLGDSVSDSVVLIVTTSAAVIIGLLVFLWKKSSDRSKELKPVIVP  63

Query  208  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddya  387
            K++  + ++DA +  GK KVTVFFGTQTGTAEGFAKALAEEI+ARYEKA VKVVDMDDYA
Sbjct  64   KSLVKEEDDDADIADGKTKVTVFFGTQTGTAEGFAKALAEEIKARYEKAFVKVVDMDDYA  123

Query  388  adddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIFGL  564
            ADDDQYEEKLKKETLAFFM+ATYGDGEPTDNAARFYKWFTEG +ER  WLQQLTYG+FGL
Sbjct  124  ADDDQYEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGKDERGTWLQQLTYGVFGL  183

Query  565  GNRQYEHFNKIGKVIDEKLSEQ  630
            GNRQYEHFNKIGKV+D+ LSEQ
Sbjct  184  GNRQYEHFNKIGKVVDDDLSEQ  205



>ref|XP_003522768.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
 gb|KHN08276.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   261 bits (667),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 180/204 (88%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S S+LVR++ES LGVSL +   D+++++ TTS AVI+GLLVF+WK+S DRSKEVKPV+
Sbjct  1    MASNSDLVRAVESLLGVSLADSVSDSLLLIATTSAAVIIGLLVFLWKKSSDRSKEVKPVI  60

Query  202  VPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
            VPK +  D +++  V  GK KVT+FFGTQTGTAEGFAKALAEEI+ARY+KA VKVVD+DD
Sbjct  61   VPKGLPKDEDDEIDVADGKTKVTIFFGTQTGTAEGFAKALAEEIKARYDKAAVKVVDLDD  120

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIF  558
            YAADDDQYEEKLKKET+AFFM+ATYGDGEPTDNAARFYKWFTEG +ER   LQQLTYG+F
Sbjct  121  YAADDDQYEEKLKKETVAFFMLATYGDGEPTDNAARFYKWFTEGKDERGTSLQQLTYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
            GLGNRQYEHFNKIGKV+DE+LSEQ
Sbjct  181  GLGNRQYEHFNKIGKVVDEELSEQ  204



>gb|ACN54323.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=693

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 155/206 (75%), Positives = 179/206 (87%), Gaps = 6/206 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPV  198
            M S+S+LV  +ES LGVSL     D+++V+ TTSLAVI+GLLVF WK+SG +RS++VKP+
Sbjct  1    MSSSSDLVGFVESVLGVSLEGSVTDSMIVIATTSLAVILGLLVFFWKKSGSERSRDVKPL  60

Query  199  VVPKAMTADPEED--AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V PK ++   EED  AV+  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD
Sbjct  61   VAPKPVSLKDEEDDDAVIAAGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVD  120

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG ER PWLQQLTYG
Sbjct  121  LDDYAMDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNERLPWLQQLTYG  180

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+DE+LSEQ
Sbjct  181  VFGLGNRQYEHFNKIAKVLDEQLSEQ  206



>emb|CAA81211.1| NADPH-ferrihemoprotein reductase [Vicia sativa]
Length=692

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 178/202 (88%), Gaps = 4/202 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVP  207
            S S+LVR++ESALG+SLG+   D+VV++ TTS AVI+GLLVF+W++S DRS+E++PV+VP
Sbjct  4    SNSDLVRTIESALGISLGDSVSDSVVIIATTSAAVIIGLLVFLWRKSPDRSRELRPVIVP  63

Query  208  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddya  387
            K      +++  VD GK KVTVF+GTQTGTAEGFAKALAEEI+ARYEKAVVKVVDMDDYA
Sbjct  64   KFTVKHEDDEVEVDRGKTKVTVFYGTQTGTAEGFAKALAEEIKARYEKAVVKVVDMDDYA  123

Query  388  adddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIFGL  564
             DDDQYEEKLKKETL FFM+ATYGDGEPTDNAARFYKWFTEG EER  WLQQLTYG+F L
Sbjct  124  IDDDQYEEKLKKETLVFFMLATYGDGEPTDNAARFYKWFTEGKEERGTWLQQLTYGVFAL  183

Query  565  GNRQYEHFNKIGKVIDEKLSEQ  630
            GNRQYEHFNKIGK++DE L+EQ
Sbjct  184  GNRQYEHFNKIGKIVDEDLTEQ  205



>ref|XP_009791726.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nicotiana sylvestris]
Length=686

 Score =   259 bits (662),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            MES+SELVRS+ES LGVSLG+DTV+VLLT S AVIVGL+V   KRS DRSKEVKP++ PK
Sbjct  1    MESSSELVRSIESELGVSLGSDTVLVLLTMSFAVIVGLVVLFLKRSSDRSKEVKPIMFPK  60

Query  211  AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaa  390
            ++  +PEE+  ++PGKVKVTVFFGTQTGTAEGF+KAL+EEI+ RYEKAVVKV+DMDDYAA
Sbjct  61   SLHVEPEEEIELEPGKVKVTVFFGTQTGTAEGFSKALSEEIKTRYEKAVVKVMDMDDYAA  120

Query  391  dddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGN  570
            DDD Y+EKLKKE +AFFMVATYGDGEPTDNAARFYKWFTEG+ER  WLQ LTYG+FGLGN
Sbjct  121  DDDLYKEKLKKEIVAFFMVATYGDGEPTDNAARFYKWFTEGQERGTWLQHLTYGVFGLGN  180

Query  571  RQYEHFNKIGKVIDEKLSEQ  630
            RQYEHFNKIGKVIDE+L EQ
Sbjct  181  RQYEHFNKIGKVIDEQLREQ  200



>ref|XP_003526551.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Glycine max]
 gb|KHN08988.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   258 bits (660),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 179/204 (88%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S S+LVR++ES LGVSL +   D+++++ TTS A+I+GLLVF+WK+S DRSKE+KPV+
Sbjct  1    MPSNSDLVRAVESLLGVSLADSVSDSLLLIATTSAALIIGLLVFLWKKSSDRSKELKPVI  60

Query  202  VPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
            VPK +  D +++  V  GK KVT+FFGTQTGTAEGFAKALAEEI+ARY+KA VKVVD+DD
Sbjct  61   VPKGLPKDDDDEVDVADGKTKVTIFFGTQTGTAEGFAKALAEEIKARYDKAAVKVVDLDD  120

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIF  558
            YAADDDQYEEKLKKETLAFFM+ATYGDGEPTDNAARFYKWFTEG +ER  WLQ LTYG+F
Sbjct  121  YAADDDQYEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGKDERGTWLQHLTYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
            GLGNRQYEHFNKIGKV+DE LSEQ
Sbjct  181  GLGNRQYEHFNKIGKVVDEDLSEQ  204



>gb|ACF35281.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=692

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 179/205 (87%), Gaps = 5/205 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVK-PV  198
            M S+SEL+R +ES  GVS G   +DTVV++ TTS+AVI GLLVF+WKRS ++S EVK PV
Sbjct  1    MSSSSELIRWIESMFGVSFGESVSDTVVLIATTSVAVITGLLVFLWKRSSNQSTEVKKPV  60

Query  199  VVPKAMTADPEEDAVVD-PGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdm  375
            VVPKA+  D EE+ V   PGK KVTVFFGTQTGTAEGFAK+LAEEI ARYEKAVVKVVD+
Sbjct  61   VVPKALQLDAEEEEVEVGPGKKKVTVFFGTQTGTAEGFAKSLAEEINARYEKAVVKVVDL  120

Query  376  ddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGI  555
            DDYA+ D+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTE +ER PWLQQ TYG+
Sbjct  121  DDYASLDNQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEEKERKPWLQQFTYGV  180

Query  556  FGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FGLGNRQYEHFNKIGKVID++LSEQ
Sbjct  181  FGLGNRQYEHFNKIGKVIDQQLSEQ  205



>ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF48632.1| cytochrome P450, putative [Ricinus communis]
Length=692

 Score =   258 bits (658),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 175/203 (86%), Gaps = 5/203 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVV  204
            S S+LVR +ES LGV LG    +D+VVV++TTS AVI+GLLVF+WKRS DRSKEV P+VV
Sbjct  4    SGSDLVRYIESVLGVELGGSPMSDSVVVIITTSFAVIIGLLVFLWKRSSDRSKEVTPLVV  63

Query  205  PKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
            PK+++   EED A    GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD+DD
Sbjct  64   PKSLSVKDEEDEAETLAGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDD  123

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YA DDDQYEEKLKKETL FFMVATYGDGEPTDNAARFYKWFTE  ER  WLQQLTYGIFG
Sbjct  124  YAMDDDQYEEKLKKETLTFFMVATYGDGEPTDNAARFYKWFTEEHERGVWLQQLTYGIFG  183

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKI KV+DE+L+EQ
Sbjct  184  LGNRQYEHFNKIAKVLDEQLNEQ  206



>gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=687

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 180/198 (91%), Gaps = 0/198 (0%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  216
            S+SEL +S+ESA GVSL  DT++VLLTTS A+IVGL+VF+ KRS DRSKEVKPVV  K++
Sbjct  4    SSSELFKSIESAFGVSLSTDTLIVLLTTSFALIVGLIVFLLKRSSDRSKEVKPVVFTKSL  63

Query  217  TADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadd  396
              +PEE+  ++PGKVKVTVFFGTQTGTAEGFAK++AEEI+ARYEKAVVKVVDMDDYAADD
Sbjct  64   NTEPEEETELEPGKVKVTVFFGTQTGTAEGFAKSIAEEIKARYEKAVVKVVDMDDYAADD  123

Query  397  dQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQ  576
            D YEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG+ER  WLQ LTYG+FGLGNRQ
Sbjct  124  DLYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGQERGVWLQHLTYGVFGLGNRQ  183

Query  577  YEHFNKIGKVIDEKLSEQ  630
            YEHFNKI KVIDE+LSEQ
Sbjct  184  YEHFNKIAKVIDEQLSEQ  201



>gb|EYU36460.1| hypothetical protein MIMGU_mgv1a002296mg [Erythranthe guttata]
Length=690

 Score =   256 bits (654),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 159/203 (78%), Positives = 177/203 (87%), Gaps = 3/203 (1%)
 Frame = +1

Query  31   MESTSELVRS-LESALGVSLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVV  204
            MES+ ELVRS +E  LGV LG++T V++LTTS A+I+GLL+FIWKRS GD SK  KPVVV
Sbjct  1    MESSLELVRSSVEQVLGVKLGDETAVLVLTTSAALILGLLIFIWKRSSGDLSKAAKPVVV  60

Query  205  PKAMTADPEEDAVVDPG-KVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
            PK +T   +E+       KVKV VFFGTQTGTAEGFAKALAEEI+ARYEKAVVKV+D+DD
Sbjct  61   PKLVTLKDDEEEEDLDPDKVKVAVFFGTQTGTAEGFAKALAEEIKARYEKAVVKVIDLDD  120

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YAADDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG+ER PWLQQL YGIF 
Sbjct  121  YAADDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGKEREPWLQQLAYGIFA  180

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIGKVID++LSEQ
Sbjct  181  LGNRQYEHFNKIGKVIDDQLSEQ  203



>pir||A47298 NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung bean
Length=690

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 180/204 (88%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S S+LVR++ES LGVSLG+   D+++++ TTS AV+VGLLVF+WK+S DRSKEVKPVV
Sbjct  1    MASNSDLVRAVESFLGVSLGDSVSDSLLLIATTSAAVVVGLLVFLWKKSSDRSKEVKPVV  60

Query  202  VPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
            VP+ +  + EE+  V  GK KVT+FFGTQTGTAEGFAKALAEEI+ARYEKA VKVVD+DD
Sbjct  61   VPRDLMMEEEEEVDVAAGKTKVTIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDD  120

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIF  558
            YAADDD YEEKLKKE+L FFM+ATYGDGEPTDNAARFYKWFTEG +ER  WLQ+LTYG+F
Sbjct  121  YAADDDLYEEKLKKESLVFFMLATYGDGEPTDNAARFYKWFTEGKDERGIWLQKLTYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
            GLGNRQYEHFNKIGKV+DE+L+EQ
Sbjct  181  GLGNRQYEHFNKIGKVVDEELAEQ  204



>ref|NP_001236742.1| NADPH:P450 reductase [Glycine max]
 gb|AAN85869.1| NADPH:P450 reductase [Glycine max]
Length=689

 Score =   254 bits (648),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 176/203 (87%), Gaps = 4/203 (2%)
 Frame = +1

Query  31   MESTSELVRSL-ESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVP  207
            M S SELVR++ ES LGVS+ +D+V+V+  TS+A+++GLLVF+W++S DRSKE KP+ VP
Sbjct  1    MASNSELVRTVVESVLGVSV-SDSVMVIAATSVALVIGLLVFVWRKSSDRSKEQKPLAVP  59

Query  208  KAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddy  384
            K +  + EED V    GK +V +FFGTQTGTAEGFAKALAEEI+ARYEKA VKV D+DDY
Sbjct  60   KLLVKEDEEDEVDAGSGKTRVAIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVADLDDY  119

Query  385  aadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIFG  561
            A DDDQYEEKLKKE+LAFFM+ATYGDGEPTDNAARFYKWFTEG +ER  WLQQLTYG+FG
Sbjct  120  AMDDDQYEEKLKKESLAFFMLATYGDGEPTDNAARFYKWFTEGKDERGIWLQQLTYGVFG  179

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIGK++DE+LSEQ
Sbjct  180  LGNRQYEHFNKIGKIVDEELSEQ  202



>gb|KHN39959.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=689

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 176/203 (87%), Gaps = 4/203 (2%)
 Frame = +1

Query  31   MESTSELVRSL-ESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVP  207
            M S SELVR++ ES LGVS+ +D+V+V+  TS+A+++GLLVF+W++S DRSKE KP+ VP
Sbjct  1    MASNSELVRTVVESVLGVSV-SDSVMVIAATSVALVIGLLVFVWRKSSDRSKEQKPLAVP  59

Query  208  KAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddy  384
            K +  + EED V    GK +V +FFGTQTGTAEGFAKALAEEI+ARYEKA VKV D+DDY
Sbjct  60   KLLVKEDEEDEVDAGSGKTRVAIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVADLDDY  119

Query  385  aadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIFG  561
            A DDDQYEEKLKKE+LAFFM+ATYGDGEPTDNAARFYKWFTEG +ER  WLQQLTYG+FG
Sbjct  120  AMDDDQYEEKLKKESLAFFMLATYGDGEPTDNAARFYKWFTEGKDERGIWLQQLTYGVFG  179

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIGK++DE+LSEQ
Sbjct  180  LGNRQYEHFNKIGKIVDEELSEQ  202



>ref|XP_008338958.1| PREDICTED: NADPH--cytochrome P450 reductase [Malus domestica]
Length=692

 Score =   253 bits (647),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 148/204 (73%), Positives = 177/204 (87%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S S+LVR+LESALGVS G    DTVVV+ TTS+A+I+G+LV +W+RS DRS+EVK +V
Sbjct  1    MSSNSDLVRALESALGVSFGGSVTDTVVVIATTSIALIIGVLVLVWRRSSDRSREVKQLV  60

Query  202  VPKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmd  378
            VPK +  + E+D   V  GK++VT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD+D
Sbjct  61   VPKPLAVEEEKDEFEVAAGKIRVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLD  120

Query  379  dyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIF  558
            DYA DDD+YEEKLKKETLAFFM+ATYGDGEPTDNAARFYKWFTEG++R  WLQ L YG+F
Sbjct  121  DYAEDDDKYEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGKDRGDWLQHLRYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
             LGNRQYEHFNK+GKV+D+KLSE+
Sbjct  181  ALGNRQYEHFNKVGKVVDDKLSEE  204



>gb|KDO81198.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=599

 Score =   251 bits (641),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 176/203 (87%), Gaps = 5/203 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVV  204
            S S+LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV 
Sbjct  5    SGSDLVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVP  64

Query  205  PKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
             K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD+DD
Sbjct  65   LKPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDD  124

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG +R PWLQQL +G+FG
Sbjct  125  YAMDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNDRGPWLQQLKFGVFG  184

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIG V+DE+L +Q
Sbjct  185  LGNRQYEHFNKIGIVLDEELCKQ  207



>gb|KHG05124.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=693

 Score =   253 bits (645),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 176/206 (85%), Gaps = 6/206 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPV  198
            M S+S+LV  +ES LGVSL     D+++V+ TTSLAVI+GLL+F WK+SG +RS++VKP+
Sbjct  1    MSSSSDLVGFVESVLGVSLEGLVTDSMIVIATTSLAVILGLLLFFWKKSGSERSRDVKPL  60

Query  199  VVPKAMTADPEEDA--VVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V PK ++   EED   V+  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD
Sbjct  61   VAPKPVSLKDEEDDDDVIASGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVD  120

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYA DD+QYEEK KKETLAFFMVATYGDGEPTDNAARFYKWFTEG ER PWLQQLTYG
Sbjct  121  LDDYAMDDEQYEEKFKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNERQPWLQQLTYG  180

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+D +LSEQ
Sbjct  181  VFGLGNRQYEHFNKIAKVLDGQLSEQ  206



>gb|KDO81197.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=635

 Score =   251 bits (642),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 176/203 (87%), Gaps = 5/203 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVV  204
            S S+LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV 
Sbjct  5    SGSDLVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVP  64

Query  205  PKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
             K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD+DD
Sbjct  65   LKPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDD  124

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG +R PWLQQL +G+FG
Sbjct  125  YAMDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNDRGPWLQQLKFGVFG  184

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIG V+DE+L +Q
Sbjct  185  LGNRQYEHFNKIGIVLDEELCKQ  207



>sp|P37116.1|NCPR_VIGRR RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Vigna radiata var. radiata]
 gb|AAA34240.1| NADPH cytochrome P450 [Vigna radiata]
Length=690

 Score =   252 bits (643),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 152/204 (75%), Positives = 179/204 (88%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S S+LVR++ES LGVSLG+   D+++++ TTS AV+VGLLVF+WK+S DRSKEVKPVV
Sbjct  1    MASNSDLVRAVESFLGVSLGDSVSDSLLLIATTSAAVVVGLLVFLWKKSSDRSKEVKPVV  60

Query  202  VPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
            VP+ +  + EE+  V  GK KVT+FFGTQTGTAEGFAKALAEEI+ARYEKA VKVVD+DD
Sbjct  61   VPRDLMMEEEEEVDVAAGKTKVTIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDD  120

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIF  558
            YAADDD YEEKLKKE+L FFM+ATYGDGEP DNAARFYKWFTEG +ER  WLQ+LTYG+F
Sbjct  121  YAADDDLYEEKLKKESLVFFMLATYGDGEPIDNAARFYKWFTEGKDERGIWLQKLTYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
            GLGNRQYEHFNKIGKV+DE+L+EQ
Sbjct  181  GLGNRQYEHFNKIGKVVDEELAEQ  204



>gb|KDO81196.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=669

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 176/203 (87%), Gaps = 5/203 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVV  204
            S S+LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV 
Sbjct  5    SGSDLVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVP  64

Query  205  PKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
             K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD+DD
Sbjct  65   LKPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDD  124

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG +R PWLQQL +G+FG
Sbjct  125  YAMDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNDRGPWLQQLKFGVFG  184

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIG V+DE+L +Q
Sbjct  185  LGNRQYEHFNKIGIVLDEELCKQ  207



>ref|XP_006472452.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Citrus sinensis]
Length=694

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 176/203 (87%), Gaps = 5/203 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVV  204
            S S+LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV 
Sbjct  5    SGSDLVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVP  64

Query  205  PKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
             K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD+DD
Sbjct  65   LKPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDD  124

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG +R PWLQQL +G+FG
Sbjct  125  YAMDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNDRGPWLQQLKFGVFG  184

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIG V+DE+L +Q
Sbjct  185  LGNRQYEHFNKIGIVLDEELCKQ  207



>gb|KDO81193.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=694

 Score =   251 bits (642),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 176/203 (87%), Gaps = 5/203 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVV  204
            S S+LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV 
Sbjct  5    SGSDLVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVP  64

Query  205  PKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
             K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD+DD
Sbjct  65   LKPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDD  124

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG +R PWLQQL +G+FG
Sbjct  125  YAMDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNDRGPWLQQLKFGVFG  184

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIG V+DE+L +Q
Sbjct  185  LGNRQYEHFNKIGIVLDEELCKQ  207



>ref|XP_002265859.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
 emb|CBI19275.3| unnamed protein product [Vitis vinifera]
Length=688

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 148/202 (73%), Positives = 176/202 (87%), Gaps = 3/202 (1%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            M S S L+ ++E+ LGVSLG+++ VV+LTT++AVI+GLL+F+W+ S DR ++VKP+VVPK
Sbjct  1    MSSESNLINTVEAFLGVSLGSESAVVILTTTVAVILGLLIFVWRISSDRGRDVKPLVVPK  60

Query  211  AMTADPEEDAVVDP--GKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddy  384
            A+ A P E+   +   GK KVTVFFGTQTGTAEGFAKALAEEI+ARY+KA +KVVD+DDY
Sbjct  61   AV-AIPAEEDEAEAAVGKTKVTVFFGTQTGTAEGFAKALAEEIKARYDKATIKVVDLDDY  119

Query  385  aadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGL  564
            A DDDQYEEKLKKE LAFFM+ATYGDGEPTDNAARFYKWFTEG+ER  WLQQLTYG+FGL
Sbjct  120  AVDDDQYEEKLKKEALAFFMLATYGDGEPTDNAARFYKWFTEGKEREAWLQQLTYGVFGL  179

Query  565  GNRQYEHFNKIGKVIDEKLSEQ  630
            GNRQYEHFNKI KV+DE LSEQ
Sbjct  180  GNRQYEHFNKIAKVVDELLSEQ  201



>ref|XP_009376208.1| PREDICTED: NADPH--cytochrome P450 reductase [Pyrus x bretschneideri]
Length=692

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 174/204 (85%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S S+LVR+LES LGVS G    DTVVV+ TTS+A+I+G+LV +W+RS DRS+EVK +V
Sbjct  1    MSSNSDLVRALESVLGVSFGGSVTDTVVVIATTSIALIIGVLVLVWRRSSDRSREVKQLV  60

Query  202  VPKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmd  378
            VPK +    EED   V  GK +VT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD+D
Sbjct  61   VPKPLEVKEEEDEFDVAAGKSRVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLD  120

Query  379  dyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIF  558
            DYA DDD YEEKLKKETLAFFM+ATYGDGEPTDNAARFYKWFTEG++R  WLQ L YG+F
Sbjct  121  DYAEDDDTYEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGKDRGSWLQHLKYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
            GLGNRQYEHFNKIGKV+D++LSE+
Sbjct  181  GLGNRQYEHFNKIGKVVDDQLSEE  204



>ref|XP_006433816.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
 gb|ESR47056.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
Length=694

 Score =   250 bits (639),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 175/203 (86%), Gaps = 5/203 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVV  204
            S S+LV+ +ESALG+SLG+   DTV+++ TTS AV +GLLV +WK+S  DRSKEVKPVV 
Sbjct  5    SGSDLVKFVESALGLSLGDSVTDTVILIATTSFAVAIGLLVLVWKKSSSDRSKEVKPVVP  64

Query  205  PKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
             K ++A  E+D A +  GK KVTVF+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD+DD
Sbjct  65   LKPLSAKDEDDEADIAAGKTKVTVFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDD  124

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YA DD+QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG +R PWLQQL +G+FG
Sbjct  125  YAMDDEQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNDRGPWLQQLKFGVFG  184

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIG V+DE+L +Q
Sbjct  185  LGNRQYEHFNKIGIVLDEELCKQ  207



>ref|XP_010530279.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 172/202 (85%), Gaps = 6/202 (3%)
 Frame = +1

Query  43   SELVRSLESALGVSLGN----DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVP  207
            S LVR LESALG+SLG+    D  +V+ TTSLAVIVG  V +W+++  DRS+EVKPVVVP
Sbjct  8    SGLVRYLESALGISLGDSVSDDVALVIATTSLAVIVGFAVLLWRKTATDRSREVKPVVVP  67

Query  208  KAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddy  384
            K++ A  E+D   +  GK +VT+FFGTQTGTAEGFAKALAEEI+ARYEKA VKVVDMDDY
Sbjct  68   KSLMAKDEDDNFDLGSGKTRVTIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVVDMDDY  127

Query  385  aadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGL  564
            AADDD YEEKLKKETLAFF+VATYGDGEPTDNAARFYKWFTEG E   WLQQLTYG+FGL
Sbjct  128  AADDDLYEEKLKKETLAFFVVATYGDGEPTDNAARFYKWFTEGNESGVWLQQLTYGVFGL  187

Query  565  GNRQYEHFNKIGKVIDEKLSEQ  630
            GNRQYEHFNKIG V+DE+LSEQ
Sbjct  188  GNRQYEHFNKIGNVLDEQLSEQ  209



>ref|XP_007226979.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
 gb|EMJ28178.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
Length=692

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 172/204 (84%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S S+LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS DRS+EVK + 
Sbjct  1    MSSNSDLVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSDRSREVKQLA  60

Query  202  VPKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmd  378
            VPK +    EED   V  GK +VT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKV+D+D
Sbjct  61   VPKPLVVKDEEDEFEVASGKTRVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVLDLD  120

Query  379  dyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIF  558
            DYA DDD+YEEKLKKETLAFFM+ATYGDGEPTDNAARFYKWFTEG++R  WLQ L YG+F
Sbjct  121  DYAEDDDKYEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGKDRGGWLQHLQYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
             LGNRQYEHFNKIGKV+D++LSE+
Sbjct  181  ALGNRQYEHFNKIGKVVDDQLSEE  204



>ref|XP_008219252.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Prunus 
mume]
Length=692

 Score =   248 bits (632),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 172/204 (84%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S S+LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS DRS+EVK + 
Sbjct  1    MSSNSDLVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSDRSREVKQLA  60

Query  202  VPKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmd  378
            VPK +    EED   V  GK +VT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKV+D+D
Sbjct  61   VPKPLVVKDEEDEFEVASGKTRVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVLDLD  120

Query  379  dyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIF  558
            DYA DDD+YEEKLKKETLAFFM+ATYGDGEPTDNAARFYKWFTEG++R  WLQ L YG+F
Sbjct  121  DYAEDDDKYEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGKDRGGWLQHLRYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
             LGNRQYEHFNKIGKV+D++LSE+
Sbjct  181  ALGNRQYEHFNKIGKVVDDQLSEE  204



>ref|XP_008219251.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Prunus 
mume]
Length=728

 Score =   248 bits (633),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 172/204 (84%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S S+LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS DRS+EVK + 
Sbjct  1    MSSNSDLVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSDRSREVKQLA  60

Query  202  VPKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmd  378
            VPK +    EED   V  GK +VT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKV+D+D
Sbjct  61   VPKPLVVKDEEDEFEVASGKTRVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVLDLD  120

Query  379  dyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIF  558
            DYA DDD+YEEKLKKETLAFFM+ATYGDGEPTDNAARFYKWFTEG++R  WLQ L YG+F
Sbjct  121  DYAEDDDKYEEKLKKETLAFFMLATYGDGEPTDNAARFYKWFTEGKDRGGWLQHLRYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
             LGNRQYEHFNKIGKV+D++LSE+
Sbjct  181  ALGNRQYEHFNKIGKVVDDQLSEE  204



>gb|AHB33949.1| cytochrome P450 reductase [Santalum album]
Length=692

 Score =   243 bits (621),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 172/205 (84%), Gaps = 5/205 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVS----LGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPV  198
            M S+SEL +S+ SALGVS       +   V++TTS A+IVG ++F+W+RSG++SKE++PV
Sbjct  1    MSSSSELWKSIGSALGVSPPPAWAEEWAAVIVTTSAALIVGFVMFMWRRSGEKSKELRPV  60

Query  199  VVPKAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdm  375
            V  KA   + EED   VD GK KVTVFFGTQTGTAEGFAKALAEEI+ARYEKAVVKVVD+
Sbjct  61   VALKAAPIEAEEDDGEVDSGKTKVTVFFGTQTGTAEGFAKALAEEIKARYEKAVVKVVDL  120

Query  376  ddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGI  555
            DDYAADDDQY EKLK ETL FFMVATYGDGEPTDNAARFYKWFTE +ER  WLQQLTYGI
Sbjct  121  DDYAADDDQYGEKLKNETLTFFMVATYGDGEPTDNAARFYKWFTEEKEREAWLQQLTYGI  180

Query  556  FGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FGLGNRQYEHFNKI KV+DE+L+EQ
Sbjct  181  FGLGNRQYEHFNKIAKVLDEQLTEQ  205



>ref|XP_010520739.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   242 bits (617),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 173/202 (86%), Gaps = 6/202 (3%)
 Frame = +1

