BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF043F24

Length=644
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794279.1|  PREDICTED: hydroxyphenylpyruvate reductase         271   5e-86   Nicotiana sylvestris
ref|XP_009588864.1|  PREDICTED: hydroxyphenylpyruvate reductase         269   5e-85   Nicotiana tomentosiformis
ref|XP_004250408.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    258   6e-81   Solanum lycopersicum
ref|XP_006361376.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    258   8e-81   Solanum tuberosum [potatoes]
emb|CDP16491.1|  unnamed protein product                                255   2e-79   Coffea canephora [robusta coffee]
ref|XP_010317839.1|  PREDICTED: formate dehydrogenase, mitochondr...    244   2e-76   
ref|XP_002319339.2|  hypothetical protein POPTR_0013s10050g             243   6e-75   Populus trichocarpa [western balsam poplar]
gb|EYU28234.1|  hypothetical protein MIMGU_mgv1a007209mg                244   6e-75   Erythranthe guttata [common monkey flower]
ref|XP_010665338.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    241   2e-74   Vitis vinifera
ref|XP_008218923.1|  PREDICTED: formate dehydrogenase, mitochondr...    241   2e-74   
ref|XP_008218920.1|  PREDICTED: formate dehydrogenase, mitochondr...    241   2e-74   Prunus mume [ume]
ref|XP_008218922.1|  PREDICTED: formate dehydrogenase, mitochondr...    241   2e-74   Prunus mume [ume]
ref|XP_008218915.1|  PREDICTED: formate dehydrogenase, mitochondr...    240   2e-74   Prunus mume [ume]
ref|XP_010665337.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    240   3e-74   Vitis vinifera
ref|XP_008218916.1|  PREDICTED: formate dehydrogenase, mitochondr...    240   3e-74   
ref|XP_002282092.2|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    241   3e-74   Vitis vinifera
ref|XP_011003972.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    240   5e-74   Populus euphratica
ref|XP_011003977.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    239   7e-74   Populus euphratica
ref|XP_007015902.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    238   8e-74   
ref|XP_007223301.1|  hypothetical protein PRUPE_ppa007293mg             239   9e-74   Prunus persica
ref|XP_011003976.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    239   1e-73   Populus euphratica
ref|XP_007015900.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    238   1e-73   
ref|XP_011003975.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    239   1e-73   Populus euphratica
ref|XP_011003974.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    239   1e-73   Populus euphratica
ref|XP_011003971.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    239   1e-73   Populus euphratica
gb|ABK96037.1|  unknown                                                 237   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_011003978.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    236   4e-73   Populus euphratica
ref|XP_007015899.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    238   5e-73   
ref|XP_007015901.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    238   6e-73   
ref|XP_010665339.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    236   7e-73   Vitis vinifera
ref|XP_010243882.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    236   4e-72   Nelumbo nucifera [Indian lotus]
ref|XP_010910119.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    234   5e-72   Elaeis guineensis
gb|KHG10814.1|  Glyoxylate reductase                                    234   2e-71   Gossypium arboreum [tree cotton]
ref|XP_010910114.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    234   2e-71   Elaeis guineensis
ref|XP_010243885.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    232   4e-71   Nelumbo nucifera [Indian lotus]
gb|KJB55666.1|  hypothetical protein B456_009G087500                    231   5e-71   Gossypium raimondii
gb|KJB55660.1|  hypothetical protein B456_009G087500                    231   5e-71   Gossypium raimondii
ref|XP_008218917.1|  PREDICTED: formate dehydrogenase, mitochondr...    231   6e-71   Prunus mume [ume]
ref|XP_011074952.1|  PREDICTED: formate dehydrogenase, mitochondrial    233   6e-71   Sesamum indicum [beniseed]
gb|KJB55664.1|  hypothetical protein B456_009G087500                    231   1e-70   Gossypium raimondii
ref|XP_010095912.1|  Retrovirus-related Pol polyprotein from tran...    229   8e-70   
ref|XP_011457341.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    224   3e-68   Fragaria vesca subsp. vesca
ref|XP_007015898.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    223   8e-68   
gb|KCW70960.1|  hypothetical protein EUGRSUZ_F04070                     220   9e-68   Eucalyptus grandis [rose gum]
gb|KDO56056.1|  hypothetical protein CISIN_1g0174901mg                  218   9e-68   Citrus sinensis [apfelsine]
gb|KDO56053.1|  hypothetical protein CISIN_1g0174901mg                  219   1e-67   Citrus sinensis [apfelsine]
ref|XP_007015897.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    223   1e-67   
gb|KDO56054.1|  hypothetical protein CISIN_1g0174901mg                  219   1e-67   Citrus sinensis [apfelsine]
gb|KCW70956.1|  hypothetical protein EUGRSUZ_F04070                     220   1e-67   Eucalyptus grandis [rose gum]
ref|XP_008802910.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    222   2e-67   Phoenix dactylifera
ref|XP_006441524.1|  hypothetical protein CICLE_v10020311mg             219   4e-67   
ref|XP_006441523.1|  hypothetical protein CICLE_v10020311mg             219   4e-67   
ref|XP_010535279.1|  PREDICTED: formate dehydrogenase, mitochondrial    222   5e-67   Tarenaya hassleriana [spider flower]
ref|XP_002521771.1|  phosphoglycerate dehydrogenase, putative           222   6e-67   Ricinus communis
ref|XP_008667394.1|  PREDICTED: uncharacterized protein LOC100217...    221   9e-67   Zea mays [maize]
ref|XP_008802909.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    221   1e-66   Phoenix dactylifera
ref|XP_010063709.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    220   1e-66   Eucalyptus grandis [rose gum]
gb|KDO56049.1|  hypothetical protein CISIN_1g0174901mg                  220   1e-66   Citrus sinensis [apfelsine]
ref|XP_010063710.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    219   2e-66   Eucalyptus grandis [rose gum]
ref|XP_006441520.1|  hypothetical protein CICLE_v10020311mg             219   2e-66   
ref|XP_004499721.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    220   3e-66   Cicer arietinum [garbanzo]
gb|KDO56050.1|  hypothetical protein CISIN_1g0174901mg                  218   3e-66   Citrus sinensis [apfelsine]
ref|XP_006478175.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    219   4e-66   
tpg|DAA39792.1|  TPA: hypothetical protein ZEAMMB73_065837              220   4e-66   
ref|XP_008667393.1|  PREDICTED: uncharacterized protein LOC100217...    221   5e-66   
gb|AFK43325.1|  unknown                                                 219   5e-66   Medicago truncatula
ref|XP_004499720.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    219   5e-66   
ref|XP_003598073.1|  D-3-phosphoglycerate dehydrogenase                 219   6e-66   Medicago truncatula
ref|XP_006441517.1|  hypothetical protein CICLE_v10020311mg             218   6e-66   Citrus clementina [clementine]
ref|XP_006390689.1|  hypothetical protein EUTSA_v10018793mg             218   6e-66   
ref|XP_006478176.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    218   8e-66   Citrus sinensis [apfelsine]
ref|XP_004161907.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    217   1e-65   
gb|AAG51802.1|AC067754_18  phosphoglycerate dehydrogenase, putati...    218   1e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001137068.1|  uncharacterized protein LOC100217241               218   2e-65   Zea mays [maize]
ref|NP_177364.2|  D-isomer specific 2-hydroxyacid dehydrogenase d...    218   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006478173.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    219   2e-65   Citrus sinensis [apfelsine]
ref|XP_006441521.1|  hypothetical protein CICLE_v10020311mg             219   2e-65   Citrus clementina [clementine]
ref|XP_006478174.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    219   2e-65   
ref|XP_006441518.1|  hypothetical protein CICLE_v10020311mg             219   2e-65   Citrus clementina [clementine]
ref|XP_006577809.1|  PREDICTED: uncharacterized protein LOC100785...    217   2e-65   Glycine max [soybeans]
ref|XP_002888861.1|  oxidoreductase family protein                      218   2e-65   
ref|XP_008667395.1|  PREDICTED: uncharacterized protein LOC100217...    216   4e-65   Zea mays [maize]
gb|KHN24796.1|  D-3-phosphoglycerate dehydrogenase                      217   6e-65   Glycine soja [wild soybean]
ref|XP_008461934.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    215   6e-65   Cucumis melo [Oriental melon]
gb|KDP31626.1|  hypothetical protein JCGZ_14851                         216   6e-65   Jatropha curcas
ref|XP_008461933.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    215   1e-64   
ref|NP_001242647.1|  uncharacterized protein LOC100785085               216   1e-64   Glycine max [soybeans]
ref|XP_002459676.1|  hypothetical protein SORBIDRAFT_02g008660          216   1e-64   Sorghum bicolor [broomcorn]
gb|KJB55658.1|  hypothetical protein B456_009G087500                    215   1e-64   Gossypium raimondii
gb|KJB55663.1|  hypothetical protein B456_009G087500                    214   4e-64   Gossypium raimondii
tpg|DAA39795.1|  TPA: hypothetical protein ZEAMMB73_065837              214   5e-64   
ref|XP_003557318.1|  PREDICTED: glyoxylate/hydroxypyruvate reduct...    214   6e-64   Brachypodium distachyon [annual false brome]
ref|XP_010474292.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    211   6e-64   
ref|XP_007148628.1|  hypothetical protein PHAVU_005G002200g             213   1e-63   Phaseolus vulgaris [French bean]
ref|XP_004984235.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    212   1e-63   
gb|EEC81831.1|  hypothetical protein OsI_25581                          213   2e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_009379261.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    213   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_007015896.1|  D-isomer specific 2-hydroxyacid dehydrogenas...    213   2e-63   
ref|XP_009379254.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    213   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_008378743.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase      213   3e-63   
gb|AER41609.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    212   3e-63   Oryza glaberrima
ref|XP_009393478.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    211   8e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010428086.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    211   8e-63   Camelina sativa [gold-of-pleasure]
dbj|BAD31969.1|  phosphoglycerate dehydrogenase-like protein            210   9e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393479.1|  PREDICTED: formate dehydrogenase, mitochondr...    210   1e-62   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK41640.1|  hypothetical protein AALP_AA2G154000                    210   2e-62   Arabis alpina [alpine rockcress]
ref|NP_001059330.1|  Os07g0264100                                       210   2e-62   
ref|XP_010414841.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    209   5e-62   Camelina sativa [gold-of-pleasure]
ref|XP_006301744.1|  hypothetical protein CARUB_v10022205mg             209   6e-62   
ref|XP_010471237.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    206   5e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010415950.1|  PREDICTED: LOW QUALITY PROTEIN: glyoxylate r...    204   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010683411.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    202   5e-60   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT11768.1|  Glyoxylate reductase                                    203   6e-60   