Query  43   SELVRSLESALGVSLGN----DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVP  207
            S LVR LESALG+SLG+    D  +V+ TTSLAVIVG  V +W+++  DRS+E+KPV VP
Sbjct  8    SGLVRYLESALGISLGDSVSDDAALVIATTSLAVIVGFAVLLWRKTAADRSREMKPVTVP  67

Query  208  KAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddy  384
            +++ A D ++D  +  GK +VT+FFGTQTGTAEGFAKAL EEI+ARYEKA VKVVDMDDY
Sbjct  68   QSLMAKDEDDDLDMGSGKTRVTIFFGTQTGTAEGFAKALTEEIKARYEKAAVKVVDMDDY  127

Query  385  aadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGL  564
            AADDDQY EKLKKETLAFF++ATYGDGEPTDNAARFYKWFTEG ER  WLQQLTYG+FGL
Sbjct  128  AADDDQYAEKLKKETLAFFIIATYGDGEPTDNAARFYKWFTEGNERGAWLQQLTYGVFGL  187

Query  565  GNRQYEHFNKIGKVIDEKLSEQ  630
            GNRQYEHFNKIGKV+DE+LSEQ
Sbjct  188  GNRQYEHFNKIGKVLDEQLSEQ  209



>ref|XP_004299743.1| PREDICTED: NADPH--cytochrome P450 reductase [Fragaria vesca subsp. 
vesca]
Length=689

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 170/204 (83%), Gaps = 4/204 (2%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  201
            M S+S+LVR LESALGVS G    DT V++ TTS+A+I+G+LV +W+RS DRS+E K + 
Sbjct  1    MSSSSDLVRKLESALGVSFGESVTDTAVLIATTSIALIIGVLVVLWRRSSDRSREFKQLA  60

Query  202  VPKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmd  378
            VPKA+    EED   V  GK +V++F+GTQTGTAEGFAKALAEEI+ARYEKA VKV+D+D
Sbjct  61   VPKAVVVKEEEDEFEVASGKTRVSIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLD  120

Query  379  dyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIF  558
            DYAA+DD+Y EKLKKET+ FFM+ATYGDGEPTDNAARFYKWFTEG +R  WL+QL YG+F
Sbjct  121  DYAAEDDKYGEKLKKETMVFFMLATYGDGEPTDNAARFYKWFTEGTDRGVWLEQLRYGVF  180

Query  559  GLGNRQYEHFNKIGKVIDEKLSEQ  630
            GLGNRQYEHFNKI KV+D+ L EQ
Sbjct  181  GLGNRQYEHFNKIAKVVDDLLVEQ  204



>gb|AIG15451.1| NADPH-cytochrome P450 reductase 1 [Azadirachta indica]
Length=695

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = +1

Query  28   NMESTSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPV  198
            N  + ++LV+ +ESALGVSLG+   DTV+V+ TT  AV++GLLV  WK+S DRSKEVKPV
Sbjct  3    NSGTGNDLVKFVESALGVSLGSSVTDTVIVIATTLFAVVIGLLVLAWKKSSDRSKEVKPV  62

Query  199  VVPKA--MTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V  K+  +  +  ++A +  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VKVVD
Sbjct  63   VPLKSPVLKKEDHDEADIVWGKTKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKVVD  122

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYAADD+QY EKLKKETL FFMVATYGDGEPTDNAARFYKWFTE  +R  WLQQL YG
Sbjct  123  LDDYAADDEQYGEKLKKETLTFFMVATYGDGEPTDNAARFYKWFTEENDRGVWLQQLRYG  182

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKIGKV+DE+L +Q
Sbjct  183  VFGLGNRQYEHFNKIGKVLDEELCKQ  208



>ref|XP_010692385.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=693

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 170/203 (84%), Gaps = 5/203 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSL----GNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVV  204
            STS+L+ S ES  G+SL    G+   ++LL TS+AVIVGL+  +W+RS D S + K VV 
Sbjct  4    STSDLIGSTESVSGLSLDPSSGSSYAILLLWTSIAVIVGLVFVLWRRSNDNSGDSKVVVA  63

Query  205  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
            PK++  +PEED + +  GK KV++FFGTQTGTAEGFAKALAEEI+ARY+KA+VKV+D+DD
Sbjct  64   PKSLKVEPEEDELEIAAGKTKVSIFFGTQTGTAEGFAKALAEEIKARYDKALVKVLDLDD  123

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YAADDD YE KLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG ER PWLQQLT+G+FG
Sbjct  124  YAADDDLYEVKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGNEREPWLQQLTFGVFG  183

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKI KV+DE+L EQ
Sbjct  184  LGNRQYEHFNKIAKVLDEQLIEQ  206



>ref|XP_011016946.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Populus euphratica]
Length=692

 Score =   235 bits (600),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 144/203 (71%), Positives = 167/203 (82%), Gaps = 10/203 (5%)
 Frame = +1

Query  43   SELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKA  213
            S+LVR +ES LGVS G+   D+VVV++TTS AV+ GL+VFI KRS DRSK VKP+VVPK+
Sbjct  6    SDLVRFVESVLGVSFGDSVSDSVVVIITTSFAVVFGLVVFISKRSSDRSKVVKPLVVPKS  65

Query  214  MTADPEEDAVVDP----GKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
            ++   EED   +P    GK KVT+F+GTQTGTA GFAKALAEE++ARYEKA VKVVD+DD
Sbjct  66   LSVKDEED---EPEALAGKTKVTIFYGTQTGTAGGFAKALAEEVKARYEKAAVKVVDLDD  122

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            Y  +DDQYEEKLKKETLA FMVATYGDGEPTDN+ARFYKWFTEG  R  W QQL+YGIFG
Sbjct  123  YDVEDDQYEEKLKKETLALFMVATYGDGEPTDNSARFYKWFTEGNVRGIWRQQLSYGIFG  182

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKI K +D+ L EQ
Sbjct  183  LGNRQYEHFNKIAKELDDLLCEQ  205



>ref|XP_010254555.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=692

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 166/195 (85%), Gaps = 4/195 (2%)
 Frame = +1

Query  58   SLESALGVSLGN----DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTAD  225
            SL+S LG+SLG+    D+ +++ TTS+AV+VGL+ FIWKRS    K  KPVVV K  + +
Sbjct  11   SLQSILGISLGSESVSDSFILIFTTSVAVLVGLVFFIWKRSSAPEKPAKPVVVLKPSSLE  70

Query  226  PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQY  405
             E++  VDPGK KVT+FFGTQTGTAEGFAKALAEEIRARY+KAVVKVVD+DDYAADDDQY
Sbjct  71   EEDEVEVDPGKTKVTIFFGTQTGTAEGFAKALAEEIRARYDKAVVKVVDLDDYAADDDQY  130

Query  406  EEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEH  585
             EKLKKETLAFF+VATYGDGEPTDNAARFYKWFTEGEE   WLQ LTYG+FGLGNRQYEH
Sbjct  131  GEKLKKETLAFFIVATYGDGEPTDNAARFYKWFTEGEESGAWLQHLTYGVFGLGNRQYEH  190

Query  586  FNKIGKVIDEKLSEQ  630
            FNK+ KV+DE+LS Q
Sbjct  191  FNKVAKVVDEQLSGQ  205



>ref|XP_011015338.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
 ref|XP_011015339.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=692

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 170/202 (84%), Gaps = 4/202 (2%)
 Frame = +1

Query  37   STSELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVP  207
            S S LVR +ES LG+S G+   D+VVV++TTS A +VGL+V + KRS DRSK+VKP+VVP
Sbjct  4    SGSNLVRFVESLLGISFGDSLSDSVVVIITTSFAALVGLVVLVLKRSSDRSKDVKPLVVP  63

Query  208  KAMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddy  384
            K+++   EED +    GK KVT+F+GTQTGTAEGFAKALAEE++ARYEKA VKV D+DDY
Sbjct  64   KSVSIKDEEDESEALGGKTKVTIFYGTQTGTAEGFAKALAEEVKARYEKAAVKVFDLDDY  123

Query  385  aadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGL  564
            A +DDQYEEKLKKETLA FMVATYGDGEPTDNAARFYKWFTEG ER  WLQQL+YG+FGL
Sbjct  124  AMEDDQYEEKLKKETLALFMVATYGDGEPTDNAARFYKWFTEGNEREIWLQQLSYGVFGL  183

Query  565  GNRQYEHFNKIGKVIDEKLSEQ  630
            GNRQYEHFNKI KV+D+ L EQ
Sbjct  184  GNRQYEHFNKIAKVLDDLLCEQ  205



>ref|XP_007141274.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
 gb|ESW13268.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
Length=685

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 173/202 (86%), Gaps = 6/202 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            M S  ELVR++   LGVS+ +D+V++++TTS AV++GLLVF+ K+S DRSKE K + VPK
Sbjct  1    MASKYELVRTV---LGVSV-SDSVLLIVTTSAAVLIGLLVFVLKKSSDRSKEQKSLAVPK  56

Query  211  -AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddya  387
             A+  + E++A V  GK +V VFFGTQTGTAEGFAKALAEEI+ARYEKA VKVVD+DDYA
Sbjct  57   LALRQEEEDEADVGLGKTRVVVFFGTQTGTAEGFAKALAEEIKARYEKAAVKVVDLDDYA  116

Query  388  adddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG-EERSPWLQQLTYGIFGL  564
             DDDQYEEKLKKE+LAFFM+ATYGDGEPTDNAARF KWF+EG +ER  WLQQL YG+FGL
Sbjct  117  MDDDQYEEKLKKESLAFFMLATYGDGEPTDNAARFCKWFSEGKDERGTWLQQLKYGVFGL  176

Query  565  GNRQYEHFNKIGKVIDEKLSEQ  630
            GNRQYEHFNKIG+V+D++LSEQ
Sbjct  177  GNRQYEHFNKIGEVVDQELSEQ  198



>ref|XP_010277515.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Nelumbo 
nucifera]
Length=691

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 170/205 (83%), Gaps = 6/205 (3%)
 Frame = +1

Query  31   MESTSELV-RSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSGDRSKEVKP  195
            M S + ++  SL+S LGVSLG    +D+ VV+LTTS AV+V L   +W+RS    K +KP
Sbjct  1    MNSNANVITNSLQSILGVSLGYESVSDSFVVVLTTSAAVLVALAFLVWRRSAPE-KPLKP  59

Query  196  VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdm  375
            V   K ++ + EE+  VDPGK K+T+FFGTQTGTAEGFAKALAEE+RARY+KAVVKVVD+
Sbjct  60   VEALKPVSFEEEEEVEVDPGKTKITIFFGTQTGTAEGFAKALAEEVRARYDKAVVKVVDL  119

Query  376  ddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGI  555
            DDYAADDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG+ER  WLQ LTYG+
Sbjct  120  DDYAADDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGKERGTWLQHLTYGV  179

Query  556  FGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FGLGNRQYEHFN+I KV+DE+ SEQ
Sbjct  180  FGLGNRQYEHFNQIAKVVDEQFSEQ  204



>ref|XP_002307336.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
 gb|AAK15259.1|AF302496_1 NADPH-cytochrome P450 oxydoreductase isoform 1 [Populus trichocarpa 
x Populus deltoides]
 gb|EEE94332.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
Length=692

 Score =   229 bits (584),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 168/200 (84%), Gaps = 4/200 (2%)
 Frame = +1

Query  43   SELVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKA  213
            S L R ++S LG+S G+   D+VVV++TTS A +VGL+V + KRS DRSK+VKP+VVPK+
Sbjct  6    SNLARFVQSVLGISFGDSLSDSVVVIITTSFAALVGLVVLVLKRSSDRSKDVKPLVVPKS  65

Query  214  MTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaa  390
            ++   EED +    GK KVT+F+GTQTGTAEGFAKALAEE++ARYEKA VKV D+DDYA 
Sbjct  66   LSIKDEEDESEALGGKTKVTIFYGTQTGTAEGFAKALAEEVKARYEKAAVKVFDLDDYAM  125

Query  391  dddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGN  570
            +DDQYEEKLKKETLA FMVATYGDGEPTDNAARFYKWFTEG ER  WLQQL+YG+FGLGN
Sbjct  126  EDDQYEEKLKKETLALFMVATYGDGEPTDNAARFYKWFTEGNERGIWLQQLSYGVFGLGN  185

Query  571  RQYEHFNKIGKVIDEKLSEQ  630
            RQYEHFNKI KV+D+ L EQ
Sbjct  186  RQYEHFNKIAKVLDDLLYEQ  205



>gb|KDP41487.1| hypothetical protein JCGZ_15894 [Jatropha curcas]
Length=689

 Score =   229 bits (583),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 175/201 (87%), Gaps = 4/201 (2%)
 Frame = +1

Query  40   TSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            +S+LVR +ES LGVSLG    D++++++TTS+AVIVGL VF+ K+S DRSKEVKPVVVPK
Sbjct  2    SSDLVRYVESVLGVSLGGSVTDSLLLIVTTSVAVIVGLFVFLLKKSSDRSKEVKPVVVPK  61

Query  211  AMTADPEED-AVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddya  387
            ++T   EED A    GK +V +F+GTQTGTAEGFAK+L+EEI+ARYEKA VKVVD+DDYA
Sbjct  62   SLTVKKEEDDAEALAGKTRVIIFYGTQTGTAEGFAKSLSEEIKARYEKAAVKVVDLDDYA  121

Query  388  adddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLG  567
            ADD++YEEKLKKETL+FFMVATYGDGEPTDNAARFYKW TE  ER  WLQQLT+G+FGLG
Sbjct  122  ADDEEYEEKLKKETLSFFMVATYGDGEPTDNAARFYKWLTEENERGVWLQQLTFGVFGLG  181

Query  568  NRQYEHFNKIGKVIDEKLSEQ  630
            NRQYEHFNKI KV+DE+LSEQ
Sbjct  182  NRQYEHFNKIAKVLDEQLSEQ  202



>ref|XP_006413419.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
 gb|ESQ54872.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
Length=694

 Score =   226 bits (576),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 162/197 (82%), Gaps = 2/197 (1%)
 Frame = +1

Query  46   ELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAMTA  222
            +L  +L + LG SL +D V+ + TTSLA+ VG  V +WK+S  DRS+E+KP+V+PK++ A
Sbjct  13   QLKSTLTTFLGDSLSDDVVLAIATTSLALAVGFAVLLWKKSASDRSRELKPLVIPKSLMA  72

Query  223  DPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaaddd  399
              E+D V +  GK +V++FFGTQTGTAEGFAKALAEEIRARYEKA VKV+D+DDYAADDD
Sbjct  73   KDEDDDVDLISGKTRVSIFFGTQTGTAEGFAKALAEEIRARYEKAAVKVIDLDDYAADDD  132

Query  400  QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQY  579
            QY EKLKKETLAFF VATYGDGEPTDNAARFYKWFTEG E    LQQL YG+F LGNRQY
Sbjct  133  QYHEKLKKETLAFFCVATYGDGEPTDNAARFYKWFTEGNELDIRLQQLAYGVFALGNRQY  192

Query  580  EHFNKIGKVIDEKLSEQ  630
            EHFNKIG V+DE+L ++
Sbjct  193  EHFNKIGIVLDEELCKK  209



>ref|NP_194183.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 sp|Q9SB48.1|NCPR1_ARATH RecName: Full=NADPH--cytochrome P450 reductase 1 [Arabidopsis 
thaliana]
 emb|CAA23011.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 emb|CAB79362.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAK96879.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAP37785.1| At4g24520 [Arabidopsis thaliana]
 gb|AEE84919.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AGA15807.1| CPR1 [Expression vector pUDE172]
Length=692

 Score =   221 bits (564),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 166/199 (83%), Gaps = 3/199 (2%)
 Frame = +1

Query  43   SELVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAM  216
            S+L + L+S +G  SL +D V+V+ TTSLA++ G +V +WK++  DRS E+KP+++PK++
Sbjct  8    SDLFKQLKSIMGTDSLSDDVVLVIATTSLALVAGFVVLLWKKTTADRSGELKPLMIPKSL  67

Query  217  TA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaad  393
             A D ++D  +  GK +V++FFGTQTGTAEGFAKAL+EEI+ARYEKA VKV+D+DDYAAD
Sbjct  68   MAKDEDDDLDLGSGKTRVSIFFGTQTGTAEGFAKALSEEIKARYEKAAVKVIDLDDYAAD  127

Query  394  ddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNR  573
            DDQYEEKLKKETLAFF VATYGDGEPTDNAARFYKWFTE  ER   LQQL YG+F LGNR
Sbjct  128  DDQYEEKLKKETLAFFCVATYGDGEPTDNAARFYKWFTEENERDIKLQQLAYGVFALGNR  187

Query  574  QYEHFNKIGKVIDEKLSEQ  630
            QYEHFNKIG V+DE+L ++
Sbjct  188  QYEHFNKIGIVLDEELCKK  206



>ref|XP_002867662.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43921.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
Length=692

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/199 (65%), Positives = 167/199 (84%), Gaps = 3/199 (2%)
 Frame = +1

Query  43   SELVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAM  216
            S+L + L+S +G  S+ +D V+V+ TTSLA++ G +V +W+++  DRS+E+KP+++PK++
Sbjct  8    SDLFKQLKSIIGTDSISDDVVLVIATTSLALVAGFVVLLWRKTTADRSQELKPLMIPKSL  67

Query  217  TA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaad  393
             A D ++D  +  GK +V++FFGTQTGTAEGFAKAL+EEI+ARYEKA VKV+D+DDYAAD
Sbjct  68   MAKDEDDDLDLGSGKTRVSIFFGTQTGTAEGFAKALSEEIKARYEKAAVKVIDLDDYAAD  127

Query  394  ddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNR  573
            DDQYEEKLKKETLAFF VATYGDGEPTDNAARFYKWFTE  ER   LQQL YG+F LGNR
Sbjct  128  DDQYEEKLKKETLAFFCVATYGDGEPTDNAARFYKWFTEENEREIRLQQLAYGVFALGNR  187

Query  574  QYEHFNKIGKVIDEKLSEQ  630
            QYEHFNKIG V+DE+L ++
Sbjct  188  QYEHFNKIGIVLDEELCKK  206



>emb|CDY03447.1| BnaC01g16350D [Brassica napus]
Length=695

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 135/197 (69%), Positives = 168/197 (85%), Gaps = 4/197 (2%)
 Frame = +1

Query  52   VRSLESA-LGVSLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA-  222
            V+S+  A LG S+ +D V+V+ TTSLA++VG +V +WK++  D+S+E+KP+V+PK++ A 
Sbjct  14   VKSILGAFLGDSVSDDVVLVIATTSLALVVGFVVLVWKKTTSDQSQELKPLVIPKSLMAK  73

Query  223  -DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaaddd  399
             + EED  +  GK +V++FFGTQTGTAEGFAKALAEEI+ARYEKA VKV+D+DDYAADDD
Sbjct  74   DEDEEDVDLGSGKERVSIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLDDYAADDD  133

Query  400  QYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQY  579
            QYEEKLKKETL+FF VATYGDGEPTDNAARFYKWFTEG E    LQQLTYG+F LGNRQY
Sbjct  134  QYEEKLKKETLSFFCVATYGDGEPTDNAARFYKWFTEGTEGDIRLQQLTYGVFALGNRQY  193

Query  580  EHFNKIGKVIDEKLSEQ  630
            EHFNKIG V+DE+LS++
Sbjct  194  EHFNKIGIVLDEELSKK  210



>ref|XP_010433757.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Camelina 
sativa]
 ref|XP_010433758.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433759.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X3 [Camelina 
sativa]
Length=691

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 166/198 (84%), Gaps = 2/198 (1%)
 Frame = +1

Query  43   SELVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAM  216
            S+L + L+S +G  S+ +D V+V+ TTSLA++ G +V +W+++  D+++E+KP+V+PK++
Sbjct  8    SDLFKQLKSIIGTDSISDDVVLVIATTSLALVAGFVVLLWRKTTADQTRELKPMVLPKSL  67

Query  217  TADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadd  396
             A  ++DA +  GK +V++FFGTQTGTAEGFAKAL+EEI+ARYE A V+V+D+DDYAADD
Sbjct  68   MAKDDDDADLGSGKTRVSIFFGTQTGTAEGFAKALSEEIKARYENAAVRVIDLDDYAADD  127

Query  397  dQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQ  576
            DQYEEKLKKETLAFF VATYGDGEPTDNAARFYKWFTE  ER   L QLTYG+F LGNRQ
Sbjct  128  DQYEEKLKKETLAFFCVATYGDGEPTDNAARFYKWFTEENERDISLGQLTYGVFALGNRQ  187

Query  577  YEHFNKIGKVIDEKLSEQ  630
            YEHFNKIG V+DE+L ++
Sbjct  188  YEHFNKIGIVLDEELCKK  205



>gb|KJB14708.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=672

 Score =   219 bits (557),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 169/206 (82%), Gaps = 6/206 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKR-SGDRSKEVKPV  198
            M S S LV  +ES LG+SLG    D+++++ TTSLAVI+  L+F+WK     RS +VK +
Sbjct  1    MSSRSGLVSFVESVLGMSLGGSVTDSMLMIATTSLAVILVFLIFLWKNLVSQRSPDVKLL  60

Query  199  VV--PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V   P ++  D ++DA+V  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VK VD
Sbjct  61   VASKPVSLKVDEDDDALVASGKKKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKAVD  120

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYA DD++YEEKLKKETLAFFMVATYGDGEPTDN+ARFYKWFTEG ER  WLQ+LTYG
Sbjct  121  LDDYAVDDEEYEEKLKKETLAFFMVATYGDGEPTDNSARFYKWFTEGNERQSWLQRLTYG  180

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+DEKLSEQ
Sbjct  181  VFGLGNRQYEHFNKIAKVLDEKLSEQ  206



>ref|XP_010448554.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 166/198 (84%), Gaps = 2/198 (1%)
 Frame = +1

Query  43   SELVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAM  216
            S+L + L+S +G  S+ +D V+V+ TTSLA++ G +V +W+++  D+++E+KP+V+PK++
Sbjct  8    SDLFKQLKSIIGTDSMSDDVVLVIATTSLALVAGFVVLLWRKTTADQTRELKPMVLPKSL  67

Query  217  TADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadd  396
             A  ++DA +  GK +V++FFGTQTGTAEGFAKAL+EEI+ARYE A V+V+D+DDYAADD
Sbjct  68   MAKDDDDADLGSGKTRVSIFFGTQTGTAEGFAKALSEEIKARYEHAAVRVIDLDDYAADD  127

Query  397  dQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQ  576
            DQYEEKLKKETLAFF VATYGDGEPTDNAARF+KWFTE  ER   L QLTYG+F LGNRQ
Sbjct  128  DQYEEKLKKETLAFFCVATYGDGEPTDNAARFFKWFTEDNERDISLGQLTYGVFALGNRQ  187

Query  577  YEHFNKIGKVIDEKLSEQ  630
            YEHFNKIG V+DE+L ++
Sbjct  188  YEHFNKIGIVLDEELCKK  205



>ref|XP_010439016.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 166/198 (84%), Gaps = 2/198 (1%)
 Frame = +1

Query  43   SELVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAM  216
            S+L + L+S +G  S+ +D V+V+ TTSLA++ G +V +W+++  D+++E+KP+V+PK++
Sbjct  8    SDLFKQLKSIIGTDSISDDVVLVIATTSLALVAGFVVLLWRKTTADQTRELKPMVLPKSL  67

Query  217  TADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadd  396
             A  ++DA +  GK +V++FFGTQTGTAEGFAKAL+EEI+ARYE A V+VVD+DDYAADD
Sbjct  68   MAKDDDDADLGSGKTRVSIFFGTQTGTAEGFAKALSEEIKARYENAAVRVVDLDDYAADD  127

Query  397  dQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQ  576
            DQYEEKLKKETLAFF VATYGDGEPTDNAARF+KWFTE  ER   L QLTYG+F LGNRQ
Sbjct  128  DQYEEKLKKETLAFFCVATYGDGEPTDNAARFFKWFTEDNERDISLGQLTYGVFALGNRQ  187

Query  577  YEHFNKIGKVIDEKLSEQ  630
            YEHFNKIG V+DE+L ++
Sbjct  188  YEHFNKIGIVLDEELCKK  205



>gb|KJB14707.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=693

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 169/206 (82%), Gaps = 6/206 (3%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKR-SGDRSKEVKPV  198
            M S S LV  +ES LG+SLG    D+++++ TTSLAVI+  L+F+WK     RS +VK +
Sbjct  1    MSSRSGLVSFVESVLGMSLGGSVTDSMLMIATTSLAVILVFLIFLWKNLVSQRSPDVKLL  60

Query  199  VV--PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            V   P ++  D ++DA+V  GK KVT+F+GTQTGTAEGFAKALAEEI+ARYEKA VK VD
Sbjct  61   VASKPVSLKVDEDDDALVASGKKKVTIFYGTQTGTAEGFAKALAEEIKARYEKAAVKAVD  120

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYA DD++YEEKLKKETLAFFMVATYGDGEPTDN+ARFYKWFTEG ER  WLQ+LTYG
Sbjct  121  LDDYAVDDEEYEEKLKKETLAFFMVATYGDGEPTDNSARFYKWFTEGNERQSWLQRLTYG  180

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+DEKLSEQ
Sbjct  181  VFGLGNRQYEHFNKIAKVLDEKLSEQ  206



>ref|XP_009138137.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=694

 Score =   218 bits (556),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 168/207 (81%), Gaps = 8/207 (4%)
 Frame = +1

Query  28   NMESTSELVRSLESALGVSL----GNDtvvvllttslavivGLLVFIWKRS-GDRSKEVK  192
              +++S L + L+S LG+SL     +D V+V+ TTSLA+ VG  V +WK++  D+S+EVK
Sbjct  4    TFDASSALAKQLKSVLGMSLDTPVSDDAVLVIATTSLALAVGFAVLLWKKTTSDQSREVK  63

Query  193  PVVVPKA-MTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvv  369
            P++VPK+ MT + EED  +  GK +V++FFGTQTG AEGFAKALAEEI+ RYEKA VKV+
Sbjct  64   PLMVPKSLMTKEEEED--LGSGKSRVSIFFGTQTGNAEGFAKALAEEIKVRYEKAAVKVI  121

Query  370  dmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTY  549
            D+DDYAADDDQYEEKLK ETL+FF VATYGDGEPTDNAARFYKWFTEG E    LQQLTY
Sbjct  122  DLDDYAADDDQYEEKLKTETLSFFCVATYGDGEPTDNAARFYKWFTEGNEGDMRLQQLTY  181

Query  550  GIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            G+F LGNRQYEHFNKIG V+DE+LS++
Sbjct  182  GVFALGNRQYEHFNKIGIVLDEELSKK  208



>emb|CAA46814.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=692

 Score =   218 bits (555),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 131/199 (66%), Positives = 165/199 (83%), Gaps = 3/199 (2%)
 Frame = +1

Query  43   SELVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAM  216
            S+L + L+S +G  SL +D V+V+ TTSLA++ G +V +WK++  DRS E+KP+++PK++
Sbjct  8    SDLFKQLKSIMGTDSLSDDVVLVIATTSLALVAGFVVLLWKKTTADRSGELKPLMIPKSL  67

Query  217  TA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaad  393
             A D ++D  +  GK +V++FFGTQTGTAEGFAKAL+EEI+ARYEKA VKV+D+DDYAAD
Sbjct  68   MAKDEDDDLDLGSGKTRVSIFFGTQTGTAEGFAKALSEEIKARYEKAAVKVIDLDDYAAD  127

Query  394  ddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNR  573
            DDQYEEKLKKETLAFF VATYGDGEPTDNAARF KWFTE  ER   LQQL YG+F LGNR
Sbjct  128  DDQYEEKLKKETLAFFCVATYGDGEPTDNAARFSKWFTEENERDIKLQQLAYGVFALGNR  187

Query  574  QYEHFNKIGKVIDEKLSEQ  630
            QYEHFNKIG V+DE+L ++
Sbjct  188  QYEHFNKIGIVLDEELCKK  206



>emb|CDY70343.1| BnaCnng67910D, partial [Brassica napus]
Length=593

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 164/206 (80%), Gaps = 5/206 (2%)
 Frame = +1

Query  28   NMESTSELVRSLESALGVSL----GNDtvvvllttslavivGLLVFIWKRS-GDRSKEVK  192
              +++S L + L+S LG+SL     +D V+V+ TTSLA+ VG    +WK++  D+ +EVK
Sbjct  4    TFDASSALAKQLKSVLGMSLDTPVSDDVVLVIATTSLALAVGFAALLWKKTTSDQRREVK  63

Query  193  PVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            P++VPK++    ++D  +  GK +V++FFGTQTG AEGFAKALAEEI+ RYEKA VKV+D
Sbjct  64   PLMVPKSLIMAKDDDVDLGSGKSRVSIFFGTQTGNAEGFAKALAEEIKVRYEKAAVKVID  123

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYAADDDQY+EKLKKETLAFF VATYGDGEPTDNAARFYKWFTEG E    LQ LTYG
Sbjct  124  LDDYAADDDQYKEKLKKETLAFFCVATYGDGEPTDNAARFYKWFTEGNEGDTRLQLLTYG  183

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +F LGNRQYEHFNKIG V+DE+LS++
Sbjct  184  VFALGNRQYEHFNKIGIVLDEELSKK  209



>ref|XP_009138145.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=695

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 167/196 (85%), Gaps = 3/196 (2%)
 Frame = +1

Query  52   VRSLESA-LGVSLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA-  222
            V+S+  A LG S+ +D V+V+ TTSLA++VG +V +W+++  D+SKE+KP+V+PK++ A 
Sbjct  14   VKSILGAFLGDSVSDDVVLVIATTSLALVVGFVVLVWRKTTSDQSKELKPLVIPKSLMAK  73

Query  223  DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQ  402
            D +ED  +  GK +V++FFGTQTGTAEGFAKALAEEI+ARYEKA VKV+D+DDYAADDDQ
Sbjct  74   DEDEDVDLGSGKERVSIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLDDYAADDDQ  133

Query  403  YEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYE  582
            YEEKLKKETL+FF VATYGDGEPTDNAARFYKWFTEG E    LQ+L YG+F LGNRQYE
Sbjct  134  YEEKLKKETLSFFCVATYGDGEPTDNAARFYKWFTEGTEGDIRLQKLAYGVFALGNRQYE  193

Query  583  HFNKIGKVIDEKLSEQ  630
            HFNKIG V+DE+LS++
Sbjct  194  HFNKIGIVLDEELSKK  209



>emb|CDY34288.1| BnaA01g13910D [Brassica napus]
Length=695

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 167/196 (85%), Gaps = 3/196 (2%)
 Frame = +1

Query  52   VRSLESA-LGVSLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAMTA-  222
            V+S+  A LG S+ +D V+V+ TTSLA++VG +V +W+++  D+SKE+KP+V+PK++ A 
Sbjct  14   VKSILGAFLGDSVSDDVVLVIATTSLALVVGFVVLVWRKTTSDQSKELKPLVIPKSLMAK  73

Query  223  DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQ  402
            D +ED  +  GK +V++FFGTQTGTAEGFAKALAEEI+ARYEKA VKV+D+DDYAADDDQ
Sbjct  74   DEDEDVDLGSGKERVSIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLDDYAADDDQ  133

Query  403  YEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYE  582
            YEEKLKKETL+FF VATYGDGEPTDNAARFYKWFTEG E    LQ+L YG+F LGNRQYE
Sbjct  134  YEEKLKKETLSFFCVATYGDGEPTDNAARFYKWFTEGTEGDIRLQKLAYGVFALGNRQYE  193

Query  583  HFNKIGKVIDEKLSEQ  630
            HFNKIG V+DE+LS++
Sbjct  194  HFNKIGIVLDEELSKK  209



>ref|XP_010277516.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Nelumbo 
nucifera]
Length=651

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 163/198 (82%), Gaps = 6/198 (3%)
 Frame = +1

Query  31   MESTSELV-RSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSGDRSKEVKP  195
            M S + ++  SL+S LGVSLG    +D+ VV+LTTS AV+V L   +W+RS    K +KP
Sbjct  1    MNSNANVITNSLQSILGVSLGYESVSDSFVVVLTTSAAVLVALAFLVWRRSAPE-KPLKP  59

Query  196  VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdm  375
            V   K ++ + EE+  VDPGK K+T+FFGTQTGTAEGFAKALAEE+RARY+KAVVKVVD+
Sbjct  60   VEALKPVSFEEEEEVEVDPGKTKITIFFGTQTGTAEGFAKALAEEVRARYDKAVVKVVDL  119

Query  376  ddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGI  555
            DDYAADDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG+ER  WLQ LTYG+
Sbjct  120  DDYAADDDQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGKERGTWLQHLTYGV  179

Query  556  FGLGNRQYEHFNKIGKVI  609
            FGLGNRQYEHFN++  V+
Sbjct  180  FGLGNRQYEHFNQVQSVL  197



>emb|CDY11017.1| BnaA03g46760D [Brassica napus]
Length=695

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 162/203 (80%), Gaps = 6/203 (3%)
 Frame = +1

Query  40   TSELVRSLESALGVSLGNDtvvvllttsl----avivGLLVFIWKRS-GDRSKEVKPVVV  204
             S+L + L S LG  LG+     ++   +    AV+VG +V +W+++  DR +E+KP+++
Sbjct  7    ASDLFKQLRSILGPYLGDSVSDDVVLVVVTTSLAVVVGFVVLLWRKTTSDRGQELKPLMI  66

Query  205  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
            PK++ A  E+D V +  GK +V++FFGTQTGTAEGFAKALAEEI+ARYEKA VKV+D+DD
Sbjct  67   PKSLMAKDEDDDVDLGSGKTRVSIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLDD  126

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YAADDDQYEEK+KKETLAFF +ATYGDGEPTDNAARFYKWFTEG E    LQQLTYG+F 
Sbjct  127  YAADDDQYEEKMKKETLAFFCIATYGDGEPTDNAARFYKWFTEGNEGEIRLQQLTYGVFA  186

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIG V+DE+LS++
Sbjct  187  LGNRQYEHFNKIGIVLDEELSKK  209



>ref|NP_001190823.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AEE84920.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
Length=688

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 155/199 (78%), Gaps = 7/199 (4%)
 Frame = +1

Query  43   SELVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKAM  216
            S+L + L+S +G  SL +D V+V+ TTSLA++ G +V +WK++  DRS E+KP+++PK++
Sbjct  8    SDLFKQLKSIMGTDSLSDDVVLVIATTSLALVAGFVVLLWKKTTADRSGELKPLMIPKSL  67

Query  217  TA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaad  393
             A D ++D  +  GK +V++FFGTQTGTAEGFAKAL+EEI+ARYEKA VK     D    
Sbjct  68   MAKDEDDDLDLGSGKTRVSIFFGTQTGTAEGFAKALSEEIKARYEKAAVKDDYAADDD--  125

Query  394  ddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNR  573
              QYEEKLKKETLAFF VATYGDGEPTDNAARFYKWFTE  ER   LQQL YG+F LGNR
Sbjct  126  --QYEEKLKKETLAFFCVATYGDGEPTDNAARFYKWFTEENERDIKLQQLAYGVFALGNR  183

Query  574  QYEHFNKIGKVIDEKLSEQ  630
            QYEHFNKIG V+DE+L ++
Sbjct  184  QYEHFNKIGIVLDEELCKK  202



>ref|XP_009137450.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Brassica 
rapa]
Length=695

 Score =   216 bits (551),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 162/202 (80%), Gaps = 6/202 (3%)
 Frame = +1

Query  43   SELVRSLESALGVSLGNDtvvvllttsl----avivGLLVFIWKRS-GDRSKEVKPVVVP  207
            S+L + L S LG  LG+     ++   +    AV+VG +V +W+++  DR +E+KP+++P
Sbjct  8    SDLFKQLRSILGPYLGDSVSDDVVLVVVTTSLAVVVGFVVLLWRKTTSDRGQELKPLMIP  67

Query  208  KAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddy  384
            K++ A  E+D V +  GK +V++FFGTQTGTAEGFAKALAEEI+ARYEKA VKV+D+DDY
Sbjct  68   KSLMAKDEDDDVDLGSGKTRVSIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLDDY  127

Query  385  aadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGL  564
            AADDDQYEEK+KKETLAFF +ATYGDGEPTDNAARFYKWFTEG E    LQQLTYG+F L
Sbjct  128  AADDDQYEEKMKKETLAFFCIATYGDGEPTDNAARFYKWFTEGNEGEIRLQQLTYGVFAL  187

Query  565  GNRQYEHFNKIGKVIDEKLSEQ  630
            GNRQYEHFNKIG V+DE+LS++
Sbjct  188  GNRQYEHFNKIGIVLDEELSKK  209



>gb|AAS00459.1| NADPH:cytochrome P450-reductase [Hypericum androsaemum]
Length=685

 Score =   215 bits (548),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 135/192 (70%), Positives = 159/192 (83%), Gaps = 4/192 (2%)
 Frame = +1

Query  61   LESALGVSLGNDtvvvllttslavivGLL-VFIWKRSGDRSKEVKPVVVP-KAMTADPEE  234
            +E ALGV  G D+V+V++TTSL  ++G++ +F+WKRS DR K+ K +VVP K ++   EE
Sbjct  9    VEWALGV--GTDSVLVVITTSLVAVIGVVALFLWKRSSDRGKDPKTLVVPPKPLSLKEEE  66

Query  235  DAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYEEK  414
            +     GK KV +F+GTQTGTAEGFAKALAEEI+ RYEKAVVKVVD+DDYA DDDQYEEK
Sbjct  67   EEDEAEGKTKVCIFYGTQTGTAEGFAKALAEEIKVRYEKAVVKVVDLDDYALDDDQYEEK  126

Query  415  LKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNK  594
            LKKETLAFFMVATYGDGEPTDNAARFYKWFTE  ER  WLQQL +G+FGLGNRQYEHFNK
Sbjct  127  LKKETLAFFMVATYGDGEPTDNAARFYKWFTEEHERGVWLQQLKFGVFGLGNRQYEHFNK  186

Query  595  IGKVIDEKLSEQ  630
            I KV+DE+  EQ
Sbjct  187  IAKVLDEQFCEQ  198



>emb|CDX92639.1| BnaC07g38970D [Brassica napus]
Length=695

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 158/203 (78%), Gaps = 6/203 (3%)
 Frame = +1

Query  40   TSELVRSLESALGVSLGNDtvvvllttslaviv----GLLVFIWKRS-GDRSKEVKPVVV  204
             S+L + L S LG  LG+     ++   +   +    G +V +W+++  DR +E+KP+++
Sbjct  7    ASDLFKQLRSILGPYLGDSVSDDVVLVVVTTSLALVFGFVVLLWRKTTSDRGQELKPLMI  66

Query  205  PKAMTADPEEDAV-VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmdd  381
            PK++ A  E+D V +  GK +V++FFGTQTGTAEGFAKALAEEI+ARYEKA VKV+D+DD
Sbjct  67   PKSLMAKDEDDDVDLGSGKERVSIFFGTQTGTAEGFAKALAEEIKARYEKAAVKVIDLDD  126

Query  382  yaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFG  561
            YA DDDQYEEK+KKETLAFF +ATYGDGEPTDNAARFYKWFTEG E    LQQLTYG+F 
Sbjct  127  YAGDDDQYEEKMKKETLAFFCIATYGDGEPTDNAARFYKWFTEGNEGDIRLQQLTYGVFA  186

Query  562  LGNRQYEHFNKIGKVIDEKLSEQ  630
            LGNRQYEHFNKIG V+DE+LS++
Sbjct  187  LGNRQYEHFNKIGIVLDEELSKK  209



>emb|CDY34287.1| BnaA01g13900D [Brassica napus]
Length=694

 Score =   215 bits (548),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 167/207 (81%), Gaps = 8/207 (4%)
 Frame = +1

Query  28   NMESTSELVRSLESALGVSL----GNDtvvvllttslavivGLLVFIWKRS-GDRSKEVK  192
              +++S L + L+S LG+SL     +D V+V+ TTSLA+ VG    +WK++  D+S+EVK
Sbjct  4    TFDASSALAKQLKSVLGMSLDTPVSDDAVLVIATTSLALAVGFAALLWKKTTSDQSREVK  63

Query  193  PVVVPKA-MTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvv  369
            P++VPK+ MT + EED  +  GK +V++FFGTQTG AEGFAKALAEEI+ RYEKA VKV+
Sbjct  64   PLMVPKSLMTKEEEED--LGSGKSRVSIFFGTQTGNAEGFAKALAEEIKVRYEKAAVKVI  121

Query  370  dmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTY  549
            D+DDYAADDDQY+EKLKKETL+FF VATYGDGEPTDNAARFYKWFTEG E    LQQLTY
Sbjct  122  DLDDYAADDDQYKEKLKKETLSFFCVATYGDGEPTDNAARFYKWFTEGNEGDTRLQQLTY  181

Query  550  GIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
             +F LGNRQYEHFNKIG V+DE+LS++
Sbjct  182  SVFALGNRQYEHFNKIGIVLDEELSKK  208



>ref|XP_006285937.1| hypothetical protein CARUB_v10007449mg [Capsella rubella]
 gb|EOA18835.1| hypothetical protein CARUB_v10007449mg [Capsella rubella]
Length=692

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 167/199 (84%), Gaps = 3/199 (2%)
 Frame = +1

Query  43   SELVRSLESALGV-SLGNDtvvvllttslavivGLLVFIWKRS-GDRSKEVKPVVVPKA-  213
            S+L + L+S +G  S+ +D V+V+ TTSLA++ G +V +W++S  D+S+E+KP+V+PK+ 
Sbjct  8    SDLFKQLKSIIGTDSISDDVVLVIATTSLALVAGFVVLLWRKSTADQSRELKPLVIPKSL  67

Query  214  MTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaad  393
            M+ D ++D  +  GK +V++FFGTQTGTAEGFAKAL+EEI+ARYEKA V+V+D+DDYAAD
Sbjct  68   MSKDDDDDVDLGSGKTRVSIFFGTQTGTAEGFAKALSEEIKARYEKASVRVIDLDDYAAD  127

Query  394  ddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNR  573
            DDQYEEKLKKE+LAFF VATYGDGEPTDNAARFYKWFTE  ER   L QLTYG+F LGNR
Sbjct  128  DDQYEEKLKKESLAFFCVATYGDGEPTDNAARFYKWFTEENERDISLPQLTYGVFALGNR  187

Query  574  QYEHFNKIGKVIDEKLSEQ  630
            QYEHFNKIG V+DE+L ++
Sbjct  188  QYEHFNKIGIVLDEELCKK  206



>gb|AFO64618.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   207 bits (528),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 137/166 (83%), Gaps = 8/166 (5%)
 Frame = +1

Query  142  LLVFIWKRSGD---RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFA  312
            ++V +W+RS     R+ E   +VVPK +T D      VD G+ KVTVFFGTQTGTAEGFA
Sbjct  61   VVVLVWRRSSSAAKRAAESPVIVVPKKVTEDE-----VDDGRKKVTVFFGTQTGTAEGFA  115

Query  313  KALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARF  492
            KAL EE +ARYEKAV KV+D+DDYAA+DD+YEEKLKKE+LAFF +ATYGDGEPTDNAARF
Sbjct  116  KALVEEAKARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARF  175

Query  493  YKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            YKWFTEGEE+  WL++L Y +FGLGNRQYEHFNKI KV+DEKL+EQ
Sbjct  176  YKWFTEGEEKGEWLEKLQYAVFGLGNRQYEHFNKIAKVVDEKLTEQ  221



>gb|AGO03795.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=483

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 136/164 (83%), Gaps = 6/164 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPV-VVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++V +W+RS    K   PV VVPK +T   EE+  VD G+ KVTVFFGTQTGTAEGFAKA
Sbjct  46   VVVLVWRRSSSSKKVEAPVIVVPKRVT---EEE--VDDGRKKVTVFFGTQTGTAEGFAKA  100

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE +ARYEKAV KV+D+DDYAA+DD+YEEKLKKE+LAFF +AT G GEPTDNAARFYK
Sbjct  101  LVEEAKARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATXGXGEPTDNAARFYK  160

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEGEER  WL++L YG+FGLGNRQYEHFNKI KV+D+KL EQ
Sbjct  161  WFTEGEERGEWLEKLQYGVFGLGNRQYEHFNKIAKVVDDKLVEQ  204



>gb|ABL09938.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 136/166 (82%), Gaps = 8/166 (5%)
 Frame = +1

Query  142  LLVFIWKRSGDRSK---EVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFA  312
            ++V +W+RS   +K   E   +VVPK +T D      VD G+ KVTVFFGTQTGTAEGFA
Sbjct  61   VVVLVWRRSSSAAKKAAESPVIVVPKKVTEDE-----VDDGRKKVTVFFGTQTGTAEGFA  115

Query  313  KALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARF  492
            KAL EE +ARYEKAV KV+D+DDYAA+DD+YEEKLKKE+LAFF +ATYGDGEPTDNAARF
Sbjct  116  KALVEEAKARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARF  175

Query  493  YKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            YKWFTEGEE+  WL++L Y +FGLGNRQYEHFNKI KV+DEKL EQ
Sbjct  176  YKWFTEGEEKGEWLEKLQYAVFGLGNRQYEHFNKIAKVVDEKLVEQ  221



>gb|ABM88789.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   205 bits (522),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 135/166 (81%), Gaps = 8/166 (5%)
 Frame = +1

Query  142  LLVFIWKRSGDRSK---EVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFA  312
            ++V +W+RS   +K   E   +VVPK +T D      VD G+ KVTVFFGTQTGTAEGFA
Sbjct  61   VVVLVWRRSSSAAKKAAESPVIVVPKKVTEDE-----VDDGRKKVTVFFGTQTGTAEGFA  115

Query  313  KALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARF  492
            KAL EE +ARYEKAV KV+D+DDYAA+DD+YEEKLKKE+LAFF +ATYGDGEPTDNAARF
Sbjct  116  KALVEEAKARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARF  175

Query  493  YKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            YKWFTEGEE+  WL +L Y +FGLGNRQYEHFNKI KV+DEKL EQ
Sbjct  176  YKWFTEGEEKGEWLDKLQYAVFGLGNRQYEHFNKIAKVVDEKLVEQ  221



>gb|ABI98819.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   205 bits (522),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 135/166 (81%), Gaps = 8/166 (5%)
 Frame = +1

Query  142  LLVFIWKRSGDRSK---EVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFA  312
            ++V +W+RS   +K   E   +VVPK +T D      VD G+ KVTVFFGTQTGTAEGFA
Sbjct  61   VVVLVWRRSSSAAKKAAESPVIVVPKKVTEDE-----VDDGRKKVTVFFGTQTGTAEGFA  115

Query  313  KALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARF  492
            KAL EE +ARYEKAV KV+D+DDYAA+DD+YEEKLKKE+LAFF +ATYGDGEPTDNAARF
Sbjct  116  KALVEEAKARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARF  175

Query  493  YKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            YKWFTEGEE+  WL +L Y +FGLGNRQYEHFNKI KV+DEKL EQ
Sbjct  176  YKWFTEGEEKGEWLDKLQYAVFGLGNRQYEHFNKIAKVVDEKLVEQ  221



>gb|ABC47946.1| cytochrome P450 reductase [Artemisia annua]
 gb|AEQ63685.1| cytochrome P450 reductase [synthetic construct]
Length=704

 Score =   205 bits (521),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 135/166 (81%), Gaps = 8/166 (5%)
 Frame = +1

Query  142  LLVFIWKRSGDRSK---EVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFA  312
            ++V +W+RS   +K   E   +VVPK +T D      VD G+ KVTVFFGTQTGTAEGFA
Sbjct  61   VVVLVWRRSSSAAKKAAESPVIVVPKKVTEDE-----VDDGRKKVTVFFGTQTGTAEGFA  115

Query  313  KALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARF  492
            KAL EE +ARYEKAV KV+D+DDYAA+DD+YEEKLKKE+LAFF +ATYGDGEPTDNAARF
Sbjct  116  KALVEEAKARYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARF  175

Query  493  YKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            YKWFTEGEE+  WL +L Y +FGLGNRQYEHFNKI KV+DEKL EQ
Sbjct  176  YKWFTEGEEKGEWLDKLQYAVFGLGNRQYEHFNKIAKVVDEKLVEQ  221



>gb|AHM95445.1| cytochrome P450 reductase [Matricaria chamomilla var. recutita]
Length=701

 Score =   202 bits (515),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 131/163 (80%), Gaps = 4/163 (2%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++V  W+RS    K   PV+V     A+ E    VD G+ KVTVFFGTQTGTAEGFAKAL
Sbjct  60   VVVLAWRRSSSSKKAEAPVIVVPKRVAEEE----VDDGRKKVTVFFGTQTGTAEGFAKAL  115

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
             EE + RYEKAV KV+D+DDYAA+DD+YEEKLKKE+LAFF +ATYGDGEPTDNAARFYKW
Sbjct  116  VEEAKVRYEKAVFKVIDLDDYAAEDDEYEEKLKKESLAFFFLATYGDGEPTDNAARFYKW  175

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEGEE+  WL +L YG+FGLGNRQYEHFNKI KV+D+KL EQ
Sbjct  176  FTEGEEKGEWLDKLQYGVFGLGNRQYEHFNKIAKVVDDKLVEQ  218



>gb|AIL29328.1| cytochrome P450 reductase [Pinus contorta]
Length=718

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 144/201 (72%), Gaps = 19/201 (9%)
 Frame = +1

Query  31   MESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  210
            +   S+L+  L ++L V +G                 +L F+W+R G  S   KP   P 
Sbjct  49   LRENSQLLMVLTTSLAVLIGC----------------VLFFVWRRGG--SAPSKPPEKPT  90

Query  211  AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaa  390
             +  + EE+   D GK KVTVFFGTQTGTAEGFAK+LAEE +ARY+KAV KVVD+DDYAA
Sbjct  91   PLVKEEEEEEEDDSGKKKVTVFFGTQTGTAEGFAKSLAEEAKARYDKAVFKVVDLDDYAA  150

Query  391  dddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGE-ERSPWLQQLTYGIFGLG  567
            DD+ YEEKLKKE LAFFM+ATYGDGEPTDNAARFYKWFTEGE ER PWL  LTYG+FGLG
Sbjct  151  DDELYEEKLKKEKLAFFMLATYGDGEPTDNAARFYKWFTEGEKERGPWLSNLTYGVFGLG  210

Query  568  NRQYEHFNKIGKVIDEKLSEQ  630
            NRQYEHFNK+   +D+ LSEQ
Sbjct  211  NRQYEHFNKVACTVDDALSEQ  231



>ref|XP_007227446.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
 gb|EMJ28645.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
Length=710

 Score =   200 bits (508),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 132/167 (79%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVV----PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++V IW+RS   S   KP V+    P  +T++PE    VD G  KVT+FFGTQTGTAEGF
Sbjct  63   VVVLIWRRS---SAPPKPRVIQPPAPVIVTSEPE----VDDGTKKVTIFFGTQTGTAEGF  115

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALAEE +ARYEK   KVVD+DDYAADD+ YEEKLKKE+LAFF +ATYGDGEPTDNAAR
Sbjct  116  AKALAEEGKARYEKVTFKVVDLDDYAADDEAYEEKLKKESLAFFFLATYGDGEPTDNAAR  175

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTEG ER  WLQ L YG+FGLGNRQYEHFNK+  V+D+ L+EQ
Sbjct  176  FYKWFTEGNERGEWLQTLHYGVFGLGNRQYEHFNKVAVVVDDVLTEQ  222



>ref|XP_008223694.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Prunus mume]
Length=710

 Score =   199 bits (507),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 132/167 (79%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVV----PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++V IW+RS   S   KP V+    P  +T +PE    VD G  KVT+FFGTQTGTAEGF
Sbjct  63   VVVLIWRRS---SAPQKPRVIQPPAPVIVTPEPE----VDDGTKKVTIFFGTQTGTAEGF  115

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALAEE +ARYEK   KVVD+DDYAADD+ YEEKLKKE+LAFF +ATYGDGEPTDNAAR
Sbjct  116  AKALAEEGKARYEKVTFKVVDLDDYAADDEAYEEKLKKESLAFFFLATYGDGEPTDNAAR  175

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTEG ER  WLQ+L YG+FGLGNRQYEHFNK+  V+D+ L+EQ
Sbjct  176  FYKWFTEGNERGEWLQKLHYGVFGLGNRQYEHFNKVAVVVDDVLTEQ  222



>gb|AAC05021.1| NADPH:ferrihemoprotein oxidoreductase [Papaver somniferum]
 gb|AHF27398.1| NADPH:ferrihemoprotein oxidoreductase [synthetic construct]
Length=683

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 155/201 (77%), Gaps = 6/201 (3%)
 Frame = +1

Query  40   TSELVRSLESALGVSLGNDtvvvllttslavivGLLV----FIWKRSGDRSKEVKPVVVP  207
            ++ L  S+ES LG+S+G++ +   +   +  +  +L+    F   +S   S + KP+   
Sbjct  3    SNNLANSIESMLGISIGSEYISDPIFIMVTTVASMLIGFGFFACMKSS--SSQSKPIETY  60

Query  208  KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddya  387
            K +    EE+  VDPGK+K+T+FFGTQTGTAEGFAKALAEEI+A+Y+KAVVKVVD+DDYA
Sbjct  61   KPIIDKEEEEIEVDPGKIKLTIFFGTQTGTAEGFAKALAEEIKAKYKKAVVKVVDLDDYA  120

Query  388  adddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLG  567
            A+DDQYEEKLKKE+L FFMVATYGDGEPTDNAARFYKWFT+  ER  WLQQLTYG+FGLG
Sbjct  121  AEDDQYEEKLKKESLVFFMVATYGDGEPTDNAARFYKWFTQEHERGEWLQQLTYGVFGLG  180

Query  568  NRQYEHFNKIGKVIDEKLSEQ  630
            NRQYEHFNKI   +DE+L +Q
Sbjct  181  NRQYEHFNKIAVDVDEQLGKQ  201



>gb|KJB22135.1| hypothetical protein B456_004G0316001, partial [Gossypium raimondii]
 gb|KJB22136.1| hypothetical protein B456_004G0316001, partial [Gossypium raimondii]
 gb|KJB22137.1| hypothetical protein B456_004G0316001, partial [Gossypium raimondii]
Length=312

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 131/158 (83%), Gaps = 3/158 (2%)
 Frame = +1

Query  157  WKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIR  336
            W+RSG  S++ K +  PK +     E+ V D GK KVT+FFGTQTGTAEGFAKAL EE +
Sbjct  70   WRRSG--SQKPKQITPPKPLIVKDRENEV-DDGKKKVTIFFGTQTGTAEGFAKALVEEAK  126

Query  337  ARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGE  516
            ARY+KA  KVVD+DDYAADDD+YEEK+KKE+LAFF +ATYGDGEPTDNAARFYKWFTEG+
Sbjct  127  ARYDKATFKVVDLDDYAADDDEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKWFTEGK  186

Query  517  ERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            ER  WLQ + YG+FGLGNRQYEHFNK+ KV+DE L+EQ
Sbjct  187  ERGEWLQNMKYGVFGLGNRQYEHFNKVAKVVDEILTEQ  224



>gb|AIC73829.1| cytochrome P450 reductase [Panax ginseng]
Length=678

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 158/196 (81%), Gaps = 10/196 (5%)
 Frame = +1

Query  58   SLESALGVSLGNDtvvvllttslavivGLLVFI-WKRSGDR--SKEVKP--VVVPKAMTA  222
            ++ ++L + + N  +++LLTTS+A+++G +VF+ W+RS  +  +K ++P  +V+PK    
Sbjct  3    AMPTSLAMLVENQELLMLLTTSVAILIGCVVFLLWRRSSSQRSAKSLEPPKLVIPKI---  59

Query  223  DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQ  402
            +PEE+  VD GK KVT+FFGTQTGTAEGFAKA +EE RARYEKA  KV+D+DDYA DDD+
Sbjct  60   EPEEE--VDDGKKKVTIFFGTQTGTAEGFAKAFSEEARARYEKAKFKVIDLDDYAGDDDE  117

Query  403  YEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYE  582
            YE KLKKE+LAFF +ATYGDGEPTDNAARFYKWF+EG+E   WL  L YG+FGLGNRQYE
Sbjct  118  YESKLKKESLAFFFLATYGDGEPTDNAARFYKWFSEGKENREWLSNLQYGVFGLGNRQYE  177

Query  583  HFNKIGKVIDEKLSEQ  630
            HFNKI KV+D+ L+EQ
Sbjct  178  HFNKIAKVVDDGLAEQ  193



>ref|XP_010688489.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=705

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 128/164 (78%), Gaps = 5/164 (3%)
 Frame = +1

Query  145  LVFIWKRS--GDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
             +FIWK+S  G  SK V  +  P  +  D   D  VD GK KVTVFFGTQTGTAEGFAKA
Sbjct  60   FLFIWKKSNGGKSSKVVSELPKPLILKDD---DVEVDDGKKKVTVFFGTQTGTAEGFAKA  116