gb|EMS56366.1|  Glyoxylate reductase                                    203   6e-60   Triticum urartu
dbj|BAK03270.1|  predicted protein                                      202   7e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK05235.1|  predicted protein                                      202   7e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02358.1|  predicted protein                                      202   7e-60   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006657609.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    202   9e-60   
dbj|BAK00574.1|  predicted protein                                      202   3e-59   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004963884.1|  PREDICTED: formate dehydrogenase 1, mitochon...    205   8e-59   
emb|CDX68275.1|  BnaA07g23150D                                          200   2e-58   
emb|CDY50445.1|  BnaC06g24190D                                          199   3e-58   Brassica napus [oilseed rape]
gb|EPS66269.1|  hypothetical protein M569_08508                         198   4e-58   Genlisea aurea
ref|XP_009104868.1|  PREDICTED: formate dehydrogenase, mitochondr...    197   1e-57   Brassica rapa
ref|XP_009104867.1|  PREDICTED: formate dehydrogenase, mitochondr...    197   1e-57   Brassica rapa
ref|XP_006858573.1|  hypothetical protein AMTR_s00071p00183090          191   5e-55   
gb|ABR18201.1|  unknown                                                 186   2e-53   Picea sitchensis
ref|XP_009379247.1|  PREDICTED: glyoxylate reductase/hydroxypyruv...    186   3e-53   Pyrus x bretschneideri [bai li]
ref|XP_006858572.1|  hypothetical protein AMTR_s00071p00182560          184   7e-53   
emb|CAN70397.1|  hypothetical protein VITISV_016521                     177   7e-51   Vitis vinifera
ref|XP_001766047.1|  predicted protein                                  176   6e-50   
ref|XP_002459677.1|  hypothetical protein SORBIDRAFT_02g008670          174   7e-49   
gb|KGN44470.1|  hypothetical protein Csa_7G302340                       172   2e-48   Cucumis sativus [cucumbers]
ref|XP_010683622.1|  PREDICTED: formate dehydrogenase 2, mitochon...    167   9e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001767463.1|  predicted protein                                  165   2e-45   
dbj|BAC22329.1|  putative phosphoglycerate dehydrogenase                150   3e-40   Oryza sativa Japonica Group [Japonica rice]
gb|AER41584.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    152   4e-40   Oryza brachyantha
gb|AER41608.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    150   6e-40   Oryza glaberrima
gb|AER41626.1|  erythronate-4-phosphate+dehydrogenase+domain+cont...    150   8e-40   Oryza glumipatula
ref|XP_004139684.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...    143   9e-38   
ref|XP_005646982.1|  hypothetical protein COCSUDRAFT_37061              131   1e-32   Coccomyxa subellipsoidea C-169
gb|KCW70958.1|  hypothetical protein EUGRSUZ_F04070                     127   7e-32   Eucalyptus grandis [rose gum]
ref|XP_010473742.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...    119   1e-29   
ref|XP_003063700.1|  predicted protein                                  120   2e-28   Micromonas pusilla CCMP1545
gb|KDO56044.1|  hypothetical protein CISIN_1g044056mg                   113   4e-27   Citrus sinensis [apfelsine]
ref|XP_007509693.1|  predicted protein                                  115   1e-26   Bathycoccus prasinos
ref|XP_005849953.1|  hypothetical protein CHLNCDRAFT_143308             114   2e-26   Chlorella variabilis
ref|XP_002505587.1|  predicted protein                                  114   3e-26   Micromonas commoda
dbj|BAJ91330.1|  predicted protein                                      109   5e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW70959.1|  hypothetical protein EUGRSUZ_F04070                     107   2e-24   Eucalyptus grandis [rose gum]
ref|XP_001422519.1|  predicted protein                                  106   1e-23   Ostreococcus lucimarinus CCE9901
ref|WP_025420783.1|  lactate dehydrogenase                              104   5e-23   Sodalis praecaptivus
gb|KDD72690.1|  hypothetical protein H632_c3019p0                       103   1e-22   Helicosporidium sp. ATCC 50920
ref|XP_005828939.1|  hypothetical protein GUITHDRAFT_46401              102   2e-22   Guillardia theta CCMP2712
ref|WP_039329515.1|  lactate dehydrogenase                            99.8    2e-21   Pantoea
ref|WP_021184805.1|  D-3-phosphoglycerate dehydrogenase               99.4    4e-21   Pantoea sp. AS-PWVM4
ref|XP_003082919.1|  oxidoreductase family protein (ISS)              99.0    5e-21   Ostreococcus tauri
ref|WP_013507782.1|  lactate dehydrogenase                            98.6    6e-21   Pantoea sp. At-9b
ref|XP_002179420.1|  predicted protein                                97.8    2e-20   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_034826230.1|  lactate dehydrogenase                            97.1    2e-20   Enterobacter cancerogenus
ref|XP_007015903.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  95.1    7e-20   
ref|WP_013200656.1|  lactate dehydrogenase                            95.1    1e-19   Erwinia billingiae
ref|XP_008189273.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...  94.4    2e-19   Acyrthosiphon pisum
ref|WP_031376041.1|  lactate dehydrogenase                            93.6    3e-19   Pantoea
ref|WP_015906531.1|  lactate dehydrogenase                            93.2    4e-19   Desulfobacterium autotrophicum
ref|WP_041287365.1|  hypothetical protein                             92.8    5e-19   
ref|WP_034897846.1|  lactate dehydrogenase                            92.8    6e-19   Erwinia typographi
gb|AFM26624.1|  phosphoglycerate dehydrogenase-like oxidoreductase    92.8    7e-19   Desulfomonile tiedjei DSM 6799
ref|WP_028671049.1|  lactate dehydrogenase                            92.4    9e-19   Saccharospirillum impatiens
ref|WP_015878860.1|  lactate dehydrogenase                            91.7    2e-18   Tolumonas auensis
ref|WP_038649217.1|  lactate dehydrogenase                            90.9    2e-18   Pantoea rwandensis
ref|WP_029912678.1|  lactate dehydrogenase                            90.5    4e-18   
ref|WP_012107589.1|  D-isomer specific 2-hydroxyacid dehydrogenase    89.4    1e-17   Methanoregula boonei
ref|XP_011399491.1|  D-3-phosphoglycerate dehydrogenase               89.0    1e-17   Auxenochlorella protothecoides
ref|WP_024966984.1|  lactate dehydrogenase                            87.8    3e-17   Pantoea sp. IMH
ref|WP_034949039.1|  lactate dehydrogenase                            87.8    3e-17   Erwinia oleae
ref|WP_020880970.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  87.0    6e-17   Desulfovibrio sp. X2
ref|WP_035265554.1|  lactate dehydrogenase                            85.9    2e-16   Desulfosarcina sp. BuS5
ref|WP_034912135.1|  lactate dehydrogenase                            85.5    2e-16   Erwinia sp. 9145
ref|WP_017800580.1|  lactate dehydrogenase                            85.1    3e-16   Erwinia toletana
emb|CCK81373.1|  D-isomer specific 2-hydroxyacid dehydrogenase NA...  79.3    4e-15   Desulfobacula toluolica Tol2
gb|EWM13769.1|  D-3-phosphoglycerate dehydrogenase                    79.3    1e-14   Kutzneria sp. 744
ref|WP_043730098.1|  hypothetical protein                             76.6    2e-14   
gb|AHF97449.1|  lactate dehydrogenase                                 79.3    3e-14   Desulfurella acetivorans A63
ref|WP_040401337.1|  hypothetical protein                             79.0    3e-14   
ref|WP_033397128.1|  lactate dehydrogenase                            78.6    4e-14   
ref|WP_020711063.1|  hypothetical protein                             78.6    6e-14   Acidobacteriaceae bacterium KBS 83
ref|WP_037135542.1|  2-hydroxyacid dehydrogenase                      77.8    9e-14   Rhizobium sp. CF394
ref|WP_004073201.1|  lactate dehydrogenase                            77.8    1e-13   Desulfobacter postgatei
ref|WP_024821851.1|  hypothetical protein                             77.8    1e-13   Aminobacterium mobile
ref|WP_018114836.1|  hypothetical protein                             76.3    4e-13   Rhizobiales bacterium
ref|WP_013570641.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  75.5    7e-13   Terriglobus saanensis
ref|WP_022842734.1|  lactate dehydrogenase                            75.1    1e-12   Acidobacteriaceae bacterium TAA166
ref|XP_008461935.1|  PREDICTED: formate dehydrogenase, mitochondr...  74.3    1e-12   
ref|WP_018335712.1|  hypothetical protein                             74.7    1e-12   Actinomycetospora chiangmaiensis
ref|WP_038572953.1|  hypothetical protein                             73.6    2e-12   
ref|WP_041446076.1|  hypothetical protein                             71.2    2e-11   
gb|AER67036.1|  D-isomer specific 2-hydroxyacid dehydrogenase NAD...  71.2    2e-11   Thermovirga lienii DSM 17291
ref|WP_029716541.1|  hypothetical protein                             70.9    3e-11   
ref|WP_014806274.1|  glyoxylate reductase                             69.7    9e-11   Acetomicrobium
gb|AFZ33157.1|  Glyoxylate reductase                                  69.7    9e-11   Gloeocapsa sp. PCC 7428
ref|WP_041919487.1|  hypothetical protein                             67.8    2e-10   
ref|WP_012940091.1|  3-phosphoglycerate dehydrogenase                 69.3    2e-10   Archaeoglobus profundus
tpg|DAA39793.1|  TPA: hypothetical protein ZEAMMB73_065837            67.8    3e-10   
gb|ACG30212.1|  hypothetical protein                                  65.5    3e-10   Zea mays [maize]
ref|WP_041306383.1|  hypothetical protein                             67.0    7e-10   
gb|ADG07683.1|  D-isomer specific 2-hydroxyacid dehydrogenase NAD...  67.0    7e-10   Kyrpidia tusciae DSM 2912
ref|WP_026988575.1|  hypothetical protein                             66.6    1e-09   Fodinicurvata fenggangensis
ref|WP_009201581.1|  glyoxylate reductase                             66.2    1e-09   Acetomicrobium hydrogeniformans
ref|XP_003839668.1|  similar to d-3-phosphoglycerate dehydrogenase    65.9    3e-09   Leptosphaeria maculans JN3
ref|WP_041587609.1|  2-hydroxyacid dehydrogenase                      65.1    3e-09   Thermoanaerobacterium thermosaccharolyticum
gb|ADL69926.1|  Glyoxylate reductase                                  65.1    3e-09   Thermoanaerobacterium thermosaccharolyticum DSM 571
ref|WP_015740268.1|  3-phosphoglycerate dehydrogenase                 65.5    4e-09   Zymomonas mobilis
ref|WP_014501073.1|  3-phosphoglycerate dehydrogenase                 65.5    4e-09   Zymomonas mobilis
ref|WP_011021352.1|  glycerate dehydrogenase                          64.7    5e-09   
ref|WP_017750993.1|  hypothetical protein                             64.3    6e-09   Clostridium tyrobutyricum
ref|XP_003304604.1|  hypothetical protein PTT_17253                   64.3    1e-08   
ref|WP_023593659.1|  D-3-phosphoglycerate dehydrogenase               64.3    1e-08   Zymomonas mobilis
ref|WP_011241433.1|  3-phosphoglycerate dehydrogenase                 64.3    1e-08   Zymomonas mobilis
dbj|BAE03264.1|  phosphoglycerate dehydrogenase                       63.5    1e-08   uncultured Candidatus Nitrosocaldus sp.
ref|WP_014736776.1|  2-hydroxyacid dehydrogenase                      63.5    1e-08   Thermogladius calderae
ref|WP_014849257.1|  3-phosphoglycerate dehydrogenase                 64.3    1e-08   Zymomonas mobilis
ref|WP_017471569.1|  3-phosphoglycerate dehydrogenase                 63.9    1e-08   Amphibacillus jilinensis
ref|WP_006111248.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  63.5    1e-08   Natrialba asiatica
ref|WP_009604978.1|  3-phosphoglycerate dehydrogenase                 63.9    1e-08   SAR116 cluster alpha proteobacterium HIMB100
ref|WP_041076035.1|  hypothetical protein                             63.2    2e-08   Thermotoga caldifontis
ref|XP_007684918.1|  hypothetical protein COCMIDRAFT_23723            63.5    2e-08   Bipolaris oryzae ATCC 44560
ref|XP_001937038.1|  D-3-phosphoglycerate dehydrogenase               63.5    2e-08   Pyrenophora tritici-repentis Pt-1C-BFP