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE +ARYEKA  K+VD+DDYA DDD+YE KLKKE LAFF +ATYGDGEPTDNAARFYK
Sbjct  117  LVEEAKARYEKATFKIVDLDDYAGDDDEYERKLKKENLAFFFLATYGDGEPTDNAARFYK  176

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WF EG++R  WLQ L YG+FGLGNRQYEHFNK+GK IDE L+EQ
Sbjct  177  WFLEGKDRGEWLQNLEYGVFGLGNRQYEHFNKVGKEIDELLAEQ  220



>ref|XP_009382841.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   197 bits (501),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
             +F W RS    K   PV  PK +T +   +   D GK KVTVFFGTQTGTAEGFAKALA
Sbjct  46   FIFFW-RSSLGGKASSPVQPPKPLTVNVVREVEADDGKRKVTVFFGTQTGTAEGFAKALA  104

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            +E +ARY+KAV KVVD+D+YAADDD+YEEK+KKETLA F +ATYGDGEPTDNAARFYKWF
Sbjct  105  DEAKARYDKAVFKVVDLDEYAADDDEYEEKMKKETLALFFLATYGDGEPTDNAARFYKWF  164

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            TEG ER  WL+ L Y IFGLGNRQYEHFNK+ KV+DE L++Q
Sbjct  165  TEGNERGNWLETLQYSIFGLGNRQYEHFNKVAKVVDETLADQ  206



>gb|ACN54324.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=710

 Score =   197 bits (501),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 131/163 (80%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +++ IW+RS   S++ K + +P   +   E +  VD GK KVT+ FGTQTGTAEGFAKAL
Sbjct  64   VVILIWRRSA--SQKPKQIQLPLKPSIIKEPELEVDDGKKKVTILFGTQTGTAEGFAKAL  121

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
             EE +ARYEKA   +VD+DDYAADD++YEEK+KK+ LAFF +ATYGDGEPTDNAARFYKW
Sbjct  122  VEEAKARYEKATFNIVDLDDYAADDEEYEEKMKKDNLAFFFLATYGDGEPTDNAARFYKW  181

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+ER  WLQ + YGIFGLGN+QYEHFNK+ KV+DE L+EQ
Sbjct  182  FTEGKERGEWLQNMKYGIFGLGNKQYEHFNKVAKVVDELLTEQ  224



>ref|XP_010548619.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Tarenaya 
hassleriana]
Length=714

 Score =   195 bits (496),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 134/164 (82%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSG-DRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++V +W+RSG ++ K V+P   PK +     E+ V D G+ KVT+FFGTQTGTAEGFAKA
Sbjct  69   VIVLVWRRSGGNKPKLVEP---PKPLVIKRREEEV-DDGRKKVTIFFGTQTGTAEGFAKA  124

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            LAEE RARYEKA  K+VD++DYAADDD+Y EKLKKE LAFF +ATYGDGEPTDNAARFYK
Sbjct  125  LAEEARARYEKARFKIVDLEDYAADDDEYAEKLKKEKLAFFFLATYGDGEPTDNAARFYK  184

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG+++   L+ + YG+FGLGNRQYEHFNKI KV+DE L+EQ
Sbjct  185  WFTEGDDKGELLKDMKYGVFGLGNRQYEHFNKIAKVVDEMLAEQ  228



>ref|XP_010093854.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB54742.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=715

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 138/167 (83%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKE----VKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
             +V +W+RSG +  +    +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  69   FVVLMWRRSGSQKPKAVELLKPLVV-----KEPEIE--VDDGKKKVTIFFGTQTGTAEGF  121

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E +ARYEKAV KVVD+DDYAADDD+YEEKLKKE+LAFF +ATYGDGEPTDNAAR
Sbjct  122  AKALADEAKARYEKAVFKVVDLDDYAADDDEYEEKLKKESLAFFFLATYGDGEPTDNAAR  181

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWF+EG+ER  WLQ L YG+FGLGNRQYEHFNK+ KV+D+ L+EQ
Sbjct  182  FYKWFSEGKERGEWLQNLQYGVFGLGNRQYEHFNKVAKVVDDNLTEQ  228



>ref|XP_004146317.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Cucumis sativus]
 gb|AIT72028.1| cytochrome P450 reductase [Cucumis sativus]
 gb|KGN65457.1| hypothetical protein Csa_1G423150 [Cucumis sativus]
Length=708

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 143/196 (73%), Gaps = 21/196 (11%)
 Frame = +1

Query  46   ELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTA-  222
            ELV  L +++ V +G                  +V +W+RSG+R  +VK + +PK +   
Sbjct  46   ELVAILTTSIAVMIG----------------CFVVLVWRRSGNR--KVKTIELPKPLLGK  87

Query  223  DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQ  402
            +PE +  VD GK KVT+FFGTQTGTAEGFAKAL++E +ARY+KA  +VVD+DDY AD+D+
Sbjct  88   EPEPE--VDDGKKKVTIFFGTQTGTAEGFAKALSDEAKARYDKAKFRVVDLDDYGADEDE  145

Query  403  YEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYE  582
            YE+KLKKE++A F +ATYGDGEPTDNAARFYKWFTEG+ER   LQ L Y +FGLGNRQYE
Sbjct  146  YEQKLKKESVAVFFLATYGDGEPTDNAARFYKWFTEGKERGECLQNLNYAVFGLGNRQYE  205

Query  583  HFNKIGKVIDEKLSEQ  630
            HFNKI KV+DE L  Q
Sbjct  206  HFNKIAKVVDELLETQ  221



>ref|XP_008453604.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Cucumis melo]
Length=708

 Score =   194 bits (493),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 145/196 (74%), Gaps = 21/196 (11%)
 Frame = +1

Query  46   ELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTA-  222
            ELV  L +++ V +G                  +V +W+RSG+R  +VK + +PK + A 
Sbjct  46   ELVAILTTSIAVMIG----------------CFVVLVWRRSGNR--KVKTIELPKPLLAK  87

Query  223  DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQ  402
            +PE +  VD GK KVT+FFGTQTGTAEGFAKAL++E +ARY+KA  +VVD+DDY  DDD+
Sbjct  88   EPEPE--VDDGKKKVTIFFGTQTGTAEGFAKALSDEAKARYDKAKFRVVDLDDYGGDDDE  145

Query  403  YEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYE  582
            YE++LKKE++A F +ATYGDGEPTDNAARFYKWFTEG+ER  WLQ L+Y +FGLGNRQYE
Sbjct  146  YEQQLKKESVAVFFLATYGDGEPTDNAARFYKWFTEGKERGEWLQNLSYAVFGLGNRQYE  205

Query  583  HFNKIGKVIDEKLSEQ  630
            HFNKI KV+DE L  Q
Sbjct  206  HFNKIAKVVDELLETQ  221



>dbj|BAJ33878.1| unnamed protein product [Thellungiella halophila]
Length=711

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGD-RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +++ +W+RSG   SK V+P+   K +   P ED V D G+ KVT+FFGTQTGTAEGFAKA
Sbjct  69   IVMLVWRRSGTGNSKRVEPL---KPLVIKPREDDV-DDGRKKVTIFFGTQTGTAEGFAKA  124

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE RARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFYK
Sbjct  125  LGEEARARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYK  184

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG +R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  185  WFTEGNDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  228



>ref|XP_006412733.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
 gb|ESQ54186.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
Length=711

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGD-RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +++ +W+RSG   SK V+P+   K +   P ED V D G+ KVT+FFGTQTGTAEGFAKA
Sbjct  69   IVMLVWRRSGTGNSKRVEPL---KPLVIKPREDDV-DDGRKKVTIFFGTQTGTAEGFAKA  124

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE RARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFYK
Sbjct  125  LGEEARARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYK  184

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG +R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  185  WFTEGNDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  228



>emb|CAA89837.3| NADPH-cytochrome P450 reductase [Pseudotsuga menziesii]
Length=719

 Score =   194 bits (492),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 132/166 (80%), Gaps = 6/166 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEV--KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +L+F+W+R G    ++  KP  + +    + EED   D GK KVTVFFGTQTGTAEGFAK
Sbjct  70   VLLFVWRRGGSAPSKLPEKPTPLGRVEEEEEEED---DSGKKKVTVFFGTQTGTAEGFAK  126

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            AL EE +ARY+KAV KVVD+DDYAADD+QYEEKLKKE LAFFM+ATYGDGEPTDNAARFY
Sbjct  127  ALVEEAKARYDKAVFKVVDLDDYAADDEQYEEKLKKEKLAFFMLATYGDGEPTDNAARFY  186

Query  496  KWFTEGE-ERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWF+E E ER PWL  L YG+FGLGNRQYEHFNK+   +DE L+EQ
Sbjct  187  KWFSETEKERGPWLSNLPYGVFGLGNRQYEHFNKVACTVDEALNEQ  232



>ref|XP_010929254.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=704

 Score =   193 bits (491),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 129/158 (82%), Gaps = 1/158 (1%)
 Frame = +1

Query  157  WKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIR  336
            W+RSG + KE   V  P+ +    E    VD G+ KVTVFFGTQTGTAEGFAK+L EE R
Sbjct  60   WRRSGGK-KETPAVEPPRPLAVRDEPGHEVDDGRKKVTVFFGTQTGTAEGFAKSLTEEAR  118

Query  337  ARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGE  516
            ARYEKAV KVVD+DDYAADDD+YEEK+KKETLA F +ATYGDGEPTDNAARFYKWFTEG+
Sbjct  119  ARYEKAVFKVVDLDDYAADDDEYEEKMKKETLALFFLATYGDGEPTDNAARFYKWFTEGK  178

Query  517  ERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            ER  WLQ L Y +FGLGNRQYEHFNK+GKV+DE L+EQ
Sbjct  179  ERGVWLQNLQYAVFGLGNRQYEHFNKVGKVVDEILAEQ  216



>ref|XP_004168990.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like, partial [Cucumis 
sativus]
Length=209

 Score =   182 bits (461),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 135/184 (73%), Gaps = 21/184 (11%)
 Frame = +1

Query  46   ELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTA-  222
            ELV  L +++ V +G                  +V +W+RSG+R  +VK + +PK +   
Sbjct  46   ELVAILTTSIAVMIG----------------CFVVLVWRRSGNR--KVKTIELPKPLLGK  87

Query  223  DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQ  402
            +PE +  VD GK KVT+FFGTQTGTAEGFAKAL++E +ARY+KA  +VVD+DDY AD+D+
Sbjct  88   EPEPE--VDDGKKKVTIFFGTQTGTAEGFAKALSDEAKARYDKAKFRVVDLDDYGADEDE  145

Query  403  YEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYE  582
            YE+KLKKE++A F +ATYGDGEPTDNAARFYKWFTEG+ER   LQ L Y +FGLGNRQYE
Sbjct  146  YEQKLKKESVAVFFLATYGDGEPTDNAARFYKWFTEGKERGECLQNLNYAVFGLGNRQYE  205

Query  583  HFNK  594
            HFNK
Sbjct  206  HFNK  209



>emb|CDY51656.1| BnaAnng10960D [Brassica napus]
Length=706

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/166 (67%), Positives = 132/166 (80%), Gaps = 9/166 (5%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEV---KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFA  312
            +++ +W+RSG   K V   KP+V+       P ED V D G+ KVT+FFGTQTGTAEGFA
Sbjct  64   IVMLLWRRSGGSPKRVETLKPLVI-----KPPSEDEV-DDGRKKVTIFFGTQTGTAEGFA  117

Query  313  KALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARF  492
            KAL EE RARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARF
Sbjct  118  KALGEEARARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARF  177

Query  493  YKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            YKWFTEG++R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  178  YKWFTEGDDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  223



>ref|XP_009408053.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=705

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 126/162 (78%), Gaps = 3/162 (2%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
            L+F  +RSG + K V+P   PK +       A  D GK KV+VFFGTQTGTAEGFAKAL 
Sbjct  59   LIFFLRRSGGKKKLVEP---PKPLAVRVLPAAEADDGKKKVSVFFGTQTGTAEGFAKALV  115

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            +E  ARY  A  KVVD+D+YAADDD+YEEK+KKETLA F VATYGDGEPTDNAARFYKWF
Sbjct  116  DEATARYNNASFKVVDLDEYAADDDEYEEKMKKETLALFFVATYGDGEPTDNAARFYKWF  175

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            TEG+ER  WL+ L + +FGLGNRQYEHFNK+ KV+DE LS+Q
Sbjct  176  TEGKERGLWLKDLQFAVFGLGNRQYEHFNKVAKVVDEMLSDQ  217



>ref|XP_008776011.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Phoenix dactylifera]
Length=484

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 132/165 (80%), Gaps = 7/165 (4%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVV---VPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            L+ +W+RSG   K+  P +    P A+  +P+ +  +D G+ KV VFFGTQTGTAEGFAK
Sbjct  53   LLLLWRRSG--GKKAAPAIEPPRPPAVGEEPQHE--IDDGRKKVAVFFGTQTGTAEGFAK  108

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            +L EE RARYEKAV KVVD+DDYAADDD+YEEK+KKETLA F +ATYGDGEPTDNAARFY
Sbjct  109  SLTEEARARYEKAVFKVVDLDDYAADDDEYEEKIKKETLALFFLATYGDGEPTDNAARFY  168

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWFTEG+ER  WLQ L Y +FGLGNRQYEHFNK+ K +DE L+EQ
Sbjct  169  KWFTEGKERGVWLQNLQYAVFGLGNRQYEHFNKVAKAVDENLAEQ  213



>ref|XP_002869386.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45645.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
Length=711

 Score =   191 bits (485),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGD-RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +++ +W+RSG   SK V+P+   K +   P E+ + D GK KVT+FFGTQTGTAEGFAKA
Sbjct  67   IVMLVWRRSGSGNSKRVEPL---KPLVIKPREEEI-DDGKKKVTIFFGTQTGTAEGFAKA  122

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE +ARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFYK
Sbjct  123  LGEEAKARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYK  182

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG +R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  183  WFTEGNDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  226



>ref|XP_009108997.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Brassica rapa]
Length=707

 Score =   191 bits (484),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 128/163 (79%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +++ +W+RS  R+   KP    K +   P  +  VD G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  64   IVLLVWRRSSARNS--KPAEPLKPLVIKPPREDEVDDGRKKVTIFFGTQTGTAEGFAKAL  121

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
             EE RARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFYKW
Sbjct  122  GEEARARYEKTKFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYKW  181

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG +R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  182  FTEGSDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  224



>emb|CDX72222.1| BnaC07g42440D [Brassica napus]
Length=708

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 133/168 (79%), Gaps = 11/168 (7%)
 Frame = +1

Query  142  LLVFIWKRSG-----DRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEG  306
            +++ +W+RSG      R + +KP+V+       P ED V D G+ KVT+FFGTQTGTAEG
Sbjct  64   IVMLLWRRSGGSGSSKRVETLKPLVI-----KPPREDEV-DDGRKKVTIFFGTQTGTAEG  117

Query  307  FAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAA  486
            FAKAL EE RARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAA
Sbjct  118  FAKALGEEARARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAA  177

Query  487  RFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            RFYKWFTEG++R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  178  RFYKWFTEGDDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  225



>ref|XP_010259920.1| PREDICTED: NADPH--cytochrome P450 reductase [Nelumbo nucifera]
Length=705

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 135/164 (82%), Gaps = 4/164 (2%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPK-AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +++F+W+RS  + K  K V VPK  +  +PE +   D GK KVTVFFGTQTGTAEGFAKA
Sbjct  57   VVLFVWRRSTGQ-KASKVVEVPKPVIVKEPEPE--FDDGKKKVTVFFGTQTGTAEGFAKA  113

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE + RYEKA  KV+D+DDYAADDD+YEEK++KETLAFF +ATYGDGEPTDNAARFYK
Sbjct  114  LVEEAKVRYEKATFKVIDLDDYAADDDEYEEKMRKETLAFFFLATYGDGEPTDNAARFYK  173

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG+ER  WL+ L +G+FGLGNRQYEHFNK+ KV+D+ LSEQ
Sbjct  174  WFTEGKERGTWLENLKFGVFGLGNRQYEHFNKVAKVVDKLLSEQ  217



>ref|NP_849472.2| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 gb|AEE85737.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=712

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGD-RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +++ +W+RSG   SK V+P+   K +   P E+ + D G+ KVT+FFGTQTGTAEGFAKA
Sbjct  67   IVMLVWRRSGSGNSKRVEPL---KPLVIKPREEEI-DDGRKKVTIFFGTQTGTAEGFAKA  122

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE +ARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFYK
Sbjct  123  LGEEAKARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYK  182

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG +R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  183  WFTEGNDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  226



>ref|NP_194750.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 sp|Q9SUM3.1|NCPR2_ARATH RecName: Full=NADPH--cytochrome P450 reductase 2 [Arabidopsis 
thaliana]
 gb|AAK17169.1|AF325101_1 NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB52465.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB81014.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 gb|AEE85738.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=711

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGD-RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +++ +W+RSG   SK V+P+   K +   P E+ + D G+ KVT+FFGTQTGTAEGFAKA
Sbjct  67   IVMLVWRRSGSGNSKRVEPL---KPLVIKPREEEI-DDGRKKVTIFFGTQTGTAEGFAKA  122

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE +ARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFYK
Sbjct  123  LGEEAKARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYK  182

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG +R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  183  WFTEGNDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  226



>emb|CAA46815.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=712

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGD-RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +++ +W+RSG   SK V+P+   K +   P E+ + D G+ KVT+FFGTQTGTAEGFAKA
Sbjct  67   IVMLVWRRSGSGNSKRVEPL---KPLVIKPREEEI-DDGRKKVTIFFGTQTGTAEGFAKA  122

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE +ARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFYK
Sbjct  123  LGEEAKARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYK  182

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG +R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  183  WFTEGNDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  226



>ref|XP_009385909.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   189 bits (481),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 127/162 (78%), Gaps = 4/162 (2%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
            L+F ++RS  +    KP   PK +      +  VD GK KVTVFFGTQTGTAEGFAKAL 
Sbjct  59   LIFFFRRSSGK----KPAEPPKPLVVRVLPELEVDDGKKKVTVFFGTQTGTAEGFAKALT  114

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            +E +ARY+ A+ KVVD+D+YAADDD+YEEK+KKETLA F +ATYGDGEPTDNAARFYKWF
Sbjct  115  DEAKARYQNAIFKVVDLDEYAADDDEYEEKMKKETLAVFFLATYGDGEPTDNAARFYKWF  174

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            TEG+ER  WL  L + +FGLGNRQYEHFNK+ KV+DE L+EQ
Sbjct  175  TEGKERGNWLDNLQFAVFGLGNRQYEHFNKVAKVVDEMLAEQ  216



>ref|XP_010914150.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=701

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 129/158 (82%), Gaps = 1/158 (1%)
 Frame = +1

Query  157  WKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIR  336
            W+RSG + K    V  P+ +    E +  +D G+ KVTVFFGTQTGTAEGFAKALAEE R
Sbjct  57   WRRSGGK-KATLVVEPPRPLEFREETENELDSGRKKVTVFFGTQTGTAEGFAKALAEEAR  115

Query  337  ARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGE  516
            ARYEKA+ KVVD+DDYAADDD+YEEK+K ETLA F +ATYGDGEPTDNAARFYKWFTEG+
Sbjct  116  ARYEKAIFKVVDLDDYAADDDEYEEKMKNETLALFFLATYGDGEPTDNAARFYKWFTEGK  175

Query  517  ERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            ER  WLQ L Y +FGLGNRQYEHFNK+GKV+DE L+EQ
Sbjct  176  ERGVWLQNLQYAVFGLGNRQYEHFNKVGKVVDEALAEQ  213



>ref|XP_009414761.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=700

 Score =   189 bits (480),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 126/162 (78%), Gaps = 4/162 (2%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
             +F ++RS  +    KP  +PK +    + +A VD GK KVTVFFGTQTGTAEGFAKALA
Sbjct  55   FMFFFRRSLGK----KPPSLPKPLVVKVQPEAEVDDGKKKVTVFFGTQTGTAEGFAKALA  110

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            +E ++RY     KVVD+D YAADDD+YEEK+KKETLA F +ATYGDGEPTDNAARF+KWF
Sbjct  111  DEAKSRYHNTAFKVVDLDQYAADDDEYEEKMKKETLALFFMATYGDGEPTDNAARFFKWF  170

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            TEG+ER  WL+ L + +FGLGNRQYEHFNK+ KV+DE L+ Q
Sbjct  171  TEGKERENWLENLQFSVFGLGNRQYEHFNKVAKVVDEMLANQ  212



>ref|XP_002534464.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF27920.1| cytochrome P450, putative, partial [Ricinus communis]
Length=694

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 135/169 (80%), Gaps = 13/169 (8%)
 Frame = +1

Query  142  LLVFIWKRSGD-RSKEV-----KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAE  303
            ++V +W+RSG  +SK V     KP+VV      +PE +   D G+ +VT+FFGTQTGTAE
Sbjct  67   VVVLVWRRSGSQKSKSVAIEPLKPLVV-----KEPEPEP--DDGQKRVTIFFGTQTGTAE  119

Query  304  GFAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNA  483
            GFAKAL+EE +ARYEKA  KVVD+DDYAADDD+YE KLKKE+LA F VATYGDGEPTDNA
Sbjct  120  GFAKALSEEAKARYEKATFKVVDLDDYAADDDEYETKLKKESLALFFVATYGDGEPTDNA  179

Query  484  ARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            ARFYKWFTEG+ER  WLQ L +G+FGLGN+QYEHFNKI KV+DE L EQ
Sbjct  180  ARFYKWFTEGKERGEWLQDLKFGVFGLGNKQYEHFNKIAKVLDELLEEQ  228



>ref|XP_008789667.1| PREDICTED: NADPH--cytochrome P450 reductase [Phoenix dactylifera]
Length=706

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
            +V +W+RS  + K  +PV  P+ +   P+ +  +D GK KVT+FFGTQTGTAEGFAKALA
Sbjct  58   IVLVWRRSAGK-KVSRPVEPPRPLVVKPDREPDMDDGKKKVTIFFGTQTGTAEGFAKALA  116

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            EE + RY+KA  KVVD+DDYAADD+ YEEK+KKETLA F +ATYGDGEPTDNAARFYKWF
Sbjct  117  EEAKMRYDKATFKVVDLDDYAADDEDYEEKMKKETLALFFLATYGDGEPTDNAARFYKWF  176

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            TEG+ER   L+ L Y +FGLGNRQYEHFNK+ KV+DE L++Q
Sbjct  177  TEGKERGNRLENLQYAVFGLGNRQYEHFNKVAKVVDEILADQ  218



>dbj|BAG68945.1| cytochrome P450 reductase [Lotus japonicus]
Length=706

 Score =   188 bits (478),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRS-GDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++VFIW+RS G+++K ++P   PK +     ++A VD G  KVT+FFGTQTGTAEGFAKA
Sbjct  59   VVVFIWRRSTGNKAKSIEP---PKRVVEKLSDEAEVDDGTRKVTIFFGTQTGTAEGFAKA  115

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            +AEE + RYEKA  K+VDMDDYA DDD+YEEKLKKETLA F +ATYGDGEPTDNAARFYK
Sbjct  116  IAEEAKVRYEKAKFKIVDMDDYAQDDDEYEEKLKKETLALFFLATYGDGEPTDNAARFYK  175

Query  499  WFTEGEERSP-WLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSE  627
            WF EG+E+   WL+ L Y +FGLGNRQYEHFNK+   +D+KL++
Sbjct  176  WFLEGDEKEEGWLRNLEYAVFGLGNRQYEHFNKVAIEVDDKLAD  219



>sp|Q05001.1|NCPR_CATRO RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Catharanthus roseus]
 emb|CAA49446.1| NADPH--ferrihemoprotein reductase [Catharanthus roseus]
Length=714

 Score =   187 bits (476),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 141/166 (85%), Gaps = 7/166 (4%)
 Frame = +1

Query  142  LLVFIWKRS-GDRSKEVKP--VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFA  312
            ++V IW+RS G   K V+P  ++VPK++  +PEE   +D GK K T+FFGTQTGTAEGFA
Sbjct  64   VVVLIWRRSSGSGKKVVEPPKLIVPKSVV-EPEE---IDEGKKKFTIFFGTQTGTAEGFA  119

Query  313  KALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARF  492
            KALAEE +ARYEKAV+KV+D+DDYAADD++YEEK +KETLAFF++ATYGDGEPTDNAARF
Sbjct  120  KALAEEAKARYEKAVIKVIDIDDYAADDEEYEEKFRKETLAFFILATYGDGEPTDNAARF  179

Query  493  YKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            YKWF EG +R  WL+ L YG+FGLGNRQYEHFNKI KV+DEK++EQ
Sbjct  180  YKWFVEGNDRGDWLKNLQYGVFGLGNRQYEHFNKIAKVVDEKVAEQ  225



>gb|KHG21257.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=711

 Score =   187 bits (476),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 129/158 (82%), Gaps = 3/158 (2%)
 Frame = +1

Query  157  WKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIR  336
            W+RS   S++ K +  PK +      D V D GK KVT+FFGTQTGTAEGFAKAL EE +
Sbjct  70   WRRS--FSQKPKQITPPKPLIVKDRGDEV-DDGKKKVTIFFGTQTGTAEGFAKALVEEAK  126

Query  337  ARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGE  516
            ARY+KA  KVVD+DDYAADDD+YEEK+KKE+LAFF +ATYGDGEPTDNAARFYKWFTEG+
Sbjct  127  ARYDKATFKVVDLDDYAADDDEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKWFTEGK  186

Query  517  ERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            ER  WLQ + YG+FGLGNRQYEHFNK+ KV+DE L+EQ
Sbjct  187  ERGEWLQNMKYGVFGLGNRQYEHFNKVAKVVDEILTEQ  224



>emb|CAN77401.1| hypothetical protein VITISV_027794 [Vitis vinifera]
Length=745

 Score =   186 bits (473),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDR-SKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++V IW+RSG + SK  +P   PK +    + +  VD GK KVT+FFGTQTGTAEGFAKA
Sbjct  59   VVVLIWRRSGQKQSKTPEP---PKPLIVK-DLEVEVDDGKQKVTIFFGTQTGTAEGFAKA  114

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            LAEE +ARYEKA+ KVVD+DDYA DDD+YEEKLKKETLAFF +ATYGDGEPTDNAARFYK
Sbjct  115  LAEEAKARYEKAIFKVVDLDDYAGDDDEYEEKLKKETLAFFFLATYGDGEPTDNAARFYK  174

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WF EG+ER  WLQ L YG+FGLGNRQYEHFNK+ KV+D+ ++EQ
Sbjct  175  WFAEGKERGEWLQNLKYGVFGLGNRQYEHFNKVAKVVDDIITEQ  218



>gb|AAT76449.1| NADPH:cytochrome P450 reductase [Taxus cuspidata]
Length=717

 Score =   186 bits (471),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +  F+W+R G  ++  KP V P  +  + +E+   D  K KVT+FFGTQTGTAEGFAKAL
Sbjct  69   VFFFVWRRGGSDTQ--KPAVRPTPLVKEEDEEEEDDSAKKKVTIFFGTQTGTAEGFAKAL  126

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARYEKAV KVVD+D+YAADD+QYEEKLKKE LAFFM+ATYGDGEPTDNAARFYKW
Sbjct  127  AEEAKARYEKAVFKVVDLDNYAADDEQYEEKLKKEKLAFFMLATYGDGEPTDNAARFYKW  186

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            F EG+ER PWL  LTYG+FGLGNRQYEHFNK+ K +DE L EQ
Sbjct  187  FLEGKEREPWLSDLTYGVFGLGNRQYEHFNKVAKAVDEVLIEQ  229



>gb|AHA50098.1| CYP450 reductase [Panax ginseng]
Length=709

 Score =   186 bits (471),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 131/163 (80%), Gaps = 1/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++V +W++S  + K  K    PK +    E + VVD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  61   VVVLVWRKSSSQ-KHAKSFEAPKLLIPKIEPEEVVDDGKKKVTIFFGTQTGTAEGFAKAL  119

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARYEKA+ KV+D+DDYA +DD YE KLKKE+LAFF +ATYGDGEPTDNAARFYKW
Sbjct  120  AEEAKARYEKAIFKVIDLDDYAPEDDDYETKLKKESLAFFFLATYGDGEPTDNAARFYKW  179

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+E+  WL  L YG+FGLGNRQYEHFNKI KV+D+ L+EQ
Sbjct  180  FTEGKEKREWLNNLQYGVFGLGNRQYEHFNKIAKVVDDGLAEQ  222



>ref|XP_002270732.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
Length=705

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDR-SKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++V IW+RSG + SK  +P   PK +    + +  VD GK KVT+FFGTQTGTAEGFAKA
Sbjct  59   VVVLIWRRSGQKQSKTPEP---PKPLIVK-DLEVEVDDGKQKVTIFFGTQTGTAEGFAKA  114

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            LAEE +ARYEKA+ KVVD+DDYA DDD+YEEKLKKETLAFF +ATYGDGEPTDNAARFYK
Sbjct  115  LAEEAKARYEKAIFKVVDLDDYAGDDDEYEEKLKKETLAFFFLATYGDGEPTDNAARFYK  174

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WF EG+ER  WLQ L YG+FGLGNRQYEHFNK+ KV+D+ ++EQ
Sbjct  175  WFAEGKERGEWLQNLKYGVFGLGNRQYEHFNKVAKVVDDIITEQ  218



>emb|CBI17838.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   185 bits (469),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDR-SKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++V IW+RSG + SK  +P   PK +    + +  VD GK KVT+FFGTQTGTAEGFAKA
Sbjct  14   VVVLIWRRSGQKQSKTPEP---PKPLIVK-DLEVEVDDGKQKVTIFFGTQTGTAEGFAKA  69

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            LAEE +ARYEKA+ KVVD+DDYA DDD+YEEKLKKETLAFF +ATYGDGEPTDNAARFYK
Sbjct  70   LAEEAKARYEKAIFKVVDLDDYAGDDDEYEEKLKKETLAFFFLATYGDGEPTDNAARFYK  129

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WF EG+ER  WLQ L YG+FGLGNRQYEHFNK+ KV+D+ ++EQ
Sbjct  130  WFAEGKERGEWLQNLKYGVFGLGNRQYEHFNKVAKVVDDIITEQ  173



>ref|XP_007014268.1| P450 reductase 2 [Theobroma cacao]
 gb|EOY31887.1| P450 reductase 2 [Theobroma cacao]
Length=710

 Score =   185 bits (469),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGD-RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++V +W+RSG  + K+++P   PK +    E +  VD GK KVT+FFGTQTGTAEGFAKA
Sbjct  64   VVVLVWRRSGSQKPKQIEP---PKPLIVK-EPELEVDDGKKKVTIFFGTQTGTAEGFAKA  119

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            LAEE +ARY+KA  KVVD+DDYA DDD+YEEK+K E+LAFF +ATYGDGEPTDNAARFYK
Sbjct  120  LAEEAKARYDKATFKVVDLDDYAVDDDEYEEKMKTESLAFFFLATYGDGEPTDNAARFYK  179

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG+ER  WLQ + YG+FGLGNRQYEHFNK+ KV+D+ L+EQ
Sbjct  180  WFTEGKERGEWLQNMKYGVFGLGNRQYEHFNKVAKVVDDLLTEQ  223



>ref|XP_006283224.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
 gb|EOA16122.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
Length=710

 Score =   185 bits (469),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 129/164 (79%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGD-RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +++ + +RSG   SK V+P+   K +   P  D  +D G+ KVT+FFGTQTGTAEGFAKA
Sbjct  66   IVMLVLRRSGSGDSKRVEPL---KPLVLKPR-DEEIDDGRKKVTIFFGTQTGTAEGFAKA  121

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE +ARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFYK
Sbjct  122  LGEEAKARYEKIRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYK  181

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG ER  WL  L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  182  WFTEGNERGEWLNNLKYGVFGLGNRQYEHFNKVAKVVDDLLVEQ  225



>gb|ACF35282.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=681

 Score =   184 bits (468),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  229  EEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYE  408
            EE++ VD GK KVT+FFGTQTGTAEGFAKALAEE R RY+   VKV+D+DDYA DD++Y 
Sbjct  81   EEESEVDDGKKKVTIFFGTQTGTAEGFAKALAEEARTRYQNTSVKVIDLDDYAIDDEEYG  140

Query  409  EKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHF  588
            +KL KETL FF +ATYGDGEPTDNAARFYKWF EGEER  WL+ L YG+FGLGNRQYEHF
Sbjct  141  KKLSKETLVFFFLATYGDGEPTDNAARFYKWFKEGEERRDWLKSLQYGVFGLGNRQYEHF  200

Query  589  NKIGKVIDEKLSEQ  630
            NKI KV+D+ +S+Q
Sbjct  201  NKIAKVMDQLISDQ  214



>emb|CDY03543.1| BnaC03g68020D [Brassica napus]
Length=710

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = +1

Query  142  LLVFIWKRS-GDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +++ +W+RS    SK  +P+   K +   P  +  VD G+ KVT+FFGTQTGTAEGFAKA
Sbjct  67   IVLLVWRRSSAGNSKPGEPL---KPLVIKPPREDEVDDGRKKVTIFFGTQTGTAEGFAKA  123

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L EE RARYEK   K+VD+DDYAADDD+YEEKLK+E +AFF +ATYGDGEPTDNAARFYK
Sbjct  124  LGEEARARYEKTRFKIVDLDDYAADDDEYEEKLKQEDVAFFFLATYGDGEPTDNAARFYK  183

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG +R  WL+ L YG+FGLGNRQYEHFNK+ KV+D  L EQ
Sbjct  184  WFTEGSDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDGILVEQ  227



>ref|XP_010438203.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Camelina sativa]
Length=709

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 130/165 (79%), Gaps = 6/165 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDR--SKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +++ + +RSG    SK V+P   PK++     E+ V D G+ KVT+FFGTQTGTAEGFAK
Sbjct  64   IVMLVLRRSGSSGDSKRVEP---PKSLVIKRREEDV-DDGRKKVTIFFGTQTGTAEGFAK  119

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            AL EE +ARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFY
Sbjct  120  ALGEEAKARYEKIRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFY  179

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWFTEG +R  WL  L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  180  KWFTEGNDRGEWLTNLKYGVFGLGNRQYEHFNKVAKVVDDLLVEQ  224



>gb|AAX59902.1| cytochrome P450 reductase [Taxus wallichiana var. chinensis]
Length=717

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +  F+W+R G  ++  KP V P  +  + +E+   D  K KVT+FFGT+TGTAEGFAKAL
Sbjct  69   VFFFVWRRGGSDTQ--KPAVKPTPLVKEEDEEEEDDSAKKKVTIFFGTRTGTAEGFAKAL  126

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARYEKAV KVVD+D+YAADD+QYEEKLKKE LAFFM+ATYGDGEPTDNAARFYKW
Sbjct  127  AEEAKARYEKAVFKVVDLDNYAADDEQYEEKLKKEKLAFFMLATYGDGEPTDNAARFYKW  186

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            F EG+ER PWL  LTYG+FGLGNRQYEHFNK+ K +DE L EQ
Sbjct  187  FLEGKEREPWLSDLTYGVFGLGNRQYEHFNKVAKAVDEVLIEQ  229



>gb|KDO43872.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=616

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGD----RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VFI +RS      + + +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  69   VVVFILRRSSSSKPKKVEPLKPLVV-----KEPEVE--VDDGKQKVTIFFGTQTGTAEGF  121

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E RARY+KA+ KVVD+DDYA ++D+YEEKLKKE + FF +ATYGDGEPTDNAAR
Sbjct  122  AKALADEARARYDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAAR  181

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE +E   WLQ+L YG+FGLGNRQYEHFNKI KV+DE L+ Q
Sbjct  182  FYKWFTEQKEGGEWLQKLKYGVFGLGNRQYEHFNKIAKVVDEILANQ  228



>gb|ABB88839.2| NADPH cytochrome P450 reductase [Stevia rebaudiana]
Length=710

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 132/165 (80%), Gaps = 4/165 (2%)
 Frame = +1

Query  139  GLLVFI-WKRSGDRSKEVKPVVVPKAMTADPEE-DAVVDPGKVKVTVFFGTQTGTAEGFA  312
            G LVF+ W+RS  +     PV  P+ +    +E ++ VD GK KV++F+GTQTGTAEGFA
Sbjct  62   GCLVFLMWRRSSSKKLVQDPV--PQVIVVKKKEKESEVDDGKKKVSIFYGTQTGTAEGFA  119

Query  313  KALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARF  492
            KAL EE + RYEK   KV+D+DDYAADDD+YEEKLKKE+LAFF +ATYGDGEPTDNAA F
Sbjct  120  KALVEEAKVRYEKTSFKVIDLDDYAADDDEYEEKLKKESLAFFFLATYGDGEPTDNAANF  179

Query  493  YKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSE  627
            YKWFTEG+++  WL++L YG+FGLGNRQYEHFNKI  V+D+KL+E
Sbjct  180  YKWFTEGDDKGEWLKKLQYGVFGLGNRQYEHFNKIAIVVDDKLTE  224



>emb|CDY14183.1| BnaA08g13140D [Brassica napus]
Length=696

 Score =   183 bits (464),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 130/167 (78%), Gaps = 10/167 (6%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKE----VKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            +++ +W++S   + +    +KP+V+       P ED V D G+ KVT+FFGTQTGTAEGF
Sbjct  53   IVMIVWRKSSSGNSKPGEPLKPLVIKP-----PREDEVED-GRKKVTIFFGTQTGTAEGF  106

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
             KAL EE RARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAAR
Sbjct  107  TKALGEEARARYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAAR  166

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTEG +R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  167  FYKWFTEGSDRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  213



>gb|KDO43873.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=598

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGD----RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VFI +RS      + + +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  69   VVVFILRRSSSSKPKKVEPLKPLVV-----KEPEVE--VDDGKQKVTIFFGTQTGTAEGF  121

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E RARY+KA+ KVVD+DDYA ++D+YEEKLKKE + FF +ATYGDGEPTDNAAR
Sbjct  122  AKALADEARARYDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAAR  181

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE +E   WLQ+L YG+FGLGNRQYEHFNKI KV+DE L+ Q
Sbjct  182  FYKWFTEQKEGGEWLQKLKYGVFGLGNRQYEHFNKIAKVVDEILANQ  228



>gb|KDO43870.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=687

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGD----RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VFI +RS      + + +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  69   VVVFILRRSSSSKPKKVEPLKPLVV-----KEPEVE--VDDGKQKVTIFFGTQTGTAEGF  121

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E RARY+KA+ KVVD+DDYA ++D+YEEKLKKE + FF +ATYGDGEPTDNAAR
Sbjct  122  AKALADEARARYDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAAR  181

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE +E   WLQ+L YG+FGLGNRQYEHFNKI KV+DE L+ Q
Sbjct  182  FYKWFTEQKEGGEWLQKLKYGVFGLGNRQYEHFNKIAKVVDEILANQ  228



>gb|KDO43868.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=715

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGD----RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VFI +RS      + + +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  69   VVVFILRRSSSSKPKKVEPLKPLVV-----KEPEVE--VDDGKQKVTIFFGTQTGTAEGF  121

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E RARY+KA+ KVVD+DDYA ++D+YEEKLKKE + FF +ATYGDGEPTDNAAR
Sbjct  122  AKALADEARARYDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAAR  181

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE +E   WLQ+L YG+FGLGNRQYEHFNKI KV+DE L+ Q
Sbjct  182  FYKWFTEQKEGGEWLQKLKYGVFGLGNRQYEHFNKIAKVVDEILANQ  228



>gb|KDO43869.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=710

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGD----RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VFI +RS      + + +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  69   VVVFILRRSSSSKPKKVEPLKPLVV-----KEPEVE--VDDGKQKVTIFFGTQTGTAEGF  121

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E RARY+KA+ KVVD+DDYA ++D+YEEKLKKE + FF +ATYGDGEPTDNAAR
Sbjct  122  AKALADEARARYDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAAR  181

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE +E   WLQ+L YG+FGLGNRQYEHFNKI KV+DE L+ Q
Sbjct  182  FYKWFTEQKEGGEWLQKLKYGVFGLGNRQYEHFNKIAKVVDEILANQ  228



>ref|XP_010433014.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=709

 Score =   182 bits (462),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDR--SKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +++ + +RSG    SK V+P   PK++     E+ V D G+ KVT+FFGTQTGTAEGFAK
Sbjct  64   IVMLVLRRSGSSGDSKRVEP---PKSLVIKRREEDV-DDGRKKVTIFFGTQTGTAEGFAK  119

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            AL EE +ARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFY
Sbjct  120  ALGEEAKARYEKIRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFY  179

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWFTEG +R  WL    YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  180  KWFTEGNDRGEWLTNFKYGVFGLGNRQYEHFNKVAKVVDDLLVEQ  224



>ref|XP_006474185.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Citrus 
sinensis]
Length=715

 Score =   182 bits (462),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGD----RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VFI +RS      + + +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  69   VVVFILRRSSSSKPKKVEPLKPLVV-----KEPEVE--VDDGKQKVTIFFGTQTGTAEGF  121

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E RARY+KA+ KVVD+DDYA ++D+YEEKLKKE + FF +ATYGDGEPTDNAAR
Sbjct  122  AKALADEARARYDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAAR  181

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE +E   WLQ+L YG+FGLGNRQYEHFNKI KV+DE L+ Q
Sbjct  182  FYKWFTEQKEGGEWLQKLKYGVFGLGNRQYEHFNKIAKVVDEILANQ  228



>emb|CDP02981.1| unnamed protein product [Coffea canephora]
Length=662

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 133/165 (81%), Gaps = 5/165 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEV--KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            ++  +W+RS   +K+V   P ++      +PEE   +D G+ KVT+FFGTQTGTAEGFAK
Sbjct  14   VVALVWRRSSASTKKVAEPPKLIMTKSVEEPEE---IDDGRTKVTIFFGTQTGTAEGFAK  70

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALA+E +ARYEKAV KV D+DDYAADD++YEEKLKKETLAFF +ATYGDGEPTDNAARFY
Sbjct  71   ALADEAKARYEKAVFKVTDLDDYAADDEEYEEKLKKETLAFFFLATYGDGEPTDNAARFY  130

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWF EG+ER  WL+ L+YG+FGLGNRQYEHFNKI KV+D+   EQ
Sbjct  131  KWFAEGKERGDWLKNLSYGVFGLGNRQYEHFNKIAKVVDDLCVEQ  175



>ref|XP_006453370.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66610.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=764

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGD----RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VFI +RS      + + +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  118  VVVFILRRSSSSKPKKVEPLKPLVV-----KEPEVE--VDDGKQKVTIFFGTQTGTAEGF  170

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E RARY+KA+ KVVD+DDYA ++D+YEEKLKKE + FF +ATYGDGEPTDNAAR
Sbjct  171  AKALADEARARYDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAAR  230

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE +E   WLQ+L YG+FGLGNRQYEHFNKI KV+DE L+ Q
Sbjct  231  FYKWFTEQKEGGEWLQKLKYGVFGLGNRQYEHFNKIAKVVDEILANQ  277



>gb|AIG15452.1| NADPH-cytochrome P450 reductase 2 [Azadirachta indica]
Length=715

 Score =   182 bits (461),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 138/167 (83%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKE----VKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++V IW+RS  +  +    +KP+VV      +PE +  VD GK K+T+FFGTQTGTAEGF
Sbjct  69   VVVLIWRRSSSQKPKKIEPLKPLVV-----KEPEVE--VDDGKQKITIFFGTQTGTAEGF  121

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E +ARY+KA+ KVVD+DDYAADD++YEEKLKKE++AFF +ATYGDGEPTDNAAR
Sbjct  122  AKALADEAKARYDKAIFKVVDLDDYAADDEEYEEKLKKESIAFFFLATYGDGEPTDNAAR  181

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTEG+ER  WLQ L YG+FGLGNRQYEHFNKI KV+D+ L+EQ
Sbjct  182  FYKWFTEGKERGEWLQNLKYGVFGLGNRQYEHFNKIAKVVDDVLAEQ  228



>ref|XP_010928663.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=706

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
            +V +W+RS  + K  +PV  PK +    + ++ VD GK KVT+FFGTQTGTAEGFAKALA
Sbjct  58   IVLVWRRSAGK-KVSRPVEPPKPLMVKTDLESEVDDGKKKVTIFFGTQTGTAEGFAKALA  116

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            EE + RY+KA  KVVD+DDYAADD++YEEK+KKE LA F +ATYGDGEPTDNAARFYKWF
Sbjct  117  EEAKVRYDKATFKVVDLDDYAADDEEYEEKMKKEMLALFFLATYGDGEPTDNAARFYKWF  176

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            TEGEER  WL+ L Y +FGLGNRQYEHFNK+ KV+D+ L++Q
Sbjct  177  TEGEERGNWLENLQYAVFGLGNRQYEHFNKVAKVVDQILADQ  218



>gb|KHG09184.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=710

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 131/163 (80%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +++ IW+RS   S++ K + +P   +   E +  VD GK KVT+ FGTQTGTAEGFAKAL
Sbjct  64   VVILIWRRSA--SQKPKQIQLPLKPSIIKEPELEVDDGKKKVTILFGTQTGTAEGFAKAL  121

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
             EE +ARYEKA   +VD+DDYAADD++YEEK+KKE LAFF +ATYGDGEPTDNAARFYKW
Sbjct  122  VEEAKARYEKATFNIVDLDDYAADDEEYEEKMKKENLAFFFLATYGDGEPTDNAARFYKW  181

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+ER  WLQ + YGIFGLGN+QYEHFNK+ KV+DE L+EQ
Sbjct  182  FTEGKERGEWLQNMKYGIFGLGNKQYEHFNKVAKVVDELLTEQ  224



>ref|XP_011010331.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 125/163 (77%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++V IW+RS    K   PV     +  D E +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  65   VVVLIWRRSSGYQKPKVPVPPKPLIVKDLEPE--VDDGKKKVTIFFGTQTGTAEGFAKAL  122

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE RARYEKA+ K VD+DDYA DDD+YEEKLKKE+L  F +ATYGDGEPTDNAARFYKW
Sbjct  123  AEEARARYEKAIFKTVDLDDYAEDDDEYEEKLKKESLVIFFLATYGDGEPTDNAARFYKW  182

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FT+G ER  WL+QL Y +FGLGNRQYEHFNKI  V+D+ L  Q
Sbjct  183  FTDGNERGEWLKQLPYAVFGLGNRQYEHFNKIAIVVDKMLGNQ  225



>emb|CDX68634.1| BnaC01g08190D [Brassica napus]
Length=712

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 130/167 (78%), Gaps = 7/167 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRS----KEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            +++ +W+RSG  S    K V+  + P  +   P ED V D G+ KVT+FFGTQTGTAEGF
Sbjct  66   IVMLVWRRSGGSSGNSSKRVETTLKP--LVIKPREDEV-DDGRKKVTIFFGTQTGTAEGF  122

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKAL EE +ARYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAAR
Sbjct  123  AKALGEEAKARYEKIRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAAR  182

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTEG  R  WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  183  FYKWFTEGNHRGEWLKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  229



>gb|ACF35280.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=709

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 156/206 (76%), Gaps = 4/206 (2%)
 Frame = +1

Query  13   RERERNMESTSELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVK  192
            R  + NM   S+    L + + + L N  +V+LLTTSLAV++GL+V +  R     +EV+
Sbjct  22   RVDQSNMSLDSD--EPLPTTVAMLLENRELVMLLTTSLAVLMGLMVVLVLRRRSAKQEVE  79

Query  193  PVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvd  372
            P  V   +T   EE+  VD GK KVT+FFGTQTGTAEGFAKALAEE +ARYEKA  KV D
Sbjct  80   PPKV--TVTKVVEEETEVDDGKKKVTIFFGTQTGTAEGFAKALAEEAKARYEKASFKVFD  137

Query  373  mddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYG  552
            +DDYAADDDQYEEK KKETLAFF +ATYGDGEPTDNAA FYKWFTEG+++  WL+ L YG
Sbjct  138  LDDYAADDDQYEEKFKKETLAFFFLATYGDGEPTDNAATFYKWFTEGKKKGDWLKNLHYG  197

Query  553  IFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +FGLGNRQYEHFNKI KV+D+ L+EQ
Sbjct  198  VFGLGNRQYEHFNKIAKVVDQLLAEQ  223



>gb|AAC05022.1| NADPH:ferrihemoprotein oxidoreductase [Eschscholzia californica]
Length=705

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 133/162 (82%), Gaps = 3/162 (2%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
             +++W+RS ++S ++   V  + +  + E +  VD GK KVT+FFGTQTGTAEGFAKALA
Sbjct  58   FLYVWRRSSNKSSKI---VETQKLIVEKEPEPEVDDGKKKVTIFFGTQTGTAEGFAKALA  114

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            EE +ARYEKA+ KV+D+DDY ADDD++EEKLKKET+A F +ATYGDGEPTDNAARFYKWF
Sbjct  115  EEAKARYEKAIFKVIDLDDYGADDDEFEEKLKKETIALFFLATYGDGEPTDNAARFYKWF  174

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            TEG+ER  WLQ L +G+FGLGNRQYEHFNK+ K +DE L+EQ
Sbjct  175  TEGKEREMWLQNLQFGVFGLGNRQYEHFNKVAKEVDEILTEQ  216



>ref|XP_011079296.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=705

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 135/165 (82%), Gaps = 6/165 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKP--VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            ++V  W+R   + K V+P  +V+PKA   +PEE   VD GK KV+VFFGTQTGTAEGFAK
Sbjct  57   VVVLAWRRGSGKKKPVEPPKLVLPKA-ALEPEE---VDDGKKKVSVFFGTQTGTAEGFAK  112

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            A +EE +ARY++A  KV+D+DDYAADD++YEEKLKKETLAFF +A+YGDGEPTDNAARFY
Sbjct  113  AFSEEAKARYQQAKFKVIDLDDYAADDEEYEEKLKKETLAFFFLASYGDGEPTDNAARFY  172

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWFTEG+ER  WL+ L YGIFGLGNRQYEHFNKI  V+D  ++EQ
Sbjct  173  KWFTEGKERGDWLKNLQYGIFGLGNRQYEHFNKIAIVVDNIMAEQ  217



>ref|XP_010265447.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=704

 Score =   180 bits (457),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 138/164 (84%), Gaps = 4/164 (2%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPK-AMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            + VF+W+RS  + KE K V  PK  +  +PE +  VD G  KVT+FFGTQTGT+EGFAKA
Sbjct  57   VFVFVWRRSSGQ-KESKGVEAPKPVIVKEPEPE--VDDGTKKVTIFFGTQTGTSEGFAKA  113

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            LAEE +ARYEKA  KVVD+DDYAADDD+YEEK+KKETLAFF +ATYGDGEPTDNAARFYK
Sbjct  114  LAEEAKARYEKATFKVVDLDDYAADDDEYEEKMKKETLAFFFLATYGDGEPTDNAARFYK  173

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG+ER  WL++LT+G+FGLGNRQYEHFNK+ KV+DE L+EQ
Sbjct  174  WFTEGKERGTWLEKLTFGVFGLGNRQYEHFNKVAKVVDELLAEQ  217



>gb|KJB53795.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=657

 Score =   180 bits (456),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +++ IW+RS   S++ K + +P   +   E +  VD GK KVT+ FGTQTGT+EGFAKAL
Sbjct  64   VVILIWRRSS--SQKPKEIQLPLKPSIIKEPELEVDDGKKKVTILFGTQTGTSEGFAKAL  121

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
             EE +ARYEKA   +VD+DDYAADD++YEEK+KKE+LAFF +ATYGDGEPTDNAARFYKW
Sbjct  122  VEEAKARYEKATFNIVDLDDYAADDEEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKW  181

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+ER  WLQ + YGIFGLGN+QYEHFNK+ KV+DE L+EQ
Sbjct  182  FTEGKERGEWLQNMKYGIFGLGNKQYEHFNKVAKVVDELLTEQ  224



>gb|KJB53796.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=614

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +++ IW+RS   S++ K + +P   +   E +  VD GK KVT+ FGTQTGT+EGFAKAL
Sbjct  64   VVILIWRRSS--SQKPKEIQLPLKPSIIKEPELEVDDGKKKVTILFGTQTGTSEGFAKAL  121

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
             EE +ARYEKA   +VD+DDYAADD++YEEK+KKE+LAFF +ATYGDGEPTDNAARFYKW
Sbjct  122  VEEAKARYEKATFNIVDLDDYAADDEEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKW  181

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+ER  WLQ + YGIFGLGN+QYEHFNK+ KV+DE L+EQ
Sbjct  182  FTEGKERGEWLQNMKYGIFGLGNKQYEHFNKVAKVVDELLTEQ  224



>ref|XP_009795589.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=713

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 136/165 (82%), Gaps = 7/165 (4%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEV---KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +V +W+RS   +K+V     +VVPK++  +PEE   +D GK KVT+FFGTQTGTAEGFAK
Sbjct  68   VVLMWRRSSTSAKKVVEPPKLVVPKSVI-EPEE---IDDGKKKVTIFFGTQTGTAEGFAK  123

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALAEE +ARY+KA  KV+DMDDYAADDD YEEKLKKETLAFF +ATYGDGEPTDNAARFY
Sbjct  124  ALAEEAKARYDKATFKVIDMDDYAADDDDYEEKLKKETLAFFFLATYGDGEPTDNAARFY  183

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWF EG+ER  + + L YG+FGLGNRQYEHFNKI KV+D+ L+EQ
Sbjct  184  KWFVEGKERGDYFKNLQYGVFGLGNRQYEHFNKIAKVVDDLLAEQ  228



>gb|KJB53797.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=711

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +++ IW+RS   S++ K + +P   +   E +  VD GK KVT+ FGTQTGT+EGFAKAL
Sbjct  64   VVILIWRRSS--SQKPKEIQLPLKPSIIKEPELEVDDGKKKVTILFGTQTGTSEGFAKAL  121

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
             EE +ARYEKA   +VD+DDYAADD++YEEK+KKE+LAFF +ATYGDGEPTDNAARFYKW
Sbjct  122  VEEAKARYEKATFNIVDLDDYAADDEEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKW  181

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+ER  WLQ + YGIFGLGN+QYEHFNK+ KV+DE L+EQ
Sbjct  182  FTEGKERGEWLQNMKYGIFGLGNKQYEHFNKVAKVVDELLTEQ  224



>gb|KJB53794.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=710

 Score =   180 bits (456),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +++ IW+RS   S++ K + +P   +   E +  VD GK KVT+ FGTQTGT+EGFAKAL
Sbjct  64   VVILIWRRSS--SQKPKEIQLPLKPSIIKEPELEVDDGKKKVTILFGTQTGTSEGFAKAL  121

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
             EE +ARYEKA   +VD+DDYAADD++YEEK+KKE+LAFF +ATYGDGEPTDNAARFYKW
Sbjct  122  VEEAKARYEKATFNIVDLDDYAADDEEYEEKMKKESLAFFFLATYGDGEPTDNAARFYKW  181

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+ER  WLQ + YGIFGLGN+QYEHFNK+ KV+DE L+EQ
Sbjct  182  FTEGKERGEWLQNMKYGIFGLGNKQYEHFNKVAKVVDELLTEQ  224



>ref|XP_008781895.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Phoenix dactylifera]
Length=706

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
            +VF+W+RS  + K  +PV  P+ +    + +  VD GK KVT+FFGTQTGTAEGFAKALA
Sbjct  58   IVFVWRRSTGK-KASRPVEPPRPLVVKTDLEPEVDDGKKKVTIFFGTQTGTAEGFAKALA  116

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            EE +ARY+KA  KVVD+DDYAADD++YEE +KKETLA F +ATYGDGEPTDNAARF++WF
Sbjct  117  EEAKARYDKATFKVVDLDDYAADDEEYEENMKKETLAVFFLATYGDGEPTDNAARFFRWF  176

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            TEG+ER  WL+ L Y +FGLGNRQYEHFNK+ KV+DE L+ Q
Sbjct  177  TEGKERESWLENLQYAVFGLGNRQYEHFNKVAKVVDEVLAVQ  218



>gb|AAB97736.1| NADPH cytochrome P450 reductase [Petroselinum crispum]
Length=681

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
            +V +W+RS  RS  VK V  PK +    E +  VD GK KVTVFFGTQTGTAEGFAKA A
Sbjct  36   VVLVWRRSSLRS--VKSVEPPKLIVPKVEIEDEVDDGKKKVTVFFGTQTGTAEGFAKAFA  93

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            EE +ARYEKA  +VVD+DDYAA+D++YE K KKE+ AFF +ATYGDGEPTDNAARFYKWF
Sbjct  94   EEAKARYEKAKFRVVDLDDYAAEDEEYEAKFKKESFAFFFLATYGDGEPTDNAARFYKWF  153

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +EGEE+  WL +L YG+FGLGNRQYEHFNKI KV+D+ L++Q
Sbjct  154  SEGEEKGDWLNKLQYGVFGLGNRQYEHFNKIAKVVDDGLADQ  195