ref|WP_013253378.1|  phosphoglycerate dehydrogenase                   62.8    2e-08   Sediminispirochaeta smaragdinae
ref|WP_039279002.1|  phosphoglycerate dehydrogenase                   62.8    2e-08   Novosphingobium malaysiense
ref|WP_035230720.1|  3-phosphoglycerate dehydrogenase                 63.2    2e-08   
ref|WP_006877083.1|  phosphoglycerate dehydrogenase                   62.4    3e-08   Anaerotruncus colihominis
dbj|GAK55269.1|  D-3-phosphoglycerate dehydrogenase                   62.4    3e-08   Candidatus Vecturithrix granuli
ref|XP_007700157.1|  hypothetical protein COCSADRAFT_142735           63.2    3e-08   Bipolaris sorokiniana ND90Pr
gb|EUN28394.1|  hypothetical protein COCVIDRAFT_25485                 62.8    3e-08   Bipolaris victoriae FI3
gb|EMD88769.1|  hypothetical protein COCHEDRAFT_67241                 62.8    3e-08   Bipolaris maydis C5
ref|WP_022726624.1|  lactate dehydrogenase                            62.4    3e-08   
ref|WP_008982449.1|  hydroxyacid dehydrogenase                        62.4    3e-08   Ruminococcaceae bacterium D16
ref|WP_012966581.1|  3-phosphoglycerate dehydrogenase                 62.8    3e-08   Ferroglobus placidus
ref|WP_015590372.1|  D-3-phosphoglycerate dehydrogenase               62.8    3e-08   Archaeoglobus sulfaticallidus
ref|XP_007783912.1|  D-3-phosphoglycerate dehydrogenase               62.8    4e-08   Coniosporium apollinis CBS 100218
ref|XP_005963039.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  62.4    4e-08   Pantholops hodgsonii [Tibetan antelope]
ref|WP_020613473.1|  phosphoglycerate dehydrogenase                   62.0    4e-08   Sediminispirochaeta bajacaliforniensis
ref|WP_006514041.1|  D-3-phosphoglycerate dehydrogenase               62.4    4e-08   Leptolyngbya sp. PCC 7375
ref|WP_025654948.1|  phosphoglycerate dehydrogenase                   62.0    4e-08   Hungatella hathewayi
ref|XP_007716265.1|  hypothetical protein COCCADRAFT_29488            62.4    4e-08   Bipolaris zeicola 26-R-13
ref|WP_044602197.1|  3-phosphoglycerate dehydrogenase                 62.4    5e-08   
ref|WP_010921048.1|  3-phosphoglycerate dehydrogenase                 62.4    5e-08   Caulobacter vibrioides
ref|WP_020878515.1|  D-3-phosphoglycerate dehydrogenase               62.4    5e-08   Desulfococcus multivorans
ref|WP_014026236.1|  3-phosphoglycerate dehydrogenase                 61.6    5e-08   
ref|WP_013931861.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  61.6    5e-08   Pseudothermotoga thermarum
ref|WP_023502990.1|  phosphoglycerate dehydrogenase related dehyd...  59.7    5e-08   
ref|WP_015011102.1|  3-phosphoglycerate dehydrogenase                 62.0    5e-08   Amphibacillus xylanus
ref|WP_016776361.1|  hydroxyacid dehydrogenase                        61.6    6e-08   Anaerophaga thermohalophila
ref|NP_001015929.1|  D-3-phosphoglycerate dehydrogenase               62.0    6e-08   Xenopus tropicalis [western clawed frog]
ref|WP_041082803.1|  hypothetical protein                             61.6    6e-08   Thermotoga profunda
ref|WP_030367266.1|  3-phosphoglycerate dehydrogenase                 61.2    6e-08   
ref|XP_005707843.1|  D-3-phosphoglycerate dehydrogenase               62.0    6e-08   Galdieria sulphuraria
ref|WP_013048792.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  61.2    6e-08   Aminobacterium colombiense
ref|WP_031504954.1|  hypothetical protein                             61.2    6e-08   Pseudothermotoga hypogea
gb|AIY89624.1|  phosphoglycerate dehydrogenase                        61.6    7e-08   Geoglobus acetivorans
emb|CDQ57777.1|  unnamed protein product                              60.8    7e-08   Oncorhynchus mykiss
ref|WP_003609903.1|  3-phosphoglycerate dehydrogenase                 61.6    7e-08   Methylosinus
ref|WP_003869389.1|  2-hydroxyacid dehydrogenase                      61.2    7e-08   
ref|WP_014063250.1|  2-hydroxyacid dehydrogenase                      61.2    7e-08   Thermoanaerobacter wiegelii
ref|WP_004623128.1|  D-3-phosphoglycerate dehydrogenase               61.6    7e-08   Caulobacter vibrioides
ref|XP_003447434.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  61.6    7e-08   Oreochromis niloticus
ref|WP_017824164.1|  3-phosphoglycerate dehydrogenase                 61.6    7e-08   Brachybacterium muris
ref|XP_004557758.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  61.6    7e-08   Maylandia zebra
ref|WP_013684189.1|  3-phosphoglycerate dehydrogenase                 61.6    7e-08   Archaeoglobus veneficus
ref|WP_013720633.1|  3-phosphoglycerate dehydrogenase                 61.6    7e-08   Methanothrix soehngenii
ref|WP_003504829.1|  MULTISPECIES: hypothetical protein               61.2    8e-08   Clostridiales
ref|WP_029907235.1|  3-phosphoglycerate dehydrogenase                 61.6    8e-08   Caulobacter sp. UNC358MFTsu5.1
ref|WP_003866641.1|  2-hydroxyacid dehydrogenase                      61.2    8e-08   Thermoanaerobacter ethanolicus
ref|WP_004405741.1|  MULTISPECIES: Phosphoglycerate dehydrogenase...  61.2    8e-08   Thermoanaerobacter
ref|WP_021640963.1|  putative glyoxylate reductase [                  61.2    8e-08   [Clostridium] symbiosum
ref|WP_012994339.1|  2-hydroxyacid dehydrogenase                      61.2    8e-08   Thermoanaerobacter italicus
ref|WP_008600740.1|  D-3-phosphoglycerate dehydrogenase               61.6    8e-08   Pacificimonas flava
ref|WP_028991991.1|  2-hydroxyacid dehydrogenase                      60.8    8e-08   Thermoanaerobacter thermocopriae
ref|WP_009051962.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        60.8    8e-08   
ref|WP_003868264.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        60.8    8e-08   
ref|WP_012994332.1|  2-hydroxyacid dehydrogenase                      60.8    9e-08   
ref|WP_024303048.1|  hydroxyacid dehydrogenase                        61.2    9e-08   
ref|WP_012269745.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        60.8    9e-08   
ref|WP_012269747.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        60.8    9e-08   
ref|WP_013149652.1|  2-hydroxyacid dehydrogenase                      60.8    9e-08   
gb|EKD38557.1|  hypothetical protein ACD_75C00696G0004                58.9    9e-08   
ref|WP_028991995.1|  2-hydroxyacid dehydrogenase                      60.8    9e-08   
ref|WP_003868999.1|  2-hydroxyacid dehydrogenase                      60.8    9e-08   
ref|WP_034132100.1|  hypothetical protein                             60.8    9e-08   
ref|XP_003229089.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    61.2    9e-08   
ref|XP_008397929.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    61.2    9e-08   
emb|CEF67819.1|  D-3-phosphoglycerate dehydrogenase                   60.8    1e-07   
ref|WP_014063714.1|  3-phosphoglycerate dehydrogenase                 61.2    1e-07   
ref|WP_022820816.1|  3-phosphoglycerate dehydrogenase                 61.2    1e-07   
ref|XP_006788556.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  61.2    1e-07   
ref|WP_043884048.1|  3-phosphoglycerate dehydrogenase                 59.3    1e-07   
ref|WP_023075995.1|  d-3-phosphoglycerate dehydrogenase               61.2    1e-07   
ref|XP_007260013.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  61.2    1e-07   
ref|WP_012875377.1|  3-phosphoglycerate dehydrogenase                 61.2    1e-07   
ref|WP_013162834.1|  3-phosphoglycerate dehydrogenase                 61.2    1e-07   
ref|WP_010974651.1|  MULTISPECIES: phosphoglycerate dehydrogenase     60.5    1e-07   
ref|WP_036801780.1|  D-3-phosphoglycerate dehydrogenase               60.8    1e-07   
ref|WP_015284010.1|  phosphoglycerate dehydrogenase-like oxidored...  60.5    1e-07   
ref|XP_006276789.1|  PREDICTED: d-3-phosphoglycerate dehydrogenase    60.8    1e-07   
ref|WP_028051872.1|  D-3-phosphoglycerate dehydrogenase               60.8    1e-07   
ref|WP_029711588.1|  hypothetical protein                             60.8    1e-07   
ref|WP_012498776.1|  3-phosphoglycerate dehydrogenase                 60.8    1e-07   
ref|WP_034420544.1|  hypothetical protein                             60.1    1e-07   
dbj|GAE93858.1|  D-3-phosphoglycerate dehydrogenase                   60.8    1e-07   
ref|WP_040203764.1|  MULTISPECIES: D-3-phosphoglycerate dehydroge...  60.8    1e-07   
ref|WP_020812372.1|  3-phosphoglycerate dehydrogenase                 60.5    2e-07   
ref|WP_013276648.1|  2-hydroxyacid dehydrogenase                      60.1    2e-07   
ref|XP_005723511.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  60.8    2e-07   
ref|WP_019154013.1|  hypothetical protein                             60.1    2e-07   
gb|KHJ49564.1|  putative phosphoglycerate dehydrogenase               60.1    2e-07   
emb|CDW53280.1|  d 3 phosphoglycerate dehydrogenase                   60.1    2e-07   
ref|WP_013826465.1|  3-phosphoglycerate dehydrogenase                 60.5    2e-07   
ref|XP_006032012.1|  PREDICTED: d-3-phosphoglycerate dehydrogenase    60.5    2e-07   
ref|WP_021060793.1|  phosphoglycerate dehydrogenase related dehyd...  60.1    2e-07   
ref|WP_011018669.1|  3-phosphoglycerate dehydrogenase                 60.5    2e-07   
ref|WP_010422163.1|  hydroxyacid dehydrogenase                        60.1    2e-07   
gb|EME50410.1|  hypothetical protein DOTSEDRAFT_69065                 60.5    2e-07   
ref|WP_015933125.1|  3-phosphoglycerate dehydrogenase                 60.5    2e-07   
ref|WP_013776137.1|  3-phosphoglycerate dehydrogenase                 60.1    2e-07   
ref|WP_015232588.1|  phosphoglycerate dehydrogenase-like oxidored...  59.7    2e-07   
emb|CBJ29093.1|  D-3-phosphoglycerate dehydrogenase                   60.5    2e-07   
gb|AAI18689.1|  hypothetical protein LOC548683                        60.1    2e-07   
ref|WP_041075886.1|  D-3-phosphoglycerate dehydrogenase               60.1    2e-07   
ref|XP_007546509.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    60.1    2e-07   
ref|WP_040389226.1|  hydroxyacid dehydrogenase                        59.7    2e-07   
ref|WP_020879502.1|  D-isomer specific 2-hydroxyacid dehydrogenas...  59.7    2e-07   
ref|XP_008276911.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    60.1    2e-07   
ref|WP_044427461.1|  hypothetical protein                             59.7    2e-07   
ref|WP_024126259.1|  MULTISPECIES: D-3-phosphoglycerate dehydroge...  60.1    2e-07   
ref|WP_013787582.1|  2-hydroxyacid dehydrogenase                      59.7    2e-07   
ref|NP_001091250.1|  phosphoglycerate dehydrogenase                   60.1    2e-07   
gb|KJB96303.1|  2-hydroxyacid dehydrogenase                           59.7    3e-07   
ref|WP_028404925.1|  phosphoglycerate dehydrogenase                   59.7    3e-07   
ref|WP_035539282.1|  MULTISPECIES: hydroxyacid dehydrogenase          59.7    3e-07   
ref|WP_015020132.1|  2-hydroxyacid dehydrogenase                      59.7    3e-07   
ref|WP_039857970.1|  hydroxyacid dehydrogenase                        59.7    3e-07   
ref|WP_030014626.1|  3-phosphoglycerate dehydrogenase                 60.1    3e-07   
gb|EAX49027.1|  Phosphoglycerate dehydrogenase                        59.7    3e-07   
ref|WP_041157478.1|  hydroxyacid dehydrogenase                        59.3    3e-07   
ref|WP_002571480.1|  hypothetical protein [                           59.3    3e-07   
gb|KFD54585.1|  hypothetical protein M513_04530                       60.1    3e-07   
ref|WP_021292044.1|  MULTISPECIES: hypothetical protein               59.7    3e-07   
ref|WP_008184540.1|  3-phosphoglycerate dehydrogenase                 59.7    3e-07   
ref|WP_042665584.1|  hypothetical protein                             59.3    3e-07   
ref|WP_041549045.1|  phosphoglycerate dehydrogenase                   59.3    3e-07   
ref|WP_040682939.1|  hypothetical protein                             59.3    3e-07   
ref|XP_005815897.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  58.9    3e-07   
gb|KIN01403.1|  hypothetical protein OIDMADRAFT_103986                59.7    3e-07   
ref|WP_015919681.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        59.3    3e-07   
gb|KFD69267.1|  hypothetical protein M514_04530                       60.1    3e-07   