>ref|XP_010447751.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=710

 Score =   179 bits (454),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 123/166 (74%), Gaps = 7/166 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDR--SKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +++ + +RSG    SK V+P   PK++     E+ V D G+ KVT+FFGTQTGTAEGFAK
Sbjct  64   IVMLVLRRSGSSGDSKRVEP---PKSLVIKRREEDV-DDGRKKVTIFFGTQTGTAEGFAK  119

Query  316  ALAEEIRARYEKav-vkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARF  492
            AL EE +ARYEK     V   D  AADDD+YEEKLKKE L FF +ATYGDGEPTDNAARF
Sbjct  120  ALGEEAKARYEKIRFKIVDLDDYAAADDDEYEEKLKKEDLVFFFLATYGDGEPTDNAARF  179

Query  493  YKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            YKWFTEG +R  WL  L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  180  YKWFTEGNDRGEWLTNLKYGVFGLGNRQYEHFNKVAKVVDDLLVEQ  225



>gb|KDO43871.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=714

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGD----RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VFI +RS      + + +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  69   VVVFILRRSSSSKPKKVEPLKPLVV-----KEPEVE--VDDGKQKVTIFFGTQTGTAEGF  121

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E RARY+KA+ KVVD+DDYA ++D+YEEKLKKE + FF +ATYGDGEPTDNAAR
Sbjct  122  AKALADEARARYDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAAR  181

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE +E   WLQ+L YG+FGLGNRQYEHFNKI KV+DE L+ Q
Sbjct  182  FYKWFTE-KEGGEWLQKLKYGVFGLGNRQYEHFNKIAKVVDEILANQ  227



>ref|NP_001063914.1| Os09g0558900 [Oryza sativa Japonica Group]
 dbj|BAD45947.1| putative NADPH-cytochrome P450 oxydoreductase isoform 3 [Oryza 
sativa Japonica Group]
 dbj|BAF25828.1| Os09g0558900 [Oryza sativa Japonica Group]
Length=714

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = +1

Query  175  RSKEVKP-VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEK  351
            R++E +P    P     + E D   D G+ +V VFFGTQTGTAEGFAKALAEE ++RY+K
Sbjct  76   RAQEPQPRAPAPAKRKQEAEPDP--DDGRQRVAVFFGTQTGTAEGFAKALAEEAKSRYDK  133

Query  352  avvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPW  531
            AV KV+D+D+YAADD++YE+KLKKE +A F VATYGDGEPTDNAARFYKWF EG ER  W
Sbjct  134  AVFKVLDLDEYAADDEEYEQKLKKEIIALFFVATYGDGEPTDNAARFYKWFGEGNERGEW  193

Query  532  LQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            L  L +G+FGLGNRQYEHFNK+GKV+D+ L+EQ
Sbjct  194  LSNLRFGVFGLGNRQYEHFNKVGKVVDQLLAEQ  226



>gb|EAZ10065.1| hypothetical protein OsI_32371 [Oryza sativa Indica Group]
Length=717

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = +1

Query  175  RSKEVKP-VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEK  351
            R++E +P    P     + E D   D G+ +V VFFGTQTGTAEGFAKALAEE ++RY+K
Sbjct  79   RAQEPQPRAPAPAKRKQEAEPDP--DDGRQRVAVFFGTQTGTAEGFAKALAEEAKSRYDK  136

Query  352  avvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPW  531
            AV KV+D+D+YAADD++YE+KLKKE +A F VATYGDGEPTDNAARFYKWF EG ER  W
Sbjct  137  AVFKVLDLDEYAADDEEYEQKLKKEIIALFFVATYGDGEPTDNAARFYKWFGEGNERGEW  196

Query  532  LQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            L  L +G+FGLGNRQYEHFNK+GKV+D+ L+EQ
Sbjct  197  LSNLRFGVFGLGNRQYEHFNKVGKVVDQLLAEQ  229



>ref|XP_006474186.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Citrus 
sinensis]
Length=714

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGD----RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VFI +RS      + + +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  69   VVVFILRRSSSSKPKKVEPLKPLVV-----KEPEVE--VDDGKQKVTIFFGTQTGTAEGF  121

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E RARY+KA+ KVVD+DDYA ++D+YEEKLKKE + FF +ATYGDGEPTDNAAR
Sbjct  122  AKALADEARARYDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAAR  181

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE +E   WLQ+L YG+FGLGNRQYEHFNKI KV+DE L+ Q
Sbjct  182  FYKWFTE-KEGGEWLQKLKYGVFGLGNRQYEHFNKIAKVVDEILANQ  227



>ref|XP_006453369.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66609.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=763

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 133/167 (80%), Gaps = 12/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGD----RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VFI +RS      + + +KP+VV      +PE +  VD GK KVT+FFGTQTGTAEGF
Sbjct  118  VVVFILRRSSSSKPKKVEPLKPLVV-----KEPEVE--VDDGKQKVTIFFGTQTGTAEGF  170

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALA+E RARY+KA+ KVVD+DDYA ++D+YEEKLKKE + FF +ATYGDGEPTDNAAR
Sbjct  171  AKALADEARARYDKAIFKVVDIDDYADEEDEYEEKLKKENIVFFFLATYGDGEPTDNAAR  230

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE +E   WLQ+L YG+FGLGNRQYEHFNKI KV+DE L+ Q
Sbjct  231  FYKWFTE-KEGGEWLQKLKYGVFGLGNRQYEHFNKIAKVVDEILANQ  276



>gb|EEE70211.1| hypothetical protein OsJ_30318 [Oryza sativa Japonica Group]
Length=795

 Score =   178 bits (452),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = +1

Query  175  RSKEVKP-VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEK  351
            R++E +P    P     + E D   D G+ +V VFFGTQTGTAEGFAKALAEE ++RY+K
Sbjct  101  RAQEPQPRAPAPAKRKQEAEPDP--DDGRQRVAVFFGTQTGTAEGFAKALAEEAKSRYDK  158

Query  352  avvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPW  531
            AV KV+D+D+YAADD++YE+KLKKE +A F VATYGDGEPTDNAARFYKWF EG ER  W
Sbjct  159  AVFKVLDLDEYAADDEEYEQKLKKEIIALFFVATYGDGEPTDNAARFYKWFGEGNERGEW  218

Query  532  LQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            L  L +G+FGLGNRQYEHFNK+GKV+D+ L+EQ
Sbjct  219  LSNLRFGVFGLGNRQYEHFNKVGKVVDQLLAEQ  251



>ref|XP_008451695.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis melo]
Length=705

 Score =   177 bits (450),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 137/165 (83%), Gaps = 7/165 (4%)
 Frame = +1

Query  142  LLVFIWKRS-GDRSKEVKPVVVPKAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            ++VF+WKRS G +SK  +P   PK +   +PE +  VD GK KVTVFFGTQTGTAEGFAK
Sbjct  62   VVVFVWKRSSGQKSKPFEP---PKQLIVKEPEPE--VDDGKKKVTVFFGTQTGTAEGFAK  116

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALAEE +ARY+KA  +VVD+DDYAADDD+YEEKLKKETLA F +ATYGDGEPTDNAARFY
Sbjct  117  ALAEEAKARYDKATFRVVDLDDYAADDDEYEEKLKKETLAIFFLATYGDGEPTDNAARFY  176

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWF+EG+E+  W+  L Y +FGLGNRQYEHFNKI KV+DE+L+EQ
Sbjct  177  KWFSEGKEKGEWISNLQYAVFGLGNRQYEHFNKIAKVVDEQLAEQ  221



>ref|XP_007154761.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
 gb|ESW26755.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
Length=707

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 128/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTAD-PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++VF+W+RS   + + KP+  PK +    PE +  +D G  KVTVFFGTQTGTAEGF+KA
Sbjct  60   VVVFVWRRSA--TPKTKPLEPPKRVVEKLPEIE--LDDGTKKVTVFFGTQTGTAEGFSKA  115

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            +AEE +ARYEKA  +VVD+DDYAADD++YE +LKKE    F +ATYGDGEPTDNAARFYK
Sbjct  116  IAEEAKARYEKATFRVVDLDDYAADDEEYEARLKKEKYVLFFLATYGDGEPTDNAARFYK  175

Query  499  WFTEGEERSP-WLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG E+   WL+ L YG+FGLGNRQYEHFNK+  V+DE  +EQ
Sbjct  176  WFTEGGEKGEGWLENLHYGVFGLGNRQYEHFNKVAIVVDELFAEQ  220



>emb|CDY28169.1| BnaA01g06800D [Brassica napus]
Length=696

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = +1

Query  244  VDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKK  423
            VD G+ KVT+FFGTQTGTAEGFAKAL EE +ARYEK   K+VD+DDYAADDD+YEEKLKK
Sbjct  85   VDDGRKKVTIFFGTQTGTAEGFAKALGEEAKARYEKIRFKIVDLDDYAADDDEYEEKLKK  144

Query  424  ETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGK  603
            E +AFF +ATYGDGEPTDNAARFYKWFTEG +R  WL+ L YG+FGLGNRQYEHFNK+ K
Sbjct  145  EDVAFFFLATYGDGEPTDNAARFYKWFTEGNDRGEWLKNLKYGVFGLGNRQYEHFNKVAK  204

Query  604  VIDEKLSEQ  630
            V+D+ L EQ
Sbjct  205  VVDDILVEQ  213



>ref|XP_004296434.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Fragaria vesca 
subsp. vesca]
Length=709

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 132/167 (79%), Gaps = 11/167 (7%)
 Frame = +1

Query  142  LLVFIWKRSGDRS----KEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++VF+W+RS  +     + +KP+V+P     +PE +  +D G  KVT+FFGTQTGTAEGF
Sbjct  62   VVVFVWRRSSAQKPKLVQPLKPLVIP-----EPEPE--LDDGSKKVTIFFGTQTGTAEGF  114

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALAEE +ARY+K   KVVD+DDYAADD+ YEEKLK E+LA F +ATYGDGEPTDNAAR
Sbjct  115  AKALAEEAKARYDKVTFKVVDLDDYAADDEAYEEKLKNESLAIFFLATYGDGEPTDNAAR  174

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTEG+E+  WLQ L YG+FGLGNRQYEHFNK+  V+DE L+ Q
Sbjct  175  FYKWFTEGKEKEAWLQNLHYGVFGLGNRQYEHFNKVAVVVDEILAAQ  221



>gb|KDP36395.1| hypothetical protein JCGZ_08664 [Jatropha curcas]
Length=711

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +V + +RS  +  +   +  PK +   +PE +  VD G+ KVT+FFGTQTGTAEGFAKAL
Sbjct  64   VVLVLRRSSGQKSKTAIIEPPKPLIVKEPEPE--VDDGQKKVTIFFGTQTGTAEGFAKAL  121

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARYEKA  +VVD+D++AADDD+YE KLKKE+L  F VATYGDGEPTDNAARFYKW
Sbjct  122  AEEAKARYEKATFRVVDLDEFAADDDEYERKLKKESLCLFFVATYGDGEPTDNAARFYKW  181

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG ER  WLQ L +G+FGLGN+QYEHFNKIGKV+DE L+EQ
Sbjct  182  FTEGNERGEWLQNLKFGVFGLGNKQYEHFNKIGKVLDEILAEQ  224



>dbj|BAJ41269.1| NADPH-P450 reductase 2 [Zingiber officinale]
Length=701

 Score =   177 bits (449),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 130/163 (80%), Gaps = 6/163 (4%)
 Frame = +1

Query  145  LVFIWKRSGDRSKE-VKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            + F+W+ SG +  E +KP+VV   M A+ E     D GK KVTVFFGTQTGTAEGFAKAL
Sbjct  58   IFFVWRSSGRKPAEPLKPLVVKTQMYAEEE-----DQGKKKVTVFFGTQTGTAEGFAKAL  112

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARY  A+ KVVD+D+YAA+DD+YEE LKKE+LA F +ATYGDGEPTDNAARFYKW
Sbjct  113  AEEAKARYPNAIFKVVDIDEYAAEDDEYEENLKKESLALFFLATYGDGEPTDNAARFYKW  172

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+ER  WL+ L +G+FGLGNRQYEHFNK+  V+DE L EQ
Sbjct  173  FTEGKERGIWLENLQFGVFGLGNRQYEHFNKVAVVVDELLHEQ  215



>ref|XP_004148333.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
 gb|KGN61141.1| hypothetical protein Csa_2G059720 [Cucumis sativus]
Length=708

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++VF+WKRS    ++ KP   PK +   +PE +  VD GK KVTVFFGTQTGTAEGFAKA
Sbjct  62   VVVFVWKRSS--GQKAKPFEPPKQLIVKEPEPE--VDDGKKKVTVFFGTQTGTAEGFAKA  117

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            LAEE +ARY+KA  +VVD+DDYAADDD+YEEKLKKETLA F +ATYGDGEPTDNAARFYK
Sbjct  118  LAEEAKARYDKATFRVVDLDDYAADDDEYEEKLKKETLAIFFLATYGDGEPTDNAARFYK  177

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WF+EG+E+  W+  L Y +FGLGNRQYEHFNKI KV+DE+L+EQ
Sbjct  178  WFSEGKEKGEWISNLQYAVFGLGNRQYEHFNKIAKVVDEQLAEQ  221



>ref|XP_004168364.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
Length=708

 Score =   176 bits (447),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 135/164 (82%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTA-DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++VF+WKRS    ++ KP   PK +   +PE +  VD GK KVTVFFGTQTGTAEGFAKA
Sbjct  62   VVVFVWKRSS--GQKAKPFEPPKQLIVKEPEPE--VDDGKKKVTVFFGTQTGTAEGFAKA  117

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            LAEE +ARY+KA  +VVD+DDYAADDD+YEEKLKKETLA F +ATYGDGEPTDNAARFYK
Sbjct  118  LAEEAKARYDKATFRVVDLDDYAADDDEYEEKLKKETLAIFFLATYGDGEPTDNAARFYK  177

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WF+EG+E+  W+  L Y +FGLGNRQYEHFNKI KV+DE+L+EQ
Sbjct  178  WFSEGKEKGEWISNLQYAVFGLGNRQYEHFNKIAKVVDEQLAEQ  221



>emb|CAE01547.2| OSJNBb0022F16.2 [Oryza sativa Japonica Group]
 emb|CAE03554.2| OSJNBa0060D06.20 [Oryza sativa Japonica Group]
Length=695

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 0/162 (0%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
            ++ +W RSG  +        P+      E DA  D G+ +VTVFFGTQTGTAEGFAKA+A
Sbjct  45   ILAVWFRSGGGAPPKAAAPPPRPPPVKIEADADADDGRKRVTVFFGTQTGTAEGFAKAMA  104

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            EE RARYEKAV KVVD+DDYAA+D++YEEKL+KET+    +ATYGDGEPTDNAARFYKWF
Sbjct  105  EEARARYEKAVFKVVDLDDYAAEDEEYEEKLRKETIVLLFLATYGDGEPTDNAARFYKWF  164

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            TEG+E+  WL+ L Y +FGLGNRQYEHFNK+ KV+DE L EQ
Sbjct  165  TEGKEKEVWLKDLKYAVFGLGNRQYEHFNKVAKVVDELLEEQ  206



>ref|XP_002960044.1| hypothetical protein SELMODRAFT_401997 [Selaginella moellendorffii]
 gb|EFJ37583.1| hypothetical protein SELMODRAFT_401997 [Selaginella moellendorffii]
Length=597

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +1

Query  148  VFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAE  327
            +F+W+R+    +E +PV V K +    EE   +D    KVTVFFGTQTGTAEGFAKALAE
Sbjct  24   LFLWRRADSSKRESEPVKVVKPVVEIEEEGDELDGFSNKVTVFFGTQTGTAEGFAKALAE  83

Query  328  EIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFT  507
            E ++RYEK + K+VD+D+YAADD+ Y+ KLKKE  A FM+ATYGDGEPTDNAARFYK+ T
Sbjct  84   EAKSRYEKVLFKIVDLDNYAADDETYQLKLKKENFAIFMLATYGDGEPTDNAARFYKFLT  143

Query  508  E-GEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            E GEER  WL ++TYGIFGLGNRQYEHFNK+  V+DE+L +Q
Sbjct  144  EGGEERGSWLSEMTYGIFGLGNRQYEHFNKVAMVVDEELEKQ  185



>ref|XP_003579401.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=692

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  253  GKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETL  432
            G+ +VT+FFGTQTGTAEGFAKA+AEE + RYEK V KVVD+DDYAA+DD+YEEKLKKETL
Sbjct  79   GRKRVTIFFGTQTGTAEGFAKAMAEEAKVRYEKTVFKVVDLDDYAAEDDEYEEKLKKETL  138

Query  433  AFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVID  612
              F +ATYGDGEPTDNAARFYKWFTEG+E+  WL+   Y +FGLGNRQYEHFNK+ KV+D
Sbjct  139  VLFFLATYGDGEPTDNAARFYKWFTEGKEKEVWLKDFKYAVFGLGNRQYEHFNKVAKVVD  198

Query  613  EKLSEQ  630
            E L EQ
Sbjct  199  ELLEEQ  204



>ref|XP_009607226.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=713

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 135/165 (82%), Gaps = 7/165 (4%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEV---KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +V +W+RS   +K+V     +VVPK++  +PEE   +D GK KVT+FFGTQTGTAEGFAK
Sbjct  68   VVLMWRRSSTSAKKVVEPPKLVVPKSVI-EPEE---IDDGKKKVTIFFGTQTGTAEGFAK  123

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALAEE +ARY+KA  KV+DMDDYA DDD YE+KLKKETLAFF +ATYGDGEPTDNAARFY
Sbjct  124  ALAEEAKARYDKATFKVIDMDDYAVDDDDYEDKLKKETLAFFFLATYGDGEPTDNAARFY  183

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWF EG+ER  + + L YG+FGLGNRQYEHFNKI KV+D+ L+EQ
Sbjct  184  KWFVEGKERGDYFKNLQYGVFGLGNRQYEHFNKIAKVVDDLLAEQ  228



>gb|EPS73891.1| hypothetical protein M569_00858 [Genlisea aurea]
Length=706

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 132/166 (80%), Gaps = 7/166 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRSK---EVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFA  312
            +L  +W+++   +K   E   +  PK + AD EE   +D G  KVTVF+GTQTGTAEGFA
Sbjct  62   VLFLVWRKTAGSAKKPSEAAKIAAPK-VKADEEE---IDDGTKKVTVFYGTQTGTAEGFA  117

Query  313  KALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARF  492
            KALAEE RARY++A  KVVD+DDYAA+D++YEEK+KKE++AFF +ATYGDGEPTDNAARF
Sbjct  118  KALAEEARARYQQAKFKVVDLDDYAAEDEEYEEKMKKESVAFFFLATYGDGEPTDNAARF  177

Query  493  YKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            YKWFTEG+ER  WL  L YG+FGLGNRQYEHFNKI  V+DE L+EQ
Sbjct  178  YKWFTEGKERGEWLTNLQYGVFGLGNRQYEHFNKIAIVVDELLAEQ  223



>ref|XP_008391625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Malus domestica]
Length=712

 Score =   175 bits (444),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 130/165 (79%), Gaps = 5/165 (3%)
 Frame = +1

Query  142  LLVFIWKR--SGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            ++VF+ +R  S  +S+ ++P      +  +PEE   VD G  KVT+FFGTQTGTAEGFAK
Sbjct  63   VVVFVLRRFSSQKQSRVLQPPKPLIVLEPEPEE---VDDGSRKVTIFFGTQTGTAEGFAK  119

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALAEE +ARYEK   KVVD+DDYAADD+ YEEKLK E+LAFF +ATYGDGEPTDNAARFY
Sbjct  120  ALAEEAKARYEKVTFKVVDLDDYAADDEAYEEKLKNESLAFFFLATYGDGEPTDNAARFY  179

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWFTEGEER  WL+ L YG+FGLGNRQYEHFNK+  V+DE L+ Q
Sbjct  180  KWFTEGEERGEWLKNLHYGVFGLGNRQYEHFNKVAVVVDEILAAQ  224



>emb|CCO62220.1| putative cytochrome P450 reductase [Actaea racemosa]
Length=699

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 135/168 (80%), Gaps = 12/168 (7%)
 Frame = +1

Query  142  LLVFIWKRSGDR--SKEV---KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEG  306
            +++ +W+RS  +  SK+V   KP++V K    +PE    VD GK KVTVFFGTQTGTAEG
Sbjct  51   VVLLVWRRSSGQKSSKDVVHLKPLIVKKD---EPE----VDDGKKKVTVFFGTQTGTAEG  103

Query  307  FAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAA  486
            FAKALAEE +ARYEKAV KVVD+DDYA DDD+YEE+LKKET+A F VATYGDGEPTDNAA
Sbjct  104  FAKALAEEAKARYEKAVFKVVDLDDYAQDDDEYEERLKKETIALFFVATYGDGEPTDNAA  163

Query  487  RFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            RFYKWF+EG+ER  W+  L +G+FGLGNRQYEHFNK+  V+DE L+ Q
Sbjct  164  RFYKWFSEGKEREAWIPNLQFGVFGLGNRQYEHFNKVAIVVDEILAAQ  211



>gb|ADG29353.1| cytochrome P450 reductase [Withania somnifera]
Length=713

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 134/164 (82%), Gaps = 7/164 (4%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEV---KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +V +W+RS   +K+V     +VVPK++  +P+E   +D GK K+T+FFGTQTGTAEGFAK
Sbjct  68   VVLMWRRSSTSAKKVMEPPKLVVPKSVI-EPQE---IDDGKKKITIFFGTQTGTAEGFAK  123

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALAEE +ARYEKA VKV+D+DDYAADD++YE+K  KETLAFF  ATYGDGEPTDNAARFY
Sbjct  124  ALAEEAKARYEKATVKVIDLDDYAADDEEYEKKFAKETLAFFFSATYGDGEPTDNAARFY  183

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSE  627
            KWF EG+ER  + + L YG+FGLGNRQYEHFN+I KV+DE L+E
Sbjct  184  KWFVEGKERGDYFKNLQYGVFGLGNRQYEHFNRIAKVVDELLAE  227



>ref|XP_010525727.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Tarenaya hassleriana]
Length=713

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 131/164 (80%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSG-DRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +   +W+RSG ++ K V+P+   K +   P E+ V D G+ KVT+FFGTQTGTAEGFAKA
Sbjct  69   VFFLVWRRSGGNKPKRVEPL---KPLVLKPREEEVED-GRKKVTIFFGTQTGTAEGFAKA  124

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            LAEE +ARYEKA  KVVD++DYAADDD+Y EKLKKE  AFF +ATYGDGEPTDNAARFYK
Sbjct  125  LAEEAKARYEKARFKVVDLEDYAADDDEYAEKLKKEKFAFFFLATYGDGEPTDNAARFYK  184

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG++    L+ + YG+FGLGNRQYEHFNKI KV+DE LS+Q
Sbjct  185  WFTEGDDNGEMLKDMKYGVFGLGNRQYEHFNKIAKVVDEMLSDQ  228



>gb|KFK29577.1| nadph-ferrihemoprotein reductase [Arabis alpina]
Length=715

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 128/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  142  LLVFIWKRSGD-RSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +++ +++RSG   SK V+P+   K +   P ED V D G+ KVT+FFGTQTGTAEGFAKA
Sbjct  71   IVMLVYRRSGSGNSKRVEPL---KPLVIKPREDEV-DDGRKKVTIFFGTQTGTAEGFAKA  126

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            L +E R RYEK   K+VD+DDYAADDD+YEEKLKKE +AFF +ATYGDGEPTDNAARFYK
Sbjct  127  LGDEARVRYEKTRFKIVDLDDYAADDDEYEEKLKKEDVAFFFLATYGDGEPTDNAARFYK  186

Query  499  WFTEGEERS-PWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTE  +R     + L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  187  WFTEENDRGEECFKNLKYGVFGLGNRQYEHFNKVAKVVDDILVEQ  231



>ref|XP_008383105.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Malus 
domestica]
Length=709

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 127/165 (77%), Gaps = 5/165 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVV--PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            ++V + +RS   S +  P V+  P+ +  +  E    D G  KVT+FFGTQTGTAEGFAK
Sbjct  59   VVVLVLRRS---SAQKHPGVIQSPRPLIVEEPEPVEADNGSKKVTIFFGTQTGTAEGFAK  115

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALAEE +ARYEK   KVVD+DDYAADD+ YEEKLK E+LAFF +ATYGDGEPTDNAARFY
Sbjct  116  ALAEEAKARYEKVTFKVVDLDDYAADDEAYEEKLKNESLAFFFLATYGDGEPTDNAARFY  175

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWFTEGEER  WL+ L YG+FGLGNRQYEHFNK+  V+DE L+ Q
Sbjct  176  KWFTEGEERGEWLKNLNYGVFGLGNRQYEHFNKVAVVVDEILAAQ  220



>ref|XP_008383106.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Malus 
domestica]
Length=708

 Score =   174 bits (440),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 127/165 (77%), Gaps = 5/165 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVV--PKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            ++V + +RS   S +  P V+  P+ +  +  E    D G  KVT+FFGTQTGTAEGFAK
Sbjct  59   VVVLVLRRS---SAQKHPGVIQSPRPLIVEEPEPVEADNGSKKVTIFFGTQTGTAEGFAK  115

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALAEE +ARYEK   KVVD+DDYAADD+ YEEKLK E+LAFF +ATYGDGEPTDNAARFY
Sbjct  116  ALAEEAKARYEKVTFKVVDLDDYAADDEAYEEKLKNESLAFFFLATYGDGEPTDNAARFY  175

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWFTEGEER  WL+ L YG+FGLGNRQYEHFNK+  V+DE L+ Q
Sbjct  176  KWFTEGEERGEWLKNLNYGVFGLGNRQYEHFNKVAVVVDEILAAQ  220



>ref|NP_001061346.1| Os08g0243500, partial [Oryza sativa Japonica Group]
 dbj|BAF23260.1| Os08g0243500, partial [Oryza sativa Japonica Group]
Length=651

 Score =   173 bits (439),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +1

Query  262  KVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFF  441
            +VTVFFGTQTGTAEGFAKALAEE ++RY+KA+ KVVD+D+YA +D++YEE+LKKE ++ F
Sbjct  42   RVTVFFGTQTGTAEGFAKALAEEAKSRYDKAIFKVVDLDEYAMEDEEYEERLKKEKISLF  101

Query  442  MVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKL  621
             VATYGDGEPTDNAARFYKWFTEG ER  WL    Y IFGLGNRQYEHFNK+ KV+DE L
Sbjct  102  FVATYGDGEPTDNAARFYKWFTEGNERGVWLNDFQYAIFGLGNRQYEHFNKVAKVVDELL  161

Query  622  SEQ  630
             EQ
Sbjct  162  VEQ  164



>ref|XP_006845640.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
 gb|ERN07315.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
Length=711

 Score =   174 bits (440),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 136/164 (83%), Gaps = 3/164 (2%)
 Frame = +1

Query  142  LLVFIWKRS-GDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +  F+W+RS G +S +V  V   K +   PE++A VDPGK KVT+FFGTQTGTAEGFAKA
Sbjct  59   VFFFVWRRSLGQKSGKVVEVN--KLVVVKPEQEAEVDPGKEKVTIFFGTQTGTAEGFAKA  116

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            LAEE +ARY+KA+ KVVD+DDYAADDD+YEEKL+KE +AFFM+ATYGDGEPTDNAARFYK
Sbjct  117  LAEEAKARYDKAIFKVVDLDDYAADDDEYEEKLRKEKIAFFMLATYGDGEPTDNAARFYK  176

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WF EG +R  WLQ + YG+FGLGNRQYEHFNK+ K +DEKL EQ
Sbjct  177  WFIEGNDRGIWLQNVKYGVFGLGNRQYEHFNKVAKQVDEKLFEQ  220



>gb|EPS67504.1| hypothetical protein M569_07270, partial [Genlisea aurea]
Length=710

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 125/167 (75%), Gaps = 6/167 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRSK----EVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            +LVF+W+R+   +K    E    V+ K    + EEDA     K ++++FFGTQTGTAEGF
Sbjct  58   VLVFMWRRAVGSAKAKDFEATKFVLSKGDEDEEEEDAGDG--KKRISIFFGTQTGTAEGF  115

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKA AEE RARY +A  KV+D+D+YA DD+QYEEKLKKE LA F +A+YGDGEPTDNA+R
Sbjct  116  AKAFAEEARARYPQATFKVIDLDEYADDDEQYEEKLKKEALAIFFLASYGDGEPTDNASR  175

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE  ER  WL+ L Y +FGLGNRQYEHFNKI KV+D+ L EQ
Sbjct  176  FYKWFTEDTERGEWLKNLQYAVFGLGNRQYEHFNKIAKVVDKILKEQ  222



>gb|AAB97737.1| NADPH cytochrome P450 reductase [Petroselinum crispum]
Length=699