ref|WP_011345551.1|  3-phosphoglycerate dehydrogenase                 59.7    3e-07   
ref|WP_013077884.1|  3-phosphoglycerate dehydrogenase                 59.7    3e-07   
ref|WP_038306467.1|  3-phosphoglycerate dehydrogenase                 59.3    3e-07   
ref|WP_036576192.1|  phosphoglycerate dehydrogenase                   59.3    4e-07   
gb|EUB30844.1|  4-phosphoerythronate dehydrogenase                    59.3    4e-07   
ref|XP_008326872.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    59.7    4e-07   
ref|WP_026104844.1|  glycerate dehydrogenase                          59.3    4e-07   
ref|WP_027884821.1|  2-hydroxyacid dehydrogenase                      59.3    4e-07   
ref|WP_043692606.1|  3-phosphoglycerate dehydrogenase                 59.7    4e-07   
ref|WP_023405931.1|  hypothetical protein                             59.7    4e-07   
ref|WP_022587664.1|  3-phosphoglycerate dehydrogenase                 59.3    4e-07   
gb|ADK67145.1|  D-isomer specific 2-hydroxyacid dehydrogenase NAD...  59.3    4e-07   
ref|WP_022587216.1|  3-phosphoglycerate dehydrogenase                 59.3    4e-07   
ref|WP_003928685.1|  3-phosphoglycerate dehydrogenase                 59.3    4e-07   
ref|XP_004347061.2|  D-3-phosphoglycerate dehydrogenase               59.3    4e-07   
ref|WP_011026608.1|  3-phosphoglycerate dehydrogenase                 59.3    4e-07   
ref|WP_011699898.1|  D-3-phosphoglycerate dehydrogenase               59.3    4e-07   
ref|WP_025773616.1|  D-3-phosphoglycerate dehydrogenase               59.3    4e-07   
ref|WP_006668563.1|  MULTISPECIES: 3-phosphoglycerate dehydrogenase   59.3    4e-07   
ref|XP_011440418.1|  PREDICTED: D-3-phosphoglycerate dehydrogenas...  59.3    4e-07   
ref|WP_011391569.1|  3-phosphoglycerate dehydrogenase                 59.3    4e-07   
gb|EKD08368.1|  D-3-phosphoglycerate dehydrogenase                    59.3    5e-07   
ref|WP_028038069.1|  3-phosphoglycerate dehydrogenase                 59.3    5e-07   
ref|WP_016483762.1|  D-3-phosphoglycerate dehydrogenase               59.3    5e-07   
ref|WP_044400573.1|  2-hydroxyacid dehydrogenase                      58.9    5e-07   
ref|WP_011700444.1|  3-phosphoglycerate dehydrogenase                 59.3    5e-07   
gb|KJE94797.1|  D-3-phosphoglycerate dehydrogenase, variant 1         59.3    5e-07   
ref|WP_012984255.1|  3-phosphoglycerate dehydrogenase                 58.9    5e-07   
ref|WP_014759337.1|  MULTISPECIES: 2-hydroxyacid dehydrogenase        58.5    5e-07   
ref|WP_041341612.1|  3-phosphoglycerate dehydrogenase                 58.9    5e-07   
gb|KIW14703.1|  phosphoglycerate dehydrogenase                        59.3    5e-07   
ref|WP_009002125.1|  phosphoglycerate dehydrogenase                   58.5    5e-07   
ref|WP_028324400.1|  3-phosphoglycerate dehydrogenase                 58.9    5e-07   
ref|WP_034422257.1|  hypothetical protein                             58.5    5e-07   
ref|WP_015406996.1|  phosphoglycerate dehydrogenase                   58.9    5e-07   
ref|WP_035071489.1|  3-phosphoglycerate dehydrogenase                 58.9    6e-07   
ref|WP_010936374.1|  3-phosphoglycerate dehydrogenase                 58.9    6e-07   
ref|WP_038369993.1|  3-phosphoglycerate dehydrogenase                 58.9    6e-07   
ref|XP_002160624.2|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  58.5    6e-07   
ref|XP_005918214.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  58.9    6e-07   
ref|XP_008024190.1|  hypothetical protein SETTUDRAFT_107778           58.9    6e-07   
ref|WP_025346097.1|  hydroxyacid dehydrogenase                        58.5    6e-07   
ref|WP_013404291.1|  3-phosphoglycerate dehydrogenase                 58.9    6e-07   
emb|CBX31172.1|  D-3-phosphoglycerate dehydrogenase                   58.9    6e-07   
ref|WP_014757321.1|  MULTISPECIES: 3-phosphoglycerate dehydrogenase   58.9    6e-07   
ref|WP_011762320.1|  3-phosphoglycerate dehydrogenase                 58.5    6e-07   
ref|WP_011499644.1|  3-phosphoglycerate dehydrogenase                 58.5    6e-07   
ref|WP_011928943.1|  3-phosphoglycerate dehydrogenase                 58.9    7e-07   
ref|WP_026373531.1|  3-phosphoglycerate dehydrogenase                 58.9    7e-07   
ref|WP_013291170.1|  3-phosphoglycerate dehydrogenase                 58.9    7e-07   
ref|WP_019848888.1|  3-phosphoglycerate dehydrogenase                 58.5    7e-07   
ref|XP_001803372.1|  hypothetical protein SNOG_13160                  58.9    7e-07   
ref|WP_035049781.1|  3-phosphoglycerate dehydrogenase                 58.5    7e-07   
ref|WP_021010033.1|  hypothetical protein                             58.5    7e-07   
ref|WP_036748563.1|  hypothetical protein                             58.2    7e-07   
ref|WP_039175995.1|  hydroxyacid dehydrogenase                        58.2    7e-07   
ref|WP_034160341.1|  3-phosphoglycerate dehydrogenase                 58.5    8e-07   
ref|WP_038036771.1|  3-phosphoglycerate dehydrogenase                 58.5    8e-07   
ref|WP_036527855.1|  phosphoglycerate dehydrogenase                   58.2    8e-07   
ref|WP_012881855.1|  3-phosphoglycerate dehydrogenase                 58.5    8e-07   
ref|WP_037523101.1|  3-phosphoglycerate dehydrogenase                 58.5    8e-07   
ref|WP_021245473.1|  3-phosphoglycerate dehydrogenase                 58.5    8e-07   
ref|WP_006618206.1|  3-phosphoglycerate dehydrogenase                 58.5    8e-07   
ref|WP_028262484.1|  hypothetical protein                             58.5    8e-07   
ref|WP_006639535.1|  glycerate dehydrogenase                          58.2    9e-07   
ref|WP_006007548.1|  2-hydroxyacid dehydrogenase                      57.8    9e-07   
ref|WP_012590776.1|  3-phosphoglycerate dehydrogenase                 58.2    9e-07   
ref|WP_025641806.1|  phosphoglycerate dehydrogenase [                 58.2    1e-06   
ref|WP_029759477.1|  hydroxyacid dehydrogenase                        57.8    1e-06   
ref|WP_028931213.1|  3-phosphoglycerate dehydrogenase                 58.2    1e-06   
ref|WP_012268891.1|  MULTISPECIES: 3-phosphoglycerate dehydrogenase   58.2    1e-06   
ref|WP_012306867.1|  MULTISPECIES: 3-phosphoglycerate dehydrogenase   58.2    1e-06   
gb|AIS53460.1|  D-3-phosphoglycerate dehydrogenase SerA               58.2    1e-06   
ref|WP_013299001.1|  3-phosphoglycerate dehydrogenase                 58.2    1e-06   
ref|WP_037045120.1|  3-phosphoglycerate dehydrogenase                 58.2    1e-06   
ref|XP_009648777.1|  D-3-phosphoglycerate dehydrogenase               58.2    1e-06   
ref|WP_024079928.1|  3-phosphoglycerate dehydrogenase                 58.2    1e-06   
ref|WP_021685008.1|  phosphoglycerate dehydrogenase                   58.2    1e-06   
ref|WP_029500870.1|  D-3-phosphoglycerate dehydrogenase               58.2    1e-06   
ref|WP_035852847.1|  3-phosphoglycerate dehydrogenase                 58.2    1e-06   
ref|WP_004399089.1|  MULTISPECIES: D-3-phosphoglycerate dehydroge...  58.2    1e-06   
gb|KIW99195.1|  phosphoglycerate dehydrogenase                        58.2    1e-06   
ref|XP_003961897.1|  PREDICTED: d-3-phosphoglycerate dehydrogenas...  58.2    1e-06   
ref|WP_035950990.1|  3-phosphoglycerate dehydrogenase                 57.8    1e-06   
ref|WP_018934410.1|  hypothetical protein                             57.8    1e-06   
ref|XP_010744254.1|  PREDICTED: D-3-phosphoglycerate dehydrogenase    57.8    1e-06   
ref|WP_013412670.1|  3-phosphoglycerate dehydrogenase                 57.8    1e-06   
ref|WP_029229471.1|  hypothetical protein                             57.8    1e-06   
ref|WP_015312626.1|  D-3-phosphoglycerate dehydrogenase               57.8    1e-06   
ref|WP_023652107.1|  D-3-phosphoglycerate dehydrogenase               57.8    1e-06   
ref|WP_012997421.1|  2-hydroxyacid dehydrogenase                      57.4    1e-06   
ref|WP_015599344.1|  3-phosphoglycerate dehydrogenase                 57.8    1e-06   
ref|WP_033343935.1|  3-phosphoglycerate dehydrogenase                 57.8    1e-06   
ref|XP_007888162.1|  PREDICTED: kelch-like protein 23 isoform X1      58.2    1e-06   
ref|WP_041910905.1|  hypothetical protein                             57.0    1e-06   
ref|WP_013296155.1|  3-phosphoglycerate dehydrogenase                 57.8    1e-06   
ref|WP_025617573.1|  3-phosphoglycerate dehydrogenase                 57.8    1e-06   
ref|WP_040011918.1|  3-phosphoglycerate dehydrogenase                 57.8    2e-06   
ref|WP_013256283.1|  D-isomer specific 2-hydroxyacid dehydrogenase    57.4    2e-06   
ref|WP_008831506.1|  phosphoglycerate dehydrogenase                   57.4    2e-06   
gb|EMS79295.1|  D-3-phosphoglycerate dehydrogenase SerA               57.8    2e-06   
ref|WP_003473143.1|  D-3-phosphoglycerate dehydrogenase               57.8    2e-06   
ref|WP_038057798.1|  3-phosphoglycerate dehydrogenase                 57.8    2e-06   
ref|WP_013925789.1|  D-lactate dehydrogenase                          57.4    2e-06   
ref|WP_040334563.1|  3-phosphoglycerate dehydrogenase                 57.8    2e-06   
ref|WP_029476138.1|  hypothetical protein                             57.8    2e-06   
ref|WP_008820741.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
gb|EYU37635.1|  hypothetical protein MIMGU_mgv1a003216mg              57.8    2e-06   
ref|WP_008071233.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
gb|KFZ18985.1|  hypothetical protein V501_00887                       57.8    2e-06   
ref|XP_003001841.1|  D-3-phosphoglycerate dehydrogenase               57.8    2e-06   
ref|WP_017975153.1|  hypothetical protein                             57.0    2e-06   
ref|WP_015052805.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_020453381.1|  MULTISPECIES: putative D-isomer specific 2-h...  57.0    2e-06   
gb|AIG97691.1|  D-3-phosphoglycerate dehydrogenase                    57.4    2e-06   
ref|WP_024297350.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
gb|AIF82828.1|  phosphoglycerate dehydrogenase-like oxidoreductase    57.0    2e-06   
ref|WP_010878316.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_015651061.1|  D-3-phosphoglycerate dehydrogenase               57.4    2e-06   
ref|WP_036475061.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
gb|AGI71489.1|  2-hydroxyacid dehydrogenase family protein            57.0    2e-06   
ref|WP_018706133.1|  hypothetical protein                             57.4    2e-06   
ref|WP_008285814.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_009052116.1|  MULTISPECIES: 3-phosphoglycerate dehydrogenase   57.4    2e-06   
ref|WP_003867587.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_005968287.1|  3-phosphoglycerate dehydrogenase                 57.0    2e-06   
ref|WP_029652106.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_013787739.1|  2-hydroxyacid dehydrogenase                      57.0    2e-06   
ref|WP_026580288.1|  glycerate dehydrogenase                          57.0    2e-06   
ref|WP_009742282.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
gb|KJE22067.1|  D-3-phosphoglycerate dehydrogenase                    57.4    2e-06   
gb|ETB70311.1|  glycerate dehydrogenase                               57.0    2e-06   
gb|KFY74902.1|  hypothetical protein V499_05116                       57.4    2e-06   
ref|WP_011309113.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_005373125.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_025810595.1|  glycerate dehydrogenase                          57.0    2e-06   
ref|WP_011606915.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_031429503.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_031305128.1|  MULTISPECIES: glycerate dehydrogenase            57.0    2e-06   
gb|EKC28803.1|  D-3-phosphoglycerate dehydrogenase                    57.4    2e-06   
ref|WP_031446391.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_015135564.1|  D-3-phosphoglycerate dehydrogenase               57.4    2e-06   
ref|WP_018406123.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   
ref|WP_031505683.1|  3-phosphoglycerate dehydrogenase                 57.4    2e-06   