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 124/162 (77%), Gaps = 0/162 (0%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
            LV +W+RS   +K  K +   K +    E +  VD GK KVT+F+GTQTGTAEGFAKALA
Sbjct  51   LVMMWRRSTTMTKSAKKLEPAKIVIPKFEMEEEVDDGKKKVTIFYGTQTGTAEGFAKALA  110

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            EE +ARY+ A+ K +D+DDYA DDD+YE KLKKE++ FF +ATYGDGEPTDNAARFYKWF
Sbjct  111  EEAKARYQDAIFKTIDLDDYAGDDDEYETKLKKESMVFFFLATYGDGEPTDNAARFYKWF  170

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
             EG+ER  WL  L YG+FGLGNRQYEHFNKI  V+D+ L EQ
Sbjct  171  CEGKERGEWLNNLQYGVFGLGNRQYEHFNKIAVVVDDGLVEQ  212



>ref|XP_006653834.1| PREDICTED: NADPH--cytochrome P450 reductase-like, partial [Oryza 
brachyantha]
Length=628

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  235  DAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYEEK  414
            DA  D G+ +VT+FFGTQTGTAEGFAKA+AEE RARYEKAV KVVD+DDYAA+D++YEEK
Sbjct  8    DADADDGRKRVTIFFGTQTGTAEGFAKAMAEEARARYEKAVFKVVDLDDYAAEDEEYEEK  67

Query  415  LKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNK  594
            L+KET+    +ATYGDGEPTDNAARFYKWFTEG+E+  WL+ L Y +FGLGNRQYEHFNK
Sbjct  68   LRKETVVLLFLATYGDGEPTDNAARFYKWFTEGKEKEVWLKDLKYAVFGLGNRQYEHFNK  127

Query  595  IGKVIDEKLSEQ  630
            + KV+DE L EQ
Sbjct  128  VAKVVDELLEEQ  139



>ref|XP_010526342.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Tarenaya 
hassleriana]
Length=716

 Score =   172 bits (435),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            +++ +W+RSG    + K V  PK +   P E   VD G+  VT+FFGTQTGTAEGFAKAL
Sbjct  69   VVLLVWRRSGTGGNKPKRVEPPKPLVLRPRE-VEVDDGRKMVTIFFGTQTGTAEGFAKAL  127

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARY+KA  KVVD++DYA +DD+Y +KLKKE +AFF +ATYGDGEPTDNAARFYKW
Sbjct  128  AEEAKARYDKARFKVVDLEDYAPEDDEYADKLKKEKIAFFFLATYGDGEPTDNAARFYKW  187

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG ++   ++ + YG+FGLGNRQYEHFNKI KV+DE L++Q
Sbjct  188  FTEGNDKGECVKDMKYGVFGLGNRQYEHFNKIAKVVDEMLADQ  230



>gb|AGO03799.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=709

 Score =   171 bits (433),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 134/169 (79%), Gaps = 10/169 (6%)
 Frame = +1

Query  142  LLVFIWKRSGDR----SKEVKP--VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAE  303
            ++V +W++S  +    +KEV+   +V+PK      E    VD GK KVT+ FGTQTGTAE
Sbjct  62   VVVLVWRKSFTKKSVVNKEVETMKIVLPKKEIKHEE----VDDGKKKVTILFGTQTGTAE  117

Query  304  GFAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNA  483
            GFAKAL EE + RYEKAV K +D+DDYAADD++YEEK KKE+LAFF +ATYGDGEPTDNA
Sbjct  118  GFAKALLEEAKVRYEKAVFKAIDLDDYAADDEEYEEKFKKESLAFFFLATYGDGEPTDNA  177

Query  484  ARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            ARFYKWFTEG+++  WL++L YG+FGLGNRQYEH+NKI  V+D+KL+EQ
Sbjct  178  ARFYKWFTEGDDKGEWLKKLQYGVFGLGNRQYEHYNKIAVVVDDKLAEQ  226



>ref|XP_002978784.1| hypothetical protein SELMODRAFT_152770 [Selaginella moellendorffii]
 gb|EFJ20231.1| hypothetical protein SELMODRAFT_152770 [Selaginella moellendorffii]
Length=627

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 113/138 (82%), Gaps = 5/138 (4%)
 Frame = +1

Query  223  DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYE--Kavvkvvdmddyaadd  396
            +PE+D   DP K KV+VFFGTQTGTAEGFAKA+ EE + RY+  K V+K+VD+D+YA +D
Sbjct  10   EPEDD---DPDKKKVSVFFGTQTGTAEGFAKAIVEEAKTRYDNSKVVLKLVDLDEYAPED  66

Query  397  dQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQ  576
            D YE+KL+KETL  F++ATYGDGEPTDNAARFYKWF EGEE+ PWL  L+Y +FGLGNRQ
Sbjct  67   DMYEQKLRKETLVIFVLATYGDGEPTDNAARFYKWFVEGEEKEPWLGNLSYAVFGLGNRQ  126

Query  577  YEHFNKIGKVIDEKLSEQ  630
            YEHFNK+   +DE L +Q
Sbjct  127  YEHFNKVAVEVDEALEKQ  144



>gb|AAC09468.2| putative NADPH-cytochrome P450 reductase [Pisum sativum]
Length=704

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 133/167 (80%), Gaps = 10/167 (6%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTAD-PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++V IW+RS   S + K + VPK +    PE D  VD GK KVTVFFGTQTGTAEGFAKA
Sbjct  58   VVVLIWRRSN--SNKSKQIEVPKLVIKKLPELD--VDDGKKKVTVFFGTQTGTAEGFAKA  113

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            +AEE +ARYEKA  +VVDMDDYAADDD+Y EKLK+ET+A F +ATYGDGEPTDNAARFYK
Sbjct  114  IAEEAKARYEKAKFRVVDMDDYAADDDEYLEKLKRETMALFFLATYGDGEPTDNAARFYK  173

Query  499  WFT---EGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFT   EGEE S   + L+YG+FGLGNRQYEHFNK+ KV+D+KL EQ
Sbjct  174  WFTEEYEGEEDS--FKNLSYGVFGLGNRQYEHFNKVAKVVDDKLLEQ  218



>ref|XP_004973052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=702

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 125/165 (76%), Gaps = 6/165 (4%)
 Frame = +1

Query  154  IWKRSGDRSKEVKPVVVPKAMTADPE------EDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +W+R+    K  + V V +A            ++A  D G+ KVTVFFGTQTGTAEGFAK
Sbjct  51   LWRRAAAGKKRKREVAVAEAAQVKARGAKGAADEAFADDGRKKVTVFFGTQTGTAEGFAK  110

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            +LAEE +ARY+KA+ KV D++DYAA+D++YEEKLKKE LA F VATYGDGEPTDNAARFY
Sbjct  111  SLAEEAKARYDKAIFKVADLEDYAAEDEEYEEKLKKEKLALFFVATYGDGEPTDNAARFY  170

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWFTEG ER  WL  L Y +FGLGNRQYEHFNK+ KV+DE L+EQ
Sbjct  171  KWFTEGNERGVWLSDLEYAVFGLGNRQYEHFNKVAKVVDELLTEQ  215



>ref|NP_001146345.1| uncharacterized protein LOC100279923 [Zea mays]
 gb|ACL53735.1| unknown [Zea mays]
Length=294

 Score =   164 bits (414),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 130/163 (80%), Gaps = 2/163 (1%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVP-KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++ +W RSG  +   KPV  P +      + DA VD G+ +VT+FFGTQTGTAEGFAK++
Sbjct  44   IIAVWFRSGGGTPS-KPVATPVRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSM  102

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE RARYEKAV KVVD+DDYA +D++YEEKLKKET+  F +ATYGDGEPTDNAARFYKW
Sbjct  103  AEEARARYEKAVFKVVDLDDYAQEDEEYEEKLKKETVVLFFLATYGDGEPTDNAARFYKW  162

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+E+  WL+ L YGIFGLGNRQYEHFNK+ KV+DE + EQ
Sbjct  163  FTEGKEKEVWLKDLKYGIFGLGNRQYEHFNKVAKVVDELVEEQ  205



>gb|EYU20907.1| hypothetical protein MIMGU_mgv1a002097mg [Erythranthe guttata]
Length=715

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTAD--PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            +V  W+R+G  +K  K  V P  +  +    E A +D GK KV+VFFGTQTGTAEGFAKA
Sbjct  66   VVLAWRRTGGSAK--KKQVEPSKLQVEKAAAEAAEIDDGKKKVSVFFGTQTGTAEGFAKA  123

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
             AEE +ARY++A  KV+D+DDYA DD+QYEEKLKKETLAFF +A+YGDGEPTDNAARFYK
Sbjct  124  FAEEAKARYQEANFKVIDLDDYAEDDEQYEEKLKKETLAFFFLASYGDGEPTDNAARFYK  183

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG ER  WL+ L YG+FGLGNRQYEHFNKI KV D+  +EQ
Sbjct  184  WFTEGNERGDWLKNLQYGMFGLGNRQYEHFNKIAKVADDIAAEQ  227



>gb|AIO11759.1| cytochrome p450 reductase [Croton stellatopilosus]
 emb|CDM63949.1| cytochrom p450 reductase [Croton stellatopilosus]
Length=711

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 125/165 (76%), Gaps = 7/165 (4%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTA---DPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +V++ +RS  +  +  P+V  K +     +PE D     G+  VT+ +GTQTGTAEGFAK
Sbjct  64   VVYVLRRSNVQKSKPPPIVPTKPLIVKELEPEPDD----GQKTVTILYGTQTGTAEGFAK  119

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            A AEE +ARYEKA  K+VD+DDYAADDD+YE KLKKE+L  F VATYGDGEPTDNAARFY
Sbjct  120  AFAEEGKARYEKAKFKIVDLDDYAADDDEYEMKLKKESLVLFFVATYGDGEPTDNAARFY  179

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWFTEG++R  WL+ L +G+FGLGN QYEHFNKI K +DE L+EQ
Sbjct  180  KWFTEGKDRGEWLRNLKFGVFGLGNVQYEHFNKIAKELDELLAEQ  224



>ref|XP_004960246.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Setaria 
italica]
Length=707

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = +1

Query  154  IWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEI  333
            +W RSG+ +         +      + DA VD G+ +VT+FFGTQTGTAEGFAK++AEE 
Sbjct  47   VWFRSGNGAPAKPAPTPVRPPPVKIDADADVDDGRKRVTIFFGTQTGTAEGFAKSMAEEA  106

Query  334  RARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG  513
            RARYEKAV KVVD+DDYA +D++YEEKLKKET+  F +ATYGDGEPTDNAARFYKWFTEG
Sbjct  107  RARYEKAVFKVVDLDDYAQEDEEYEEKLKKETVVLFFLATYGDGEPTDNAARFYKWFTEG  166

Query  514  EERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +E+  WL+ L +G+FGLGNRQYEHFNK+ KV+DE L EQ
Sbjct  167  KEKEVWLKDLKFGVFGLGNRQYEHFNKVAKVVDELLQEQ  205



>ref|XP_006372087.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
 gb|ERP49884.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
Length=466

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++V IW+RS    +   PV     +  D E +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  65   VVVLIWRRSSGYQRPKVPVPPKPLIVKDLEPE--VDDGKKKVTIFFGTQTGTAEGFAKAL  122

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARY+KA  K VD+DDYA DDD+YEEKLKKE L  F +ATYGDGEPTDNAARFYKW
Sbjct  123  AEEAKARYDKATFKTVDLDDYAGDDDEYEEKLKKEDLVIFFLATYGDGEPTDNAARFYKW  182

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG ER  WL+ L + +FGLGNRQYEHFNKI  V+D+  ++Q
Sbjct  183  FTEGNERGEWLKDLPFAVFGLGNRQYEHFNKIAIVVDKIFADQ  225



>ref|XP_004960247.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Setaria 
italica]
Length=694

 Score =   169 bits (427),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 102/159 (64%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = +1

Query  154  IWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEI  333
            +W RSG+ +         +      + DA VD G+ +VT+FFGTQTGTAEGFAK++AEE 
Sbjct  47   VWFRSGNGAPAKPAPTPVRPPPVKIDADADVDDGRKRVTIFFGTQTGTAEGFAKSMAEEA  106

Query  334  RARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEG  513
            RARYEKAV KVVD+DDYA +D++YEEKLKKET+  F +ATYGDGEPTDNAARFYKWFTEG
Sbjct  107  RARYEKAVFKVVDLDDYAQEDEEYEEKLKKETVVLFFLATYGDGEPTDNAARFYKWFTEG  166

Query  514  EERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +E+  WL+ L +G+FGLGNRQYEHFNK+ KV+DE L EQ
Sbjct  167  KEKEVWLKDLKFGVFGLGNRQYEHFNKVAKVVDELLQEQ  205



>ref|XP_011043963.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++V IW+RS    +   PV     +  D E +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  65   VVVLIWRRSSGYQRPKVPVPPKPLIVKDLEPE--VDDGKKKVTIFFGTQTGTAEGFAKAL  122

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARY+KA  K +D+DDYA DDD+YEEKLKKE L  F +ATYGDGEPTDNAARFYKW
Sbjct  123  AEEAKARYDKATFKTIDLDDYAVDDDEYEEKLKKENLVIFFLATYGDGEPTDNAARFYKW  182

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG ER  WL+ L Y +FGLGNRQYEHFNKI  V+D+  ++Q
Sbjct  183  FTEGNERGEWLKDLPYAVFGLGNRQYEHFNKIAIVVDKIFADQ  225



>ref|XP_002984697.1| hypothetical protein SELMODRAFT_234596 [Selaginella moellendorffii]
 gb|EFJ14342.1| hypothetical protein SELMODRAFT_234596 [Selaginella moellendorffii]
Length=627

 Score =   167 bits (424),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = +1

Query  247  DPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYE--KavvkvvdmddyaadddQYEEKLK  420
            DP K KV+VFFGTQTGTAEGFAKA+ EE + RY+  K V K+VD+D+YA +DD YE+KL+
Sbjct  15   DPDKKKVSVFFGTQTGTAEGFAKAIVEEAKTRYDNSKVVFKLVDLDEYAPEDDMYEQKLR  74

Query  421  KETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIG  600
            KETL  F++ATYGDGEPTDNAARFYKWF EGEE+ PWL  L+Y +FGLGNRQYEHFNK+ 
Sbjct  75   KETLVIFVMATYGDGEPTDNAARFYKWFVEGEEKEPWLGNLSYAVFGLGNRQYEHFNKVA  134

Query  601  KVIDEKLSEQ  630
              +DE L +Q
Sbjct  135  VEVDEALEKQ  144



>ref|XP_001785882.1| predicted protein [Physcomitrella patens]
 gb|EDQ49310.1| predicted protein [Physcomitrella patens]
Length=670

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 119/164 (73%), Gaps = 8/164 (5%)
 Frame = +1

Query  151  FIWKRSGDR-SKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAE  327
            FIW++ G++ + E KPVV       +  ED+ V     +VTVFFGTQTGTAEGFAKA+AE
Sbjct  23   FIWRQQGEKKAVETKPVVAKPVQLDEEFEDSSVK----RVTVFFGTQTGTAEGFAKAIAE  78

Query  328  EIRARYEKavvkvvdmddya--adddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            E ++RY+ + V    +D     ADD+QYE +LKKE+LA FMVATYGDGEPTDNAARFYKW
Sbjct  79   EAKSRYDSSSVVFKVVDLDDYGADDEQYEARLKKESLALFMVATYGDGEPTDNAARFYKW  138

Query  502  FTE-GEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            F E GE++   L  L Y +FGLGNRQYEHFNK+ K +DE L++Q
Sbjct  139  FVESGEDQQIGLDGLKYAVFGLGNRQYEHFNKVAKKVDEALTQQ  182



>gb|AAK15261.1|AF302498_1 NADPH-cytochrome P450 oxydoreductase isoform 3 [Populus trichocarpa 
x Populus deltoides]
Length=712

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++V IW+RS    +   PV     +  D E +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  65   VVVLIWRRSSGYQRPKVPVPPKPLIVKDLEPE--VDDGKKKVTIFFGTQTGTAEGFAKAL  122

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARY+KA  K VDMDDYA DDD+YEEKLKKE L  F +ATYGDGEPTDNAARFYKW
Sbjct  123  AEEAKARYDKATFKTVDMDDYAGDDDEYEEKLKKEDLVIFFLATYGDGEPTDNAARFYKW  182

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG ER  WL+ L Y +FGLGNRQYEHFNKI  V+D+  ++Q
Sbjct  183  FTEGNERGEWLKDLPYAVFGLGNRQYEHFNKIAIVVDKIFADQ  225



>ref|XP_006372088.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
 gb|ERP49885.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
Length=516

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++V IW+RS    +   PV     +  D E +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  65   VVVLIWRRSSGYQRPKVPVPPKPLIVKDLEPE--VDDGKKKVTIFFGTQTGTAEGFAKAL  122

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARY+KA  K VD+DDYA DDD+YEEKLKKE L  F +ATYGDGEPTDNAARFYKW
Sbjct  123  AEEAKARYDKATFKTVDLDDYAGDDDEYEEKLKKEDLVIFFLATYGDGEPTDNAARFYKW  182

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG ER  WL+ L + +FGLGNRQYEHFNKI  V+D+  ++Q
Sbjct  183  FTEGNERGEWLKDLPFAVFGLGNRQYEHFNKIAIVVDKIFADQ  225



>ref|XP_010913661.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Elaeis guineensis]
Length=706

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 134/163 (82%), Gaps = 1/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++VF+W+RS  + K  +PV  P+ +    + +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  57   VIVFVWRRSTGK-KASRPVEPPRPLVLKTDLEPEVDDGKKKVTIFFGTQTGTAEGFAKAL  115

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARY+KA  KVVD+D+YA DD++YEEK+KKETLA F +ATYGDGEPTDNAA+FY+W
Sbjct  116  AEEAKARYDKATFKVVDLDEYADDDEEYEEKMKKETLALFFLATYGDGEPTDNAAKFYRW  175

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+ER  W++ L Y +FGLGNRQYEHFNK+GKV+DE L++Q
Sbjct  176  FTEGKERENWVENLQYAVFGLGNRQYEHFNKVGKVVDEILADQ  218



>ref|XP_002324469.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|EEF03034.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++V IW+RS    +   PV     +  D E +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  65   VVVLIWRRSSGYQRPKVPVPPKPLIVKDLEPE--VDDGKKKVTIFFGTQTGTAEGFAKAL  122

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARY+KA  K VD+DDYA DDD+YEEKLKKE L  F +ATYGDGEPTDNAARFYKW
Sbjct  123  AEEAKARYDKATFKTVDLDDYAGDDDEYEEKLKKEDLVIFFLATYGDGEPTDNAARFYKW  182

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG ER  WL+ L + +FGLGNRQYEHFNKI  V+D+  ++Q
Sbjct  183  FTEGNERGEWLKDLPFAVFGLGNRQYEHFNKIAIVVDKIFADQ  225



>ref|XP_009384791.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   166 bits (420),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
             +F+W+RS  + K  KP    K ++   + +   D G+ KVT+FFGTQTGTAEGFAKALA
Sbjct  46   FIFLWRRSSVQ-KASKPAEPLKPLSVKVDREPEADYGRKKVTIFFGTQTGTAEGFAKALA  104

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            EE +ARY+KA  KVVD+DDYAADDD+YE+KLKKE LA F +ATYGDGEPTDNAARFYKWF
Sbjct  105  EEAKARYDKATFKVVDLDDYAADDDEYEDKLKKEPLALFFLATYGDGEPTDNAARFYKWF  164

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            TEG+E   WL+ L Y +FGLGNRQYEHFNK+ KV+DE L++Q
Sbjct  165  TEGKEHGNWLENLQYSVFGLGNRQYEHFNKVAKVVDEILADQ  206



>ref|XP_004957625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=705

 Score =   166 bits (420),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  214  MTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaad  393
            + A P+++   D G+ +VTVFFGTQTGTAEGFAKALAEE +ARY++AV KVVD+DDYAA+
Sbjct  79   LAAKPKDEPDPDDGRQRVTVFFGTQTGTAEGFAKALAEEAKARYDRAVFKVVDLDDYAAE  138

Query  394  ddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNR  573
            D++Y EKLKKE++A F +ATYGDGEPTDNAARFYKWF+EG ER  WL  L +G+FGLGNR
Sbjct  139  DEEYGEKLKKESIALFFLATYGDGEPTDNAARFYKWFSEGNERGEWLSNLQFGVFGLGNR  198

Query  574  QYEHFNKIGKVIDEKLSEQ  630
            QYEHFNKIGK++D+ L+EQ
Sbjct  199  QYEHFNKIGKMVDQLLAEQ  217



>ref|XP_008667833.1| PREDICTED: uncharacterized protein LOC100279923 isoform X1 [Zea 
mays]
 tpg|DAA35631.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=695

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 130/163 (80%), Gaps = 2/163 (1%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVP-KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++ +W RSG  +   KPV  P +      + DA VD G+ +VT+FFGTQTGTAEGFAK++
Sbjct  44   IIAVWFRSGGGTPS-KPVATPVRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSM  102

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE RARYEKAV KVVD+DDYA +D++YEEKLKKET+  F +ATYGDGEPTDNAARFYKW
Sbjct  103  AEEARARYEKAVFKVVDLDDYAQEDEEYEEKLKKETVVLFFLATYGDGEPTDNAARFYKW  162

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+E+  WL+ L YGIFGLGNRQYEHFNK+ KV+DE + EQ
Sbjct  163  FTEGKEKEVWLKDLKYGIFGLGNRQYEHFNKVAKVVDELVEEQ  205



>ref|XP_008667834.1| PREDICTED: uncharacterized protein LOC100279923 isoform X2 [Zea 
mays]
 tpg|DAA35632.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=694

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 130/163 (80%), Gaps = 2/163 (1%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVP-KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++ +W RSG  +   KPV  P +      + DA VD G+ +VT+FFGTQTGTAEGFAK++
Sbjct  44   IIAVWFRSGGGTPS-KPVATPVRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSM  102

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE RARYEKAV KVVD+DDYA +D++YEEKLKKET+  F +ATYGDGEPTDNAARFYKW
Sbjct  103  AEEARARYEKAVFKVVDLDDYAQEDEEYEEKLKKETVVLFFLATYGDGEPTDNAARFYKW  162

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FTEG+E+  WL+ L YGIFGLGNRQYEHFNK+ KV+DE + EQ
Sbjct  163  FTEGKEKEVWLKDLKYGIFGLGNRQYEHFNKVAKVVDELVEEQ  205



>gb|AAS90127.1| NADPH cytochrome P450 reductase [Ammi majus]
Length=681

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALA  324
            +V +W+RS  RS  VK V  PK +    E +  VD GK KVTVFFGTQTGTAEGFAKA A
Sbjct  36   VVLVWRRSSLRS--VKSVEPPKLIVPKVEIEDEVDDGKKKVTVFFGTQTGTAEGFAKAFA  93

Query  325  EEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWF  504
            EE +ARYEKA  +V+D+DDYAA+D++YEEK KKE+ AFF +ATYGDGEPTDNAARFYKWF
Sbjct  94   EEAKARYEKAKFRVIDLDDYAAEDEEYEEKFKKESFAFFFLATYGDGEPTDNAARFYKWF  153

Query  505  TEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            +EGEE+  WL +L YG+FGLGNRQYEHFNKI KV+D+ L++Q
Sbjct  154  SEGEEKGEWLNKLQYGVFGLGNRQYEHFNKIAKVVDDGLADQ  195



>gb|AHB33950.1| cytochrome P450 reductase [Santalum album]
Length=704

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 137/199 (69%), Gaps = 21/199 (11%)
 Frame = +1

Query  46   ELVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPV----VVPKA  213
            E+V +L ++L V +G                 +  ++W+ S  + K V       V  K 
Sbjct  39   EVVVALTTSLAVLIGC----------------VFAYLWRFSSSQ-KAVAAAKGVEVARKP  81

Query  214  MTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaad  393
            +     E A VD GK KVT+FFGTQTGTAEGFAKAL EE +ARYEKA+ K+VD+DDYAA+
Sbjct  82   VIGKESEAAEVDDGKKKVTIFFGTQTGTAEGFAKALVEEAKARYEKAIFKLVDLDDYAAE  141

Query  394  ddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNR  573
            DD+YEEKLKKE  A F +ATYGDGEPTDNAARFYKWFTE  E   WLQ+L +G+FGLGNR
Sbjct  142  DDEYEEKLKKEKFALFFLATYGDGEPTDNAARFYKWFTEENESGEWLQKLQFGVFGLGNR  201

Query  574  QYEHFNKIGKVIDEKLSEQ  630
            QYEHFNK+ KV+DE L+EQ
Sbjct  202  QYEHFNKVAKVVDEILAEQ  220



>ref|NP_001159331.1| uncharacterized protein LOC100304425 [Zea mays]
 gb|ACN25819.1| unknown [Zea mays]
 gb|ACN28051.1| unknown [Zea mays]
 gb|AFW59698.1| hypothetical protein ZEAMMB73_961001 [Zea mays]
Length=694

 Score =   164 bits (416),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = +1

Query  154  IWKRSGDRSKEVKPVVVP-KAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEE  330
            +W RSG  +   KPV  P +      + DA VD G+ +VT+FFGTQTGTAEGFAK++A+E
Sbjct  47   VWFRSGGGAPS-KPVATPLRPPPVKVDADADVDDGRKRVTIFFGTQTGTAEGFAKSMADE  105

Query  331  IRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTE  510
             R RYEKAV KVVD+DDYA +D++YEEKLKKET+A F +ATYGDGEPTDNAARFYKWFTE
Sbjct  106  ARVRYEKAVFKVVDLDDYAQEDEEYEEKLKKETVALFFLATYGDGEPTDNAARFYKWFTE  165

Query  511  GEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            G+E+  WL+ L YGIFGLGNRQYEHFNK+ KV+DE L EQ
Sbjct  166  GKEKEVWLKDLKYGIFGLGNRQYEHFNKVAKVVDELLEEQ  205



>ref|XP_002986144.1| hypothetical protein SELMODRAFT_157822 [Selaginella moellendorffii]
 gb|EFJ12675.1| hypothetical protein SELMODRAFT_157822 [Selaginella moellendorffii]
Length=674

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = +1

Query  157  WKRSGDRSKEV--KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEE  330
            W ++ D  K V   P VV   + A+ EE   +     KVTVFFGTQTGTAEGFAKAL EE
Sbjct  26   WWKAADAGKRVAEPPRVVTPIVEAEEEEADDLAGYTSKVTVFFGTQTGTAEGFAKALVEE  85

Query  331  IRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTE  510
             ++RY++ + K VD+D+YAADDD Y  +LKKE LA FM+ATYGDGEPTDNAARFYK+ TE
Sbjct  86   AKSRYDRVLFKAVDLDNYAADDDHYRLRLKKEKLAIFMLATYGDGEPTDNAARFYKFLTE  145

Query  511  G-EERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            G +ER  WL ++TY +FGLGNRQYE+FNK+GKV+DE+L +Q
Sbjct  146  GGDERGLWLNEMTYAVFGLGNRQYEYFNKVGKVVDEELEKQ  186



>gb|KCW80968.1| hypothetical protein EUGRSUZ_C02330 [Eucalyptus grandis]
Length=703

 Score =   163 bits (412),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 134/165 (81%), Gaps = 5/165 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEV--KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            ++VF+W+RS  +   +  +P   P A+  +PE +  VD GK KV +FFGTQTGTAEGFAK
Sbjct  64   VVVFVWRRSSAKKPRLGFEPPK-PPAVREEPEPE--VDDGKKKVAIFFGTQTGTAEGFAK  120

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            A+AEE +ARYEKAV KVVD+DDYAADD++YEEKLKKE LAFF +ATYGDGEPTDNAARFY
Sbjct  121  AMAEEAKARYEKAVFKVVDLDDYAADDEEYEEKLKKENLAFFFLATYGDGEPTDNAARFY  180

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWF EG+ER  WLQ L YG+FGLGNRQYEHFNK+ KV+DE  +EQ
Sbjct  181  KWFYEGKERGEWLQNLQYGVFGLGNRQYEHFNKVAKVVDEVFAEQ  225



>ref|XP_003541616.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 6/165 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTAD-PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
             +VFIW+RS   S + KP+  PK +    PE +  VD G  KVT+FFGTQTGTAEGFAKA
Sbjct  61   FVVFIWRRSS--SPKAKPLEPPKRVIEKLPEIE--VDDGTKKVTIFFGTQTGTAEGFAKA  116

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            +AEE +ARY+KA  +VVDMDDYAADDD+YEE+ KKET A F +ATYGDGEPTDNAARFYK
Sbjct  117  IAEEAKARYDKATFRVVDMDDYAADDDEYEERFKKETHALFFLATYGDGEPTDNAARFYK  176