>ref|XP_009794279.1| PREDICTED: hydroxyphenylpyruvate reductase [Nicotiana sylvestris]
Length=400

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            ++ KMG+N SSH+TRVLFCGP+FPASHNYTREY+QGY F+QVDD+P ENVPAVI DY+IC
Sbjct  54   EVQKMGDNSSSHVTRVLFCGPHFPASHNYTREYLQGYPFVQVDDVPLENVPAVIGDYEIC  113

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            VVK+ R+NSD++S AK MKLIMQFGVGLEGVDI AAT HGIKVARIP GATGNA SCAEM
Sbjct  114  VVKSFRMNSDVLSRAKSMKLIMQFGVGLEGVDINAATEHGIKVARIPGGATGNAASCAEM  173

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYLILGLLRK H++ I+++QK LGEPIGD L GKTVFIM
Sbjct  174  AIYLILGLLRKQHQLKISVEQKKLGEPIGDNLEGKTVFIM  213



>ref|XP_009588864.1| PREDICTED: hydroxyphenylpyruvate reductase [Nicotiana tomentosiformis]
Length=401

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            ++ KMG+N SS +TRVLFCGP+FPASHNYTREY+QGY F+QVDD+P ENVPAVI DY+IC
Sbjct  55   EVQKMGDNSSSQVTRVLFCGPHFPASHNYTREYLQGYPFVQVDDVPLENVPAVIGDYEIC  114

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            VVK+ R+NSD++S AK MKLIMQFGVGLEGVDI AAT HGIKVARIP GATGNA SCAEM
Sbjct  115  VVKSFRMNSDVLSRAKSMKLIMQFGVGLEGVDINAATEHGIKVARIPGGATGNAASCAEM  174

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYLILGLLRK H++ I+++QK LGEPIGD L GKTVFIM
Sbjct  175  AIYLILGLLRKQHQLKISVEQKKLGEPIGDNLEGKTVFIM  214



>ref|XP_004250408.1| PREDICTED: glyoxylate/hydroxypyruvate reductase HPR3 [Solanum 
lycopersicum]
Length=398

 Score =   258 bits (660),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 137/157 (87%), Gaps = 0/157 (0%)
 Frame = +2

Query  173  KMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVK  352
            KM +N  +H+TRVLFCGP+FP SHNYTREY+QGY F+QVDD+P E+VPAVI DYDICVVK
Sbjct  55   KMSDNRCNHVTRVLFCGPHFPDSHNYTREYLQGYPFVQVDDVPLESVPAVIGDYDICVVK  114

Query  353  NLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIY  532
            + R+NSD++S AKRMKLIMQFGVGLEGVDI AAT HGIKVA+IP GATGNA SCAEMAIY
Sbjct  115  SFRMNSDVLSRAKRMKLIMQFGVGLEGVDITAATKHGIKVAKIPGGATGNAASCAEMAIY  174

Query  533  LILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            LILGLLRK H+M I+++QK LGEP G  L GKTVFI+
Sbjct  175  LILGLLRKQHQMKISVEQKKLGEPTGVNLQGKTVFIL  211



>ref|XP_006361376.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like 
[Solanum tuberosum]
Length=398

 Score =   258 bits (660),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = +2

Query  173  KMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVK  352
            KM +N  SH+TRVLFCGP+FP SHNYTREY+QGY F+QVDD+P E+VPAVI DY+ICVVK
Sbjct  55   KMSDNRCSHVTRVLFCGPHFPDSHNYTREYLQGYPFVQVDDVPLESVPAVIGDYEICVVK  114

Query  353  NLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIY  532
            + R+NSD++S AKRMKLIMQFGVGLEGVDI AAT HGIKVA+IP GATGNA SCAEMAIY
Sbjct  115  SFRMNSDVLSRAKRMKLIMQFGVGLEGVDINAATKHGIKVAKIPGGATGNAASCAEMAIY  174

Query  533  LILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            LILGLLRK ++M I+++QK LGEP GD L GKTVFI+
Sbjct  175  LILGLLRKQNQMKISVEQKKLGEPTGDNLQGKTVFIL  211



>emb|CDP16491.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            +NGS  +TRVLFCGP+FPASH+YTREY+Q Y F++VDD+PF++VP VI +Y +CVVK++R
Sbjct  63   DNGSDQVTRVLFCGPHFPASHDYTREYLQDYPFVKVDDVPFDSVPDVIGNYHLCVVKSMR  122

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
            LNS+LIS AKRMKLIMQ+GVGLEGVDI AA+ HGIK+ARIPSGATGNA SCAEMAIYLIL
Sbjct  123  LNSELISHAKRMKLIMQYGVGLEGVDIGAASKHGIKIARIPSGATGNAVSCAEMAIYLIL  182

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GLLRK +EM IA+KQ+ LG P+GDTLLGKTVFIM
Sbjct  183  GLLRKQNEMQIAVKQRKLGVPVGDTLLGKTVFIM  216



>ref|XP_010317839.1| PREDICTED: formate dehydrogenase, mitochondrial-like [Solanum 
lycopersicum]
Length=295

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 132/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M +N  SH+TRVLFCGP+FP SHNYTREY+QGY F+QVDD+P E+VPAVI DYDICVVK+
Sbjct  1    MSDNRCSHVTRVLFCGPHFPDSHNYTREYLQGYPFVQVDDVPLESVPAVIGDYDICVVKS  60

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
             R+NSD+ S AKRMKLIMQFGVGLEGVDI AAT H IKVA+I  GATGNA S AEMAIYL
Sbjct  61   FRMNSDVHSRAKRMKLIMQFGVGLEGVDITAATNHCIKVAKISGGATGNAASYAEMAIYL  120

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            ILGLLRK H+M I+++QK LGEP G  L GKTVFI+
Sbjct  121  ILGLLRKQHQMKISVEQKKLGEPTGVNLHGKTVFIL  156



>ref|XP_002319339.2| hypothetical protein POPTR_0013s10050g [Populus trichocarpa]
 gb|EEE95262.2| hypothetical protein POPTR_0013s10050g [Populus trichocarpa]
Length=388

 Score =   243 bits (620),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 144/200 (72%), Gaps = 6/200 (3%)
 Frame = +2

Query  44   KTSLFSNNSPTSGGGCRVVEHNFshhqqqqrhcssAGILGKILKMGENGSSHITRVLFCG  223
            KT+L S    T G  C     N S            G L ++ +M  N   HITRVLFCG
Sbjct  8    KTTLISAVKRTCGLPCAFALSNLSPLHFS------TGTLSEVEQMVGNSDKHITRVLFCG  61

Query  224  PNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKL  403
            P FPASH YT+EY+Q Y FIQVDD+P   VP VI +Y+IC+VKN+RL S++IS A +MKL
Sbjct  62   PYFPASHQYTKEYLQKYPFIQVDDVPLAVVPDVISNYNICIVKNMRLTSNIISRATQMKL  121

Query  404  IMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK  583
            IMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCAEMAIYL+LGLLRK +EM I+IK
Sbjct  122  IMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIYLMLGLLRKQNEMQISIK  181

Query  584  QKMLGEPIGDTLLGKTVFIM  643
            QK LGEP G+TL GKTVFIM
Sbjct  182  QKRLGEPAGETLFGKTVFIM  201



>gb|EYU28234.1| hypothetical protein MIMGU_mgv1a007209mg [Erythranthe guttata]
Length=415

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 142/165 (86%), Gaps = 1/165 (1%)
 Frame = +2

Query  152  GILGKILKM-GENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            G+L K+ +M G++    ITRVLFCGP+FPASHNYT EY+Q + FIQVD +P ++V  VI 
Sbjct  66   GLLKKVKEMTGDSSKPIITRVLFCGPHFPASHNYTIEYLQSHPFIQVDVVPLDDVREVIG  125

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
            +YDICVVK+LRLN+D+IS A +MKLIMQFGVGLEGVDI AAT HGIKVA+IPS  TGNAT
Sbjct  126  NYDICVVKSLRLNADIISRANKMKLIMQFGVGLEGVDINAATKHGIKVAKIPSDGTGNAT  185

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEM+IYL+LGLLRK +EM +A++QK+LG+PIGDTLLGKTVFIM
Sbjct  186  SCAEMSIYLMLGLLRKQYEMQVAVRQKLLGDPIGDTLLGKTVFIM  230



>ref|XP_010665338.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X3 [Vitis vinifera]
Length=351

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            KI KM ++ +  ITR+LFCGPNFPAS+ YTREY+Q Y FIQVDD  FE+VP VI DYD+C
Sbjct  5    KIEKMVKDSNGCITRLLFCGPNFPASNKYTREYLQNYPFIQVDDSSFEDVPDVIADYDMC  64

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            +VK++RL+S++IS A +MKLIMQFGVGLEGVDI AAT  GIKVARI SG TGNA SCAEM
Sbjct  65   IVKSMRLDSNIISRANKMKLIMQFGVGLEGVDINAATKCGIKVARIASGETGNAASCAEM  124

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYL+LGLLRK  EM I++KQK++GEPIGDTL GKTVFIM
Sbjct  125  AIYLMLGLLRKQKEMQISLKQKIVGEPIGDTLFGKTVFIM  164



>ref|XP_008218923.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X3 [Prunus mume]
Length=355

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  149  AGILGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            A I GK+ +M +N    ITRVLFCGP+FPASH YTREY++ Y F+QVDD+P ++VP VI+
Sbjct  5    ANISGKVERMVDNDEKKITRVLFCGPHFPASHTYTREYLKEYPFVQVDDVPLDDVPGVIQ  64

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
            +Y+IC+VK ++ +S+L+S A++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA 
Sbjct  65   NYNICIVKTMKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAA  124

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL+LGLLRK +EM IAIKQ+ +G+PIGDTLLGKTVFI+
Sbjct  125  SCAEMAIYLMLGLLRKQNEMQIAIKQRKVGDPIGDTLLGKTVFIL  169



>ref|XP_008218920.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X1 [Prunus mume]
Length=376

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  149  AGILGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            A I GK+ +M +N    ITRVLFCGP+FPASH YTREY++ Y F+QVDD+P ++VP VI+
Sbjct  26   ANISGKVERMVDNDEKKITRVLFCGPHFPASHTYTREYLKEYPFVQVDDVPLDDVPGVIQ  85

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
            +Y+IC+VK ++ +S+L+S A++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA 
Sbjct  86   NYNICIVKTMKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAA  145

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL+LGLLRK +EM IAIKQ+ +G+PIGDTLLGKTVFI+
Sbjct  146  SCAEMAIYLMLGLLRKQNEMQIAIKQRKVGDPIGDTLLGKTVFIL  190



>ref|XP_008218922.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X2 [Prunus mume]
Length=374

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  149  AGILGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            A I GK+ +M +N    ITRVLFCGP+FPASH YTREY++ Y F+QVDD+P ++VP VI+
Sbjct  26   ANISGKVERMVDNDEKKITRVLFCGPHFPASHTYTREYLKEYPFVQVDDVPLDDVPGVIQ  85

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
            +Y+IC+VK ++ +S+L+S A++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA 
Sbjct  86   NYNICIVKTMKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAA  145

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL+LGLLRK +EM IAIKQ+ +G+PIGDTLLGKTVFI+
Sbjct  146  SCAEMAIYLMLGLLRKQNEMQIAIKQRKVGDPIGDTLLGKTVFIL  190



>ref|XP_008218915.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X1 [Prunus mume]
Length=355

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  149  AGILGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            A ILGK+ +M +     ITRVLFCGP+FPASH YTREY++ + F+QVDD+P ++VP VI+
Sbjct  5    ADILGKVERMIDKDEKKITRVLFCGPHFPASHTYTREYLKEFPFVQVDDVPLDDVPGVIQ  64

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
            +Y+IC+VK ++ +S+L+S A++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA 
Sbjct  65   NYNICIVKTMKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAA  124

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL+LGLLRK +EM IAIKQ+ LG+PIGDTLLGKTVFI+
Sbjct  125  SCAEMAIYLMLGLLRKQNEMQIAIKQRKLGDPIGDTLLGKTVFIL  169



>ref|XP_010665337.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X2 [Vitis vinifera]
Length=356

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            KI KM ++ +  ITR+LFCGPNFPAS+ YTREY+Q Y FIQVDD  FE+VP VI DYD+C
Sbjct  10   KIEKMVKDSNGCITRLLFCGPNFPASNKYTREYLQNYPFIQVDDSSFEDVPDVIADYDMC  69

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            +VK++RL+S++IS A +MKLIMQFGVGLEGVDI AAT  GIKVARI SG TGNA SCAEM
Sbjct  70   IVKSMRLDSNIISRANKMKLIMQFGVGLEGVDINAATKCGIKVARIASGETGNAASCAEM  129

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYL+LGLLRK  EM I++KQK++GEPIGDTL GKTVFIM
Sbjct  130  AIYLMLGLLRKQKEMQISLKQKIVGEPIGDTLFGKTVFIM  169



>ref|XP_008218916.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X2 [Prunus mume]
Length=353

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 140/165 (85%), Gaps = 0/165 (0%)
 Frame = +2

Query  149  AGILGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            A ILGK+ +M +     ITRVLFCGP+FPASH YTREY++ + F+QVDD+P ++VP VI+
Sbjct  5    ADILGKVERMIDKDEKKITRVLFCGPHFPASHTYTREYLKEFPFVQVDDVPLDDVPGVIQ  64

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
            +Y+IC+VK ++ +S+L+S A++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA 
Sbjct  65   NYNICIVKTMKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAA  124

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL+LGLLRK +EM IAIKQ+ LG+PIGDTLLGKTVFI+
Sbjct  125  SCAEMAIYLMLGLLRKQNEMQIAIKQRKLGDPIGDTLLGKTVFIL  169



>ref|XP_002282092.2| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X1 [Vitis vinifera]
Length=382

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            KI KM ++ +  ITR+LFCGPNFPAS+ YTREY+Q Y FIQVDD  FE+VP VI DYD+C
Sbjct  36   KIEKMVKDSNGCITRLLFCGPNFPASNKYTREYLQNYPFIQVDDSSFEDVPDVIADYDMC  95

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            +VK++RL+S++IS A +MKLIMQFGVGLEGVDI AAT  GIKVARI SG TGNA SCAEM
Sbjct  96   IVKSMRLDSNIISRANKMKLIMQFGVGLEGVDINAATKCGIKVARIASGETGNAASCAEM  155

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYL+LGLLRK  EM I++KQK++GEPIGDTL GKTVFIM
Sbjct  156  AIYLMLGLLRKQKEMQISLKQKIVGEPIGDTLFGKTVFIM  195



>ref|XP_011003972.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Populus euphratica]
Length=390

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 145/200 (73%), Gaps = 6/200 (3%)
 Frame = +2

Query  44   KTSLFSNNSPTSGGGCRVVEHNFshhqqqqrhcssAGILGKILKMGENGSSHITRVLFCG  223
            KT+L S    T G  C +   N S              L ++ +M  N   HITRVLFCG
Sbjct  10   KTTLISAVKRTCGLPCALTLSNLSPLLFS------TDTLSEVEQMVGNSDKHITRVLFCG  63

Query  224  PNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKL  403
            P F ASH YT+EY+Q Y FIQVDD+PF  VP VI +Y+IC+VKN++L S++IS A +MKL
Sbjct  64   PYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYNICIVKNMQLTSNIISRATQMKL  123

Query  404  IMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK  583
            IMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCAEMAIYL+LGLLRK +EM I+IK
Sbjct  124  IMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIYLMLGLLRKQNEMQISIK  183

Query  584  QKMLGEPIGDTLLGKTVFIM  643
            QK LGEP G+TLLGKTVFIM
Sbjct  184  QKRLGEPAGETLLGKTVFIM  203



>ref|XP_011003977.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X6 [Populus euphratica]
Length=373

 Score =   239 bits (611),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            L ++ +M  N   HITRVLFCGP F ASH YT+EY+Q Y FIQVDD+PF  VP VI +Y+
Sbjct  46   LSEVEQMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYN  105

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            IC+VKN++L S++IS A +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCA
Sbjct  106  ICIVKNMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCA  165

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYL+LGLLRK +EM I+IKQK LGEP G+TLLGKTVFIM
Sbjct  166  EMAIYLMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIM  207



>ref|XP_007015902.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 4, partial [Theobroma cacao]
 gb|EOY33521.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 4, partial [Theobroma cacao]
Length=321

 Score =   238 bits (607),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            K+ K   +    ITRVLFCGP+FPAS NYTREY++ Y +IQVDD+P ++VP  I +Y +C
Sbjct  4    KVEKRDADNDKPITRVLFCGPHFPASQNYTREYLEKYPYIQVDDVPLKDVPDHIGNYHLC  63

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            VVKN+RL+S++IS A +MKLIMQFGVGLEGVDI AAT HGIKVARIPS ATGNA SCAEM
Sbjct  64   VVKNMRLDSNVISRANQMKLIMQFGVGLEGVDIDAATKHGIKVARIPSDATGNAASCAEM  123