Query  499  WFTEGEERSP-WLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG E+   WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L+EQ
Sbjct  177  WFTEGGEKGEGWLENLHYGVFGLGNRQYEHFNKVAKVVDDMLAEQ  221



>ref|XP_010048643.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Eucalyptus 
grandis]
 gb|KCW80967.1| hypothetical protein EUGRSUZ_C02330 [Eucalyptus grandis]
Length=711

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 134/165 (81%), Gaps = 5/165 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEV--KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            ++VF+W+RS  +   +  +P   P A+  +PE +  VD GK KV +FFGTQTGTAEGFAK
Sbjct  64   VVVFVWRRSSAKKPRLGFEPPK-PPAVREEPEPE--VDDGKKKVAIFFGTQTGTAEGFAK  120

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            A+AEE +ARYEKAV KVVD+DDYAADD++YEEKLKKE LAFF +ATYGDGEPTDNAARFY
Sbjct  121  AMAEEAKARYEKAVFKVVDLDDYAADDEEYEEKLKKENLAFFFLATYGDGEPTDNAARFY  180

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWF EG+ER  WLQ L YG+FGLGNRQYEHFNK+ KV+DE  +EQ
Sbjct  181  KWFYEGKERGEWLQNLQYGVFGLGNRQYEHFNKVAKVVDEVFAEQ  225



>gb|AGX85599.1| NADPH:cytochrome P450 reductase [Scoparia dulcis]
Length=713

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 137/167 (82%), Gaps = 8/167 (5%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKE--VKP--VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++V +W+++   +K+  V+P  +VVPK   A PEE+   D GK KVT+FFGTQTGTAEGF
Sbjct  63   VVVLVWRKTSGSAKKKAVEPPKLVVPKP-AAQPEEE---DDGKKKVTIFFGTQTGTAEGF  118

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALAEE +ARY +A  KVVD+DDYAA+D++YEEK+KKE +AFF +ATYGDGEPTDNAAR
Sbjct  119  AKALAEEAKARYSQAKFKVVDLDDYAAEDEEYEEKMKKENIAFFFLATYGDGEPTDNAAR  178

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTEG+ER  WL+ L YGIFGLGNRQYEHFNKI KV+D+ + EQ
Sbjct  179  FYKWFTEGKERGEWLKNLQYGIFGLGNRQYEHFNKIAKVVDDLILEQ  225



>ref|XP_002447240.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
 gb|EES11568.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
Length=694

 Score =   162 bits (410),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = +1

Query  253  GKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETL  432
            G+ +VT+FFGTQTGTAEGFAK++AEE RARYEKAV KVVD+DDYA +D++YEEKLKKET+
Sbjct  80   GRKRVTIFFGTQTGTAEGFAKSMAEEARARYEKAVFKVVDLDDYAQEDEEYEEKLKKETV  139

Query  433  AFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVID  612
              F +ATYGDGEPTDNAARFYKWFTEG+E+  WL+ L YGIFGLGNRQYEHFNK+ KV+D
Sbjct  140  VLFFLATYGDGEPTDNAARFYKWFTEGKEKEVWLKALKYGIFGLGNRQYEHFNKVAKVVD  199

Query  613  EKLSEQ  630
            E L EQ
Sbjct  200  ELLEEQ  205



>ref|XP_006381796.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|AAK15260.1|AF302497_1 NADPH-cytochrome P450 oxydoreductase isoform 2 [Populus trichocarpa 
x Populus deltoides]
 gb|ERP59593.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 126/163 (77%), Gaps = 2/163 (1%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKAL  321
            ++V IW+RS    K   PV     +  D E +  VD GK KVT+FFGTQTGTAEGFAKAL
Sbjct  65   VVVLIWRRSSGYQKPKVPVPPKPLIVKDLEPE--VDDGKKKVTIFFGTQTGTAEGFAKAL  122

Query  322  AEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKW  501
            AEE +ARYEKA+ K VD+DDYA DDD+YEEKLKKE+LA F +ATYGDGEPTDNAARFYKW
Sbjct  123  AEEAKARYEKAIFKTVDLDDYAEDDDEYEEKLKKESLAIFFLATYGDGEPTDNAARFYKW  182

Query  502  FTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FT+G ER  WL++L Y +FGLGNRQYEHFNKI  V+D+ L  Q
Sbjct  183  FTDGNERGEWLKELPYAVFGLGNRQYEHFNKIAIVVDKILGNQ  225



>ref|XP_002984958.1| hypothetical protein SELMODRAFT_181373 [Selaginella moellendorffii]
 gb|EFJ13833.1| hypothetical protein SELMODRAFT_181373 [Selaginella moellendorffii]
Length=680

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 121/161 (75%), Gaps = 3/161 (2%)
 Frame = +1

Query  157  WKRSGDRSKEV--KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEE  330
            W ++ D  K V   P VV   + A+ EE   +     KVTVFFGTQTGTAEGFAKAL EE
Sbjct  26   WWKAADAGKRVAEPPTVVTPIVEAEEEEADDLAGYTSKVTVFFGTQTGTAEGFAKALVEE  85

Query  331  IRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFTE  510
             ++RY++ + K VD+D+YAADDD Y  +LKKE LA FM+ATYGDGEPTDNAARFYK+ TE
Sbjct  86   AKSRYDRVLFKAVDLDNYAADDDHYRLRLKKEKLAIFMLATYGDGEPTDNAARFYKFLTE  145

Query  511  -GEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
             G+ER  WL ++TY +FGLGNRQYE+FNK+GK +DE+L +Q
Sbjct  146  GGDERGLWLNEMTYAVFGLGNRQYEYFNKVGKDVDEELEKQ  186



>ref|XP_003549436.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 128/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTAD-PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++VFIW+RS   S + KP+  PK +    PE +  VD G  KVT+ FGTQTGTAEGFAKA
Sbjct  61   VVVFIWRRSS--SPKAKPLEPPKRVVEKLPEIE--VDDGTKKVTILFGTQTGTAEGFAKA  116

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
             AEE +ARYEKA  +VVDMDDYAADDD+YEE+ KKET   F +ATYGDGEPTDNAARFYK
Sbjct  117  TAEEAKARYEKATFRVVDMDDYAADDDEYEERFKKETHVLFFLATYGDGEPTDNAARFYK  176

Query  499  WFTEGEERSP-WLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG E+   WLQ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  177  WFTEGGEKGEGWLQNLHYGVFGLGNRQYEHFNKVAKVVDDMLVEQ  221



>gb|KCW78708.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis]
Length=583

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +1

Query  139  GLLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            G + F W RSG  S++ +    PK +    E +   D GK KVT+FFGTQTGTAEGFAKA
Sbjct  36   GWVAFRWSRSG--SQKPRSFEPPKPLIVK-ETEPEADDGKKKVTIFFGTQTGTAEGFAKA  92

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            +AEE +ARYEKAV +VVD+DDYAADD++YEEKLKKETL  F +ATYGDGEPTDNAARFYK
Sbjct  93   MAEEAKARYEKAVFRVVDLDDYAADDEEYEEKLKKETLVIFFLATYGDGEPTDNAARFYK  152

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG ER  WLQ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  153  WFTEGNERGQWLQNLQYGVFGLGNRQYEHFNKVAKVVDDALVEQ  196



>gb|AEW43314.1| NADPH cytochrome P450 reductase [Picrorhiza kurrooa]
Length=710

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 136/167 (81%), Gaps = 7/167 (4%)
 Frame = +1

Query  139  GLLVFIWKRSGDRSKE-VKP--VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            G  VF+  R G + K+ V+P  +VVPK    +PEE   VD GK KVT+FFGTQTGTAEGF
Sbjct  60   GCAVFLALRGGKKKKKAVEPPKLVVPKG-PVEPEE---VDDGKKKVTIFFGTQTGTAEGF  115

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALAEE +ARY++A  KVVD+DDYAADD++YEEK+KKETLAFF +ATYGDGEPTDNAAR
Sbjct  116  AKALAEEAKARYQQAKFKVVDLDDYAADDEEYEEKMKKETLAFFFLATYGDGEPTDNAAR  175

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTEG+E+  WL+ L YGIFGLGNRQYEHFNKI  V+D+ ++ Q
Sbjct  176  FYKWFTEGKEKGDWLKNLQYGIFGLGNRQYEHFNKIALVVDDIITGQ  222



>gb|KCW78707.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis]
Length=626

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +1

Query  139  GLLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            G + F W RSG  S++ +    PK +    E +   D GK KVT+FFGTQTGTAEGFAKA
Sbjct  36   GWVAFRWSRSG--SQKPRSFEPPKPLIVK-ETEPEADDGKKKVTIFFGTQTGTAEGFAKA  92

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            +AEE +ARYEKAV +VVD+DDYAADD++YEEKLKKETL  F +ATYGDGEPTDNAARFYK
Sbjct  93   MAEEAKARYEKAVFRVVDLDDYAADDEEYEEKLKKETLVIFFLATYGDGEPTDNAARFYK  152

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG ER  WLQ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  153  WFTEGNERGQWLQNLQYGVFGLGNRQYEHFNKVAKVVDDALVEQ  196



>ref|XP_010046982.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Eucalyptus 
grandis]
 gb|KCW78706.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis]
Length=683

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +1

Query  139  GLLVFIWKRSGDRSKEVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            G + F W RSG  S++ +    PK +    E +   D GK KVT+FFGTQTGTAEGFAKA
Sbjct  36   GWVAFRWSRSG--SQKPRSFEPPKPLIVK-ETEPEADDGKKKVTIFFGTQTGTAEGFAKA  92

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            +AEE +ARYEKAV +VVD+DDYAADD++YEEKLKKETL  F +ATYGDGEPTDNAARFYK
Sbjct  93   MAEEAKARYEKAVFRVVDLDDYAADDEEYEEKLKKETLVIFFLATYGDGEPTDNAARFYK  152

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG ER  WLQ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  153  WFTEGNERGQWLQNLQYGVFGLGNRQYEHFNKVAKVVDDALVEQ  196



>gb|ACG27711.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=703

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  229  EEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYE  408
            EE+   D G+ KVTVFFGTQTGTAEGFAKALAEE ++RY+KA  KVVD+DDYAA+D++YE
Sbjct  83   EEEKPADDGRKKVTVFFGTQTGTAEGFAKALAEEAKSRYDKASFKVVDLDDYAAEDEEYE  142

Query  409  EKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHF  588
            EKLK+E LA F VATYGDGEPTDNAARFYKWFTEG ER  WL    Y +FGLGNRQYEHF
Sbjct  143  EKLKEEKLALFFVATYGDGEPTDNAARFYKWFTEGNERGVWLNDFEYAVFGLGNRQYEHF  202

Query  589  NKIGKVIDEKLSEQ  630
            NK+ KV+DE L+EQ
Sbjct  203  NKVAKVVDEILTEQ  216



>gb|KHN22700.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=707

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 129/162 (80%), Gaps = 6/162 (4%)
 Frame = +1

Query  151  FIWKRSGDRSKEVKPVVVPKAMTAD-PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAE  327
            FIW+RS   S + KP+  PK +    PE +  VD G  KVT+FFGTQTGTAEGFAKA+AE
Sbjct  64   FIWRRSS--SPKAKPLEPPKRVIEKLPEIE--VDDGTKKVTIFFGTQTGTAEGFAKAIAE  119

Query  328  EIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFT  507
            E +ARY+KA  +VVDMDDYAADDD+YEE+ KKET A F +ATYGDGEPTDNAARFYKWFT
Sbjct  120  EAKARYDKATFRVVDMDDYAADDDEYEERFKKETHALFFLATYGDGEPTDNAARFYKWFT  179

Query  508  EGEERSP-WLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            EG E+   WL+ L YG+FGLGNRQYEHFNK+ KV+D+ L+EQ
Sbjct  180  EGGEKGEGWLENLHYGVFGLGNRQYEHFNKVAKVVDDMLAEQ  221



>gb|EPS66345.1| hypothetical protein M569_08425 [Genlisea aurea]
Length=683

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 132/176 (75%), Gaps = 15/176 (9%)
 Frame = +1

Query  139  GLLVFI-WKR-SGDRSKEV---KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAE  303
            GL++F+ W++ SG  +K+    + +VVPK      E D   D G  KVT+F+GTQTGTAE
Sbjct  27   GLVIFLTWRKTSGSENKKAGQSQNIVVPKGKDDVEELD---DEGTKKVTIFYGTQTGTAE  83

Query  304  GFAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNA  483
            GFAKALAEE RARY++A  KVVD+DDY ADD++YEEK+KKE++A F +ATYGDGEPTDNA
Sbjct  84   GFAKALAEEARARYQQAKFKVVDLDDYGADDEEYEEKMKKESIALFFLATYGDGEPTDNA  143

Query  484  ARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNK-------IGKVIDEKLSEQ  630
            ARFYKWFTEG E+  WL+ L YG+FGLGNRQYEHFNK       I  V+D+ L EQ
Sbjct  144  ARFYKWFTEGNEKGEWLKNLHYGVFGLGNRQYEHFNKVFRHTRQIALVVDKILDEQ  199



>gb|EYU42400.1| hypothetical protein MIMGU_mgv1a002170mg [Erythranthe guttata]
Length=705

 Score =   160 bits (404),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 134/168 (80%), Gaps = 10/168 (6%)
 Frame = +1

Query  139  GLLVFI-WKRSGDRSK---EVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEG  306
            G LVF+ W+R+G   K   E+  +VVPKA   +PEE   VD GK KVT+F+GTQTGTAEG
Sbjct  60   GCLVFLMWRRAGSAKKKAVELPKLVVPKA---EPEE---VDDGKKKVTIFYGTQTGTAEG  113

Query  307  FAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAA  486
            FAKALAEE +ARY++A  KV+D+DDYAADD++YEEK+KKE L FF +ATYGDGEPTDNAA
Sbjct  114  FAKALAEEAKARYQQAKFKVIDLDDYAADDEEYEEKMKKENLVFFFLATYGDGEPTDNAA  173

Query  487  RFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            RFYKWF EG+ER  WL+ L YG+FGLGNRQYEHFNKI   +D  ++EQ
Sbjct  174  RFYKWFIEGKERGDWLKNLQYGVFGLGNRQYEHFNKIAIEVDNIVTEQ  221



>ref|XP_011069915.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=712

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 138/167 (83%), Gaps = 8/167 (5%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKE--VKP--VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++V IW+R+   +K+  V+P  +VV KA  A+PEE   VD G+ KVT+FFGTQTGTAEGF
Sbjct  62   VVVLIWRRAAGSAKKKVVEPPKLVVAKA-PAEPEE---VDDGRKKVTIFFGTQTGTAEGF  117

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKALAEE +ARY++A  KVVD+DDYAADD++YEEK+KKETLAFF +ATYGDGEPTDNAAR
Sbjct  118  AKALAEEAKARYQQAKFKVVDLDDYAADDEEYEEKMKKETLAFFFLATYGDGEPTDNAAR  177

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTE ++R  WL+ L YG+FGLGNRQYEHFNKI  V+D+  +EQ
Sbjct  178  FYKWFTEEKDRGDWLKNLQYGVFGLGNRQYEHFNKIAIVVDKIFAEQ  224



>gb|AAZ39649.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=715

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 133/165 (81%), Gaps = 7/165 (4%)
 Frame = +1

Query  145  LVFIWKRSGDRSKEV---KPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +V I +RS   +K+V     +VVPK++    E    +D GK KVT+FFGTQTGTAEGFAK
Sbjct  67   VVLIMRRSSTSAKKVVDPPKLVVPKSVMETEE----IDDGKKKVTIFFGTQTGTAEGFAK  122

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALAEE +ARY+KAV KV+DMDDYAADD++YEEKLKKETLAFF +ATYGDGEPTDNAARFY
Sbjct  123  ALAEEAKARYDKAVFKVIDMDDYAADDEEYEEKLKKETLAFFFLATYGDGEPTDNAARFY  182

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWF EG+ER  + + L YG+FGLGNRQYEHFNKI  V+DE L+EQ
Sbjct  183  KWFVEGKERGDYFKNLQYGVFGLGNRQYEHFNKIANVVDELLAEQ  227



>ref|XP_003610109.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES92306.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=701

 Score =   159 bits (403),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 130/164 (79%), Gaps = 5/164 (3%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTAD-PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++V IW+RS   S++ KP+ VPK +    PE +  +D G  KVTVFFGTQTGTAEGFAKA
Sbjct  56   VVVLIWRRSN--SQKPKPIEVPKRVIEKLPELE--IDDGTKKVTVFFGTQTGTAEGFAKA  111

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            +AEE +ARYEKA  KVVDMDDYAADDD+YEEKLKKET+A F +ATYGDGEPTDNAARFYK
Sbjct  112  IAEEAKARYEKAKFKVVDMDDYAADDDEYEEKLKKETMALFFLATYGDGEPTDNAARFYK  171

Query  499  WFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WF E E      + L YG+FGLGNRQYEHFNK+ K++D+KL E+
Sbjct  172  WFEEFEGEEDSFKNLQYGVFGLGNRQYEHFNKVAKIVDDKLLEK  215



>ref|XP_004242931.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=715

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 135/165 (82%), Gaps = 7/165 (4%)
 Frame = +1

Query  145  LVFIWKRSGDRSK---EVKPVVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            +V +W+RS   ++   E+  +VVPK++  +PEE   +D GK K+ +FFGTQTGTAEGFAK
Sbjct  68   VVLMWRRSSTSARKVVELPKLVVPKSVV-EPEE---IDDGKKKIAIFFGTQTGTAEGFAK  123

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALAEE +ARYEKA+ KV+DMDDYAADD++YEEKLKKE LAFF +ATYGDGEPTDNAARFY
Sbjct  124  ALAEEAKARYEKAIFKVIDMDDYAADDEEYEEKLKKEKLAFFFLATYGDGEPTDNAARFY  183

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWF EG+ER    + L YG+FGLGNRQYEHFNKI KV+DE L+EQ
Sbjct  184  KWFEEGKERGDCFKNLQYGVFGLGNRQYEHFNKIAKVVDELLAEQ  228



>ref|XP_003578634.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=697

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 125/165 (76%), Gaps = 1/165 (1%)
 Frame = +1

Query  139  GLLVFIWKRSGDRSKEVKPVVVPKAMTADP-EEDAVVDPGKVKVTVFFGTQTGTAEGFAK  315
            G  V ++ R    +   +P    + + A   E++   D G+++V VFFGTQTGTAEGFAK
Sbjct  45   GCGVALFLRRSSSAAGPQPATASRPLAAKAREKEPDPDDGRLRVAVFFGTQTGTAEGFAK  104

Query  316  ALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFY  495
            ALAEE +ARY+KAV KVVD+DDYAA+DD Y EKLKKE +A F +ATYGDGEPTDNAARFY
Sbjct  105  ALAEEAKARYDKAVFKVVDLDDYAAEDDDYAEKLKKEIIALFFLATYGDGEPTDNAARFY  164

Query  496  KWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            KWF+EG ER  WL  L + +FGLGNRQYEHFNKIGKV+D+ LSEQ
Sbjct  165  KWFSEGNERGEWLSNLRFAVFGLGNRQYEHFNKIGKVVDQLLSEQ  209



>gb|AGC92176.1| cytochrome P450 oxidoreductase [Ocimum basilicum]
Length=707

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 134/167 (80%), Gaps = 9/167 (5%)
 Frame = +1

Query  142  LLVFIWKRSGDRS--KEVKP--VVVPKAMTADPEEDAVVDPGKVKVTVFFGTQTGTAEGF  309
            ++V  W+R+   +  K+ +P  +VVPKA  A+ EE   VD  K KV++FFGTQTGTAEGF
Sbjct  58   VVVLAWRRTAGSATKKQFEPPKLVVPKA--AELEE---VDDDKPKVSIFFGTQTGTAEGF  112

Query  310  AKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAAR  489
            AKA AEE +ARY +A  KV+D+DDYAADDD+YEEKLKKETLAFF +A+YGDGEPTDNAAR
Sbjct  113  AKAFAEEAKARYPQANFKVIDLDDYAADDDEYEEKLKKETLAFFFLASYGDGEPTDNAAR  172

Query  490  FYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            FYKWFTEG++R  WL+ L YG+FGLGNRQYEHFNKI  V+++ + EQ
Sbjct  173  FYKWFTEGKDRGDWLKNLQYGVFGLGNRQYEHFNKIAIVVNDIIVEQ  219



>gb|KHN17598.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=715

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 125/162 (77%), Gaps = 6/162 (4%)
 Frame = +1

Query  151  FIWKRSGDRSKEVKPVVVPKAMTAD-PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAE  327
            FIW+RS   S + KP+  PK +    PE +  VD G  KVT+ FGTQTGTAEGFAKA AE
Sbjct  72   FIWRRSS--SPKAKPLEPPKRVIEKLPEIE--VDDGTKKVTILFGTQTGTAEGFAKATAE  127

Query  328  EIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYKWFT  507
            E +ARYEKA  +VVDMDDYAADDD+YEE+ KKET   F +ATYGDGEPTDNAARFYKWFT
Sbjct  128  EAKARYEKATFRVVDMDDYAADDDEYEERFKKETHVLFFLATYGDGEPTDNAARFYKWFT  187

Query  508  EGEERSP-WLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            EG E+   WLQ L YG+FGLGNRQYEHFNK+ KV+D+ L EQ
Sbjct  188  EGGEKGEGWLQNLHYGVFGLGNRQYEHFNKVAKVVDDMLVEQ  229



>dbj|BAJ99370.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  253  GKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETL  432
            G+ +VT+FFGTQTGTAEGFAKA+AEE +ARYEKAV KVVD+DDYAA+DD+YEEKLKKET 
Sbjct  28   GRKRVTIFFGTQTGTAEGFAKAMAEEAKARYEKAVFKVVDLDDYAAEDDEYEEKLKKETF  87

Query  433  AFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVID  612
            A F +ATYGDGEPTDNAARFYKWFTEG+E+  WL+   Y +FGLGNRQYEHFNK+ K +D
Sbjct  88   ALFFLATYGDGEPTDNAARFYKWFTEGKEKEVWLKDFNYAVFGLGNRQYEHFNKVAKEVD  147

Query  613  EKLSEQ  630
            E L EQ
Sbjct  148  ELLLEQ  153



>ref|XP_006661531.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Oryza brachyantha]
Length=642

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 111/130 (85%), Gaps = 2/130 (2%)
 Frame = +1

Query  247  DP--GKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLK  420
            DP  G+ +V VFFGTQTGTAEGFAKALAEE +ARY+KAV KV+D+D+YAA+D+ +E KLK
Sbjct  25   DPHDGRQRVAVFFGTQTGTAEGFAKALAEEAKARYDKAVFKVLDLDEYAAEDEDFEHKLK  84

Query  421  KETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIG  600
            KE +A F +ATYGDGEPTDNAARFYKWF EG ER  WL  L +G+FGLGNRQYEHFNK+G
Sbjct  85   KENIALFFLATYGDGEPTDNAARFYKWFAEGNERGEWLSNLRFGVFGLGNRQYEHFNKVG  144

Query  601  KVIDEKLSEQ  630
            KV+D+ L+EQ
Sbjct  145  KVVDQLLAEQ  154



>ref|XP_008676669.1| PREDICTED: uncharacterized protein LOC100216882 isoform X1 [Zea 
mays]
 gb|AFW62053.1| hypothetical protein ZEAMMB73_790468 [Zea mays]
Length=702

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 111/134 (83%), Gaps = 1/134 (1%)
 Frame = +1

Query  229  EEDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYE  408
            EE+   D G+ KVTVFFGTQTGT+EGFAKALAEE ++RY+KA  KVVD+DDYAA+D++  
Sbjct  83   EEEKPADDGRKKVTVFFGTQTGTSEGFAKALAEEAKSRYDKASFKVVDLDDYAAEDEE-Y  141

Query  409  EKLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHF  588
            EKLKKE LA F VATYGDGEPTDNAARFYKWFTEG ER  WL    Y +FGLGNRQYEHF
Sbjct  142  EKLKKEKLALFFVATYGDGEPTDNAARFYKWFTEGNERGVWLNDFEYAVFGLGNRQYEHF  201

Query  589  NKIGKVIDEKLSEQ  630
            NK+ KV+DE L+EQ
Sbjct  202  NKVAKVVDEILTEQ  215



>dbj|BAJ41268.1| NADPH-P450 reductase 1 [Zingiber officinale]
Length=703

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = +1

Query  232  EDAVVDPGKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYEE  411
            EDA  D GK KVT+FFG+QTGTAE FAK LA+E  ARY+K V KVVD+DDYA ++ +YEE
Sbjct  85   EDA--DFGKKKVTLFFGSQTGTAERFAKTLADEANARYKKVVFKVVDLDDYAFENHEYEE  142

Query  412  KLKKETLAFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFN  591
            KLKKETL  F +ATYGDGEPTDNAARFYKWF E +ER+ +L  L + +FGLG+RQYEHFN
Sbjct  143  KLKKETLGLFFLATYGDGEPTDNAARFYKWFFEAKERNVYLDNLQFAVFGLGSRQYEHFN  202

Query  592  KIGKVIDEKLSEQ  630
            K+G  +D  L+EQ
Sbjct  203  KVGIEVDRILAEQ  215



>gb|AAG17471.1|AF123610_10 NADPH-cytochrome P450 reductase [Triticum aestivum]
Length=656

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  253  GKVKVTVFFGTQTGTAEGFAKALAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETL  432
            G+ +VT+FFGTQTGTAEGFAKA+AEE +ARYEK + KVVD+DDYAA+DD+YEEKLKKET 
Sbjct  42   GRKRVTIFFGTQTGTAEGFAKAMAEEAKARYEKVLFKVVDLDDYAAEDDEYEEKLKKETF  101

Query  433  AFFMVATYGDGEPTDNAARFYKWFTEGEERSPWLQQLTYGIFGLGNRQYEHFNKIGKVID  612
            A F +ATYGDGEPTDNAARFYKWFTEG+E+  WL+   Y +FGLGNRQYEHFNK+ K +D
Sbjct  102  ALFFLATYGDGEPTDNAARFYKWFTEGKEKEVWLKDFNYAVFGLGNRQYEHFNKVAKEVD  161

Query  613  EKLSEQ  630
            E L EQ
Sbjct  162  ELLLEQ  167



>ref|XP_004507857.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Cicer 
arietinum]
Length=715

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTAD-PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++V IW+RS   +++ KP+ VPK +    PE D  VD G  KVTV FGTQTGTAEGFAKA
Sbjct  58   VVVLIWRRSN--AQKSKPIEVPKRIIDKLPELD--VDDGTKKVTVLFGTQTGTAEGFAKA  113

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            +AEE +ARY+KA  +VVDMDDYAADDD+YEEK KKET+  F +ATYGDGEPTDNAARFYK
Sbjct  114  IAEEAKARYDKAKFRVVDMDDYAADDDEYEEKFKKETVIIFFLATYGDGEPTDNAARFYK  173

Query  499  WFTEGEERS-PWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG E      + L YG+FGLGNRQYEHFNK+ KV+D+ L+E+
Sbjct  174  WFTEGNEGGEESFKNLQYGVFGLGNRQYEHFNKVAKVVDDMLAEK  218



>ref|XP_004507858.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=705

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 129/165 (78%), Gaps = 6/165 (4%)
 Frame = +1

Query  142  LLVFIWKRSGDRSKEVKPVVVPKAMTAD-PEEDAVVDPGKVKVTVFFGTQTGTAEGFAKA  318
            ++V IW+RS   +++ KP+ VPK +    PE D  VD G  KVTV FGTQTGTAEGFAKA
Sbjct  58   VVVLIWRRSN--AQKSKPIEVPKRIIDKLPELD--VDDGTKKVTVLFGTQTGTAEGFAKA  113

Query  319  LAEEIRARYEKavvkvvdmddyaadddQYEEKLKKETLAFFMVATYGDGEPTDNAARFYK  498
            +AEE +ARY+KA  +VVDMDDYAADDD+YEEK KKET+  F +ATYGDGEPTDNAARFYK
Sbjct  114  IAEEAKARYDKAKFRVVDMDDYAADDDEYEEKFKKETVIIFFLATYGDGEPTDNAARFYK  173

Query  499  WFTEGEERS-PWLQQLTYGIFGLGNRQYEHFNKIGKVIDEKLSEQ  630
            WFTEG E      + L YG+FGLGNRQYEHFNK+ KV+D+ L+E+
Sbjct  174  WFTEGNEGGEESFKNLQYGVFGLGNRQYEHFNKVAKVVDDMLAEK  218



Lambda      K        H        a         alpha
   0.314    0.133    0.379    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875