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYL+LGLLRK +EM I++KQK LGEP+G+TLLG+TVFIM
Sbjct  124  AIYLMLGLLRKQNEMQISVKQKKLGEPVGETLLGQTVFIM  163



>ref|XP_007223301.1| hypothetical protein PRUPE_ppa007293mg [Prunus persica]
 gb|EMJ24500.1| hypothetical protein PRUPE_ppa007293mg [Prunus persica]
Length=374

 Score =   239 bits (610),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 139/165 (84%), Gaps = 0/165 (0%)
 Frame = +2

Query  149  AGILGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            A ILGK+ +M +N    ITRVLFCGP+FPASH YTREY++ Y F+QVDD+P ++VP VI+
Sbjct  26   ANILGKVERMVDNDEKKITRVLFCGPHFPASHTYTREYLKEYPFVQVDDVPLDDVPGVIQ  85

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
            +Y+IC+VK ++ +S L+S A++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA 
Sbjct  86   NYNICIVKTMKFDSILLSHAEKMKLIMQYGVGLEGVDIDSATEFGIKVARIPSHVTGNAA  145

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL+LGLLRK +EM IAIKQ+ +G+PIGD LLGKTVFI+
Sbjct  146  SCAEMAIYLMLGLLRKQNEMQIAIKQRKVGDPIGDMLLGKTVFIL  190



>ref|XP_011003976.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X5 [Populus euphratica]
Length=388

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            L ++ +M  N   HITRVLFCGP F ASH YT+EY+Q Y FIQVDD+PF  VP VI +Y+
Sbjct  46   LSEVEQMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYN  105

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            IC+VKN++L S++IS A +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCA
Sbjct  106  ICIVKNMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCA  165

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYL+LGLLRK +EM I+IKQK LGEP G+TLLGKTVFIM
Sbjct  166  EMAIYLMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIM  207



>ref|XP_007015900.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY33519.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
Length=349

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            K+ K   +    ITRVLFCGP+FPAS NYTREY++ Y +IQVDD+P ++VP  I +Y +C
Sbjct  4    KVEKRDADNDKPITRVLFCGPHFPASQNYTREYLEKYPYIQVDDVPLKDVPDHIGNYHLC  63

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            VVKN+RL+S++IS A +MKLIMQFGVGLEGVDI AAT HGIKVARIPS ATGNA SCAEM
Sbjct  64   VVKNMRLDSNVISRANQMKLIMQFGVGLEGVDIDAATKHGIKVARIPSDATGNAASCAEM  123

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYL+LGLLRK +EM I++KQK LGEP+G+TLLG+TVFIM
Sbjct  124  AIYLMLGLLRKQNEMQISVKQKKLGEPVGETLLGQTVFIM  163



>ref|XP_011003975.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X4 [Populus euphratica]
Length=388

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            L ++ +M  N   HITRVLFCGP F ASH YT+EY+Q Y FIQVDD+PF  VP VI +Y+
Sbjct  40   LSEVEQMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYN  99

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            IC+VKN++L S++IS A +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCA
Sbjct  100  ICIVKNMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCA  159

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYL+LGLLRK +EM I+IKQK LGEP G+TLLGKTVFIM
Sbjct  160  EMAIYLMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIM  201



>ref|XP_011003974.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X3 [Populus euphratica]
Length=390

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            L ++ +M  N   HITRVLFCGP F ASH YT+EY+Q Y FIQVDD+PF  VP VI +Y+
Sbjct  42   LSEVEQMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYN  101

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            IC+VKN++L S++IS A +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCA
Sbjct  102  ICIVKNMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCA  161

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYL+LGLLRK +EM I+IKQK LGEP G+TLLGKTVFIM
Sbjct  162  EMAIYLMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIM  203



>ref|XP_011003971.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Populus euphratica]
Length=394

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            L ++ +M  N   HITRVLFCGP F ASH YT+EY+Q Y FIQVDD+PF  VP VI +Y+
Sbjct  46   LSEVEQMVGNSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYN  105

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            IC+VKN++L S++IS A +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCA
Sbjct  106  ICIVKNMQLTSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCA  165

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYL+LGLLRK +EM I+IKQK LGEP G+TLLGKTVFIM
Sbjct  166  EMAIYLMLGLLRKQNEMQISIKQKRLGEPAGETLLGKTVFIM  207



>gb|ABK96037.1| unknown [Populus trichocarpa]
Length=343

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  185  NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRL  364
            N   HITRVLFCGP FPASH YT+EY+Q Y FIQVDD+P   VP VI +Y+IC+VKN+RL
Sbjct  4    NSDKHITRVLFCGPYFPASHQYTKEYLQKYPFIQVDDVPLAVVPDVISNYNICIVKNMRL  63

Query  365  NSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILG  544
             S++IS A +MKLIMQFGVG+EGVDI AAT +GIKVARIP  ATGNA SCAEMAIYL+LG
Sbjct  64   TSNIISRATQMKLIMQFGVGIEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIYLMLG  123

Query  545  LLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            LLRK +EM I+IKQK LGEP G+TL GKTVFIM
Sbjct  124  LLRKQNEMQISIKQKRLGEPAGETLFGKTVFIM  156



>ref|XP_011003978.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X7 [Populus euphratica]
Length=343

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = +2

Query  185  NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRL  364
            N   HITRVLFCGP F ASH YT+EY+Q Y FIQVDD+PF  VP VI +Y+IC+VKN++L
Sbjct  4    NSDKHITRVLFCGPYFAASHQYTKEYLQKYPFIQVDDVPFAVVPDVISNYNICIVKNMQL  63

Query  365  NSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILG  544
             S++IS A +MKLIMQFGVGLEGVDI AAT +GIKVARIP  ATGNA SCAEMAIYL+LG
Sbjct  64   TSNIISRATQMKLIMQFGVGLEGVDIDAATKYGIKVARIPGDATGNAASCAEMAIYLMLG  123

Query  545  LLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            LLRK +EM I+IKQK LGEP G+TLLGKTVFIM
Sbjct  124  LLRKQNEMQISIKQKRLGEPAGETLLGKTVFIM  156



>ref|XP_007015899.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY33518.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
Length=384

 Score =   238 bits (606),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            K+ K   +    ITRVLFCGP+FPAS NYTREY++ Y +IQVDD+P ++VP  I +Y +C
Sbjct  39   KVEKRDADNDKPITRVLFCGPHFPASQNYTREYLEKYPYIQVDDVPLKDVPDHIGNYHLC  98

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            VVKN+RL+S++IS A +MKLIMQFGVGLEGVDI AAT HGIKVARIPS ATGNA SCAEM
Sbjct  99   VVKNMRLDSNVISRANQMKLIMQFGVGLEGVDIDAATKHGIKVARIPSDATGNAASCAEM  158

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYL+LGLLRK +EM I++KQK LGEP+G+TLLG+TVFIM
Sbjct  159  AIYLMLGLLRKQNEMQISVKQKKLGEPVGETLLGQTVFIM  198



>ref|XP_007015901.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY33520.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
Length=387

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 135/160 (84%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            K+ K   +    ITRVLFCGP+FPAS NYTREY++ Y +IQVDD+P ++VP  I +Y +C
Sbjct  42   KVEKRDADNDKPITRVLFCGPHFPASQNYTREYLEKYPYIQVDDVPLKDVPDHIGNYHLC  101

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            VVKN+RL+S++IS A +MKLIMQFGVGLEGVDI AAT HGIKVARIPS ATGNA SCAEM
Sbjct  102  VVKNMRLDSNVISRANQMKLIMQFGVGLEGVDIDAATKHGIKVARIPSDATGNAASCAEM  161

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYL+LGLLRK +EM I++KQK LGEP+G+TLLG+TVFIM
Sbjct  162  AIYLMLGLLRKQNEMQISVKQKKLGEPVGETLLGQTVFIM  201



>ref|XP_010665339.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 isoform 
X4 [Vitis vinifera]
 emb|CBI39250.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   236 bits (602),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M ++ +  ITR+LFCGPNFPAS+ YTREY+Q Y FIQVDD  FE+VP VI DYD+C+VK+
Sbjct  1    MVKDSNGCITRLLFCGPNFPASNKYTREYLQNYPFIQVDDSSFEDVPDVIADYDMCIVKS  60

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            +RL+S++IS A +MKLIMQFGVGLEGVDI AAT  GIKVARI SG TGNA SCAEMAIYL
Sbjct  61   MRLDSNIISRANKMKLIMQFGVGLEGVDINAATKCGIKVARIASGETGNAASCAEMAIYL  120

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK  EM I++KQK++GEPIGDTL GKTVFIM
Sbjct  121  MLGLLRKQKEMQISLKQKIVGEPIGDTLFGKTVFIM  156



>ref|XP_010243882.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Nelumbo nucifera]
 ref|XP_010243884.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Nelumbo nucifera]
Length=404

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            K+ KM EN  S +TRVLFCGP FPASH YTREY+Q Y FIQVDD+P ++VP+VI +YDIC
Sbjct  51   KVEKMVENNDSQVTRVLFCGPQFPASHKYTREYLQNYPFIQVDDVPLDDVPSVIGNYDIC  110

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            V K  +L+S +I  A R+KLI+QFGVGLEGVD+ AAT +GIKVARIP   TGNA SCAEM
Sbjct  111  VPKMKKLDSKVIDCAIRLKLIVQFGVGLEGVDVDAATRYGIKVARIPGNVTGNAASCAEM  170

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYLIL LLRK  EM IA+ QK LGEPIG+TL GKTVFIM
Sbjct  171  AIYLILSLLRKQKEMQIAVDQKRLGEPIGETLFGKTVFIM  210



>ref|XP_010910119.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Elaeis guineensis]
Length=344

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = +2

Query  179  GENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNL  358
             ENG +HITRVLFCG +FPAS NYTREY+Q Y FIQVDD+  ++VP VI  Y ICV KN 
Sbjct  6    AENGYNHITRVLFCGFHFPASQNYTREYLQKYPFIQVDDVALDDVPDVIDKYHICVAKNR  65

Query  359  RLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLI  538
            RL+S +I+ A +MKLIMQFGVGLEGVDI AAT H IKVARIP   TGN+ SCAEMAIYL+
Sbjct  66   RLDSKVIAKAVQMKLIMQFGVGLEGVDIDAATQHKIKVARIPGSVTGNSASCAEMAIYLM  125

Query  539  LGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            LGLLRK  EMD+A+KQK LGEPIGDT+LGKTVFI+
Sbjct  126  LGLLRKQKEMDVAVKQKNLGEPIGDTILGKTVFIL  160



>gb|KHG10814.1| Glyoxylate reductase [Gossypium arboreum]
Length=383

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 133/165 (81%), Gaps = 0/165 (0%)
 Frame = +2

Query  149  AGILGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            AG+     K   +    ITRVLFCGP+FPAS  YTREY++ Y FIQVDD+P + VP  I 
Sbjct  33   AGMSSMAEKKDVDNDKPITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHIG  92

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
            +YD+CV KN+R +S+++S AK+MKLIMQFGVGLEG+DI AA  HGIKVARIP  ATGNA 
Sbjct  93   NYDLCVSKNMRFDSNVLSRAKQMKLIMQFGVGLEGIDIDAAKKHGIKVARIPGDATGNAA  152

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL+LGLLRK +EM I++KQKMLGEPIG+TLLGKTVFIM
Sbjct  153  SCAEMAIYLMLGLLRKQNEMQISVKQKMLGEPIGETLLGKTVFIM  197



>ref|XP_010910114.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Elaeis guineensis]
Length=379

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 128/154 (83%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            ENG +HITRVLFCG +FPAS NYTREY+Q Y FIQVDD+  ++VP VI  Y ICV KN R
Sbjct  42   ENGYNHITRVLFCGFHFPASQNYTREYLQKYPFIQVDDVALDDVPDVIDKYHICVAKNRR  101

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
            L+S +I+ A +MKLIMQFGVGLEGVDI AAT H IKVARIP   TGN+ SCAEMAIYL+L
Sbjct  102  LDSKVIAKAVQMKLIMQFGVGLEGVDIDAATQHKIKVARIPGSVTGNSASCAEMAIYLML  161

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GLLRK  EMD+A+KQK LGEPIGDT+LGKTVFI+
Sbjct  162  GLLRKQKEMDVAVKQKNLGEPIGDTILGKTVFIL  195



>ref|XP_010243885.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
 ref|XP_010243886.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
 ref|XP_010243887.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
 ref|XP_010243888.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X2 [Nelumbo nucifera]
Length=350

 Score =   232 bits (591),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M EN  S +TRVLFCGP FPASH YTREY+Q Y FIQVDD+P ++VP+VI +YDICV K 
Sbjct  1    MVENNDSQVTRVLFCGPQFPASHKYTREYLQNYPFIQVDDVPLDDVPSVIGNYDICVPKM  60

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
             +L+S +I  A R+KLI+QFGVGLEGVD+ AAT +GIKVARIP   TGNA SCAEMAIYL
Sbjct  61   KKLDSKVIDCAIRLKLIVQFGVGLEGVDVDAATRYGIKVARIPGNVTGNAASCAEMAIYL  120

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            IL LLRK  EM IA+ QK LGEPIG+TL GKTVFIM
Sbjct  121  ILSLLRKQKEMQIAVDQKRLGEPIGETLFGKTVFIM  156



>gb|KJB55666.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=338

 Score =   231 bits (589),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            ITRVLFCGP+FPAS  YTREY++ Y FIQVDD+P + VP  I +YD+CV KN+  +S+++
Sbjct  16   ITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHIGNYDLCVSKNMLFDSNVL  75

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S AK+MKLIMQFGVGLEG+DI AAT HGIKVARIP  ATGNA SCAEMAIYL LGLLRK 
Sbjct  76   SRAKQMKLIMQFGVGLEGIDIDAATKHGIKVARIPGDATGNAASCAEMAIYLTLGLLRKQ  135

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM I++KQKMLGEPIG+TLLGKTVFIM
Sbjct  136  NEMQISVKQKMLGEPIGETLLGKTVFIM  163



>gb|KJB55660.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55661.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55662.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=349

 Score =   231 bits (590),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            ITRVLFCGP+FPAS  YTREY++ Y FIQVDD+P + VP  I +YD+CV KN+  +S+++
Sbjct  16   ITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHIGNYDLCVSKNMLFDSNVL  75

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S AK+MKLIMQFGVGLEG+DI AAT HGIKVARIP  ATGNA SCAEMAIYL LGLLRK 
Sbjct  76   SRAKQMKLIMQFGVGLEGIDIDAATKHGIKVARIPGDATGNAASCAEMAIYLTLGLLRKQ  135

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM I++KQKMLGEPIG+TLLGKTVFIM
Sbjct  136  NEMQISVKQKMLGEPIGETLLGKTVFIM  163



>ref|XP_008218917.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X3 [Prunus mume]
 ref|XP_008218918.1| PREDICTED: formate dehydrogenase, mitochondrial-like isoform 
X3 [Prunus mume]
Length=342

 Score =   231 bits (589),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M +     ITRVLFCGP+FPASH YTREY++ + F+QVDD+P ++VP VI++Y+IC+VK 
Sbjct  1    MIDKDEKKITRVLFCGPHFPASHTYTREYLKEFPFVQVDDVPLDDVPGVIQNYNICIVKT  60

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            ++ +S+L+S A++MKLIMQ+GVGLEGVDI +AT  GIKVARIPS  TGNA SCAEMAIYL
Sbjct  61   MKFDSNLLSRAEKMKLIMQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAASCAEMAIYL  120

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK +EM IAIKQ+ LG+PIGDTLLGKTVFI+
Sbjct  121  MLGLLRKQNEMQIAIKQRKLGDPIGDTLLGKTVFIL  156



>ref|XP_011074952.1| PREDICTED: formate dehydrogenase, mitochondrial [Sesamum indicum]
Length=406

 Score =   233 bits (594),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 134/164 (82%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  GILGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKD  331
            G+LG   +M  +    ITRVLFCGP FPASHNYT+EY+Q +  I+VD +P ++VP  I +
Sbjct  56   GLLGNFQEMTGDSGKPITRVLFCGPQFPASHNYTKEYLQSHPCIKVDVVPLDDVPHAIGN  115

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            YDICVVKN+RL++D+I+ A ++KLIMQFGVGLEGVD+ +AT HGIKVARIP  ATGNA S
Sbjct  116  YDICVVKNMRLSADVIARANKLKLIMQFGVGLEGVDLNSATKHGIKVARIPGDATGNAAS  175

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            CAEMAIY +LGLLRK +EM +A+KQK LGEP+GD LLGKT+FIM
Sbjct  176  CAEMAIYQMLGLLRKQYEMQVAVKQKKLGEPVGDMLLGKTIFIM  219



>gb|KJB55664.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=383

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            ITRVLFCGP+FPAS  YTREY++ Y FIQVDD+P + VP  I +YD+CV KN+  +S+++
Sbjct  50   ITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHIGNYDLCVSKNMLFDSNVL  109

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S AK+MKLIMQFGVGLEG+DI AAT HGIKVARIP  ATGNA SCAEMAIYL LGLLRK 
Sbjct  110  SRAKQMKLIMQFGVGLEGIDIDAATKHGIKVARIPGDATGNAASCAEMAIYLTLGLLRKQ  169

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM I++KQKMLGEPIG+TLLGKTVFIM
Sbjct  170  NEMQISVKQKMLGEPIGETLLGKTVFIM  197



>ref|XP_010095912.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
 gb|EXB62506.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Morus 
notabilis]
Length=358

 Score =   229 bits (583),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 127/150 (85%), Gaps = 0/150 (0%)
 Frame = +2

Query  185  NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRL  364
            N    ITRV+FCGP+FPASHNYTR+Y+Q Y FIQVD++P ++VP VI++Y +CVVK ++L
Sbjct  10   NAQEKITRVIFCGPHFPASHNYTRQYLQDYPFIQVDEVPLDDVPKVIENYHLCVVKMMKL  69

Query  365  NSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILG  544
            +S +I+ AK MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAEMAIYLILG
Sbjct  70   DSHIIARAKEMKLIMQFGVGLEGVDINAATKFGIKVARIPGDVTGNAASCAEMAIYLILG  129

Query  545  LLRKXHEMDIAIKQKMLGEPIGDTLLGKTV  634
            LLRK +EM IAIK++ LGEP+G+TL+GKT+
Sbjct  130  LLRKQNEMQIAIKERKLGEPVGETLVGKTL  159



>ref|XP_011457341.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011457342.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011457343.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
 ref|XP_011457344.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=335

 Score =   224 bits (571),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/148 (70%), Positives = 130/148 (88%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            IT VLFCGP+FPAS +YTREY+  Y F+QVDD+P  +VP VI++YDIC+VK+++L+ D++
Sbjct  8    ITHVLFCGPHFPASEDYTREYLIDYPFVQVDDVPLADVPDVIENYDICIVKSMKLDFDVL  67

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S AK+MKLIMQ+GVGLEGV+I AAT  GIKVARIPS ATGNA SCAEM+IYL+LGLLRK 
Sbjct  68   SRAKKMKLIMQYGVGLEGVEIDAATKFGIKVARIPSHATGNAASCAEMSIYLMLGLLRKQ  127

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM I+IKQ+ LG+PIG+TLLGKTVFI+
Sbjct  128  NEMQISIKQRKLGDPIGETLLGKTVFIL  155



>ref|XP_007015898.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
 gb|EOY33517.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 3 [Theobroma cacao]
Length=329

 Score =   223 bits (567),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            ITRVLFCGP+FPAS NYTREY++ Y FIQVD++  ++VP  I +Y +CVV N+RL+S++I
Sbjct  10   ITRVLFCGPHFPASQNYTREYLEKYPFIQVDEVALKDVPDHIGNYHLCVVLNMRLDSNVI  69

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A +MKLIMQFGVGLEGVD+ AAT  GIKVARIP  ATGNA SCAEMAIYLILGLLRK 
Sbjct  70   SRANQMKLIMQFGVGLEGVDVDAATRLGIKVARIPGDATGNAASCAEMAIYLILGLLRKQ  129

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM I++KQK LGEP+G+TL GKTVFIM
Sbjct  130  NEMQISVKQKKLGEPLGETLFGKTVFIM  157



>gb|KCW70960.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=252

 Score =   220 bits (560),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            E+G   +TRVLFCGP+FPAS +YTREY+  Y FIQVD+   ++VP VI +Y +CVVKN R
Sbjct  4    ESGEQGVTRVLFCGPHFPASQDYTREYLSQYPFIQVDEAALDDVPRVIGNYHLCVVKNKR  63

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
             +SD+I+ AK+MKL+MQFGVGLEGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+L
Sbjct  64   FDSDIIARAKQMKLLMQFGVGLEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLML  123

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GLLRK +E+  ++ Q+ LGEP+G+TL GKTV IM
Sbjct  124  GLLRKQNEIQTSVNQRKLGEPVGETLFGKTVLIM  157



>gb|KDO56056.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
 gb|KDO56057.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
 gb|KDO56058.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
 gb|KDO56059.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
Length=210

 Score =   218 bits (556),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  159



>gb|KDO56053.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
Length=226

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  159



>ref|XP_007015897.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
 gb|EOY33516.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 2 [Theobroma cacao]
Length=343

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/148 (72%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            ITRVLFCGP+FPAS NYTREY++ Y FIQVD++  ++VP  I +Y +CVV N+RL+S++I
Sbjct  10   ITRVLFCGPHFPASQNYTREYLEKYPFIQVDEVALKDVPDHIGNYHLCVVLNMRLDSNVI  69

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A +MKLIMQFGVGLEGVD+ AAT  GIKVARIP  ATGNA SCAEMAIYLILGLLRK 
Sbjct  70   SRANQMKLIMQFGVGLEGVDVDAATRLGIKVARIPGDATGNAASCAEMAIYLILGLLRKQ  129

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM I++KQK LGEP+G+TL GKTVFIM
Sbjct  130  NEMQISVKQKKLGEPLGETLFGKTVFIM  157



>gb|KDO56054.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
Length=218

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  159



>gb|KCW70956.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=272

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            E+G   +TRVLFCGP+FPAS +YTREY+  Y FIQVD+   ++VP VI +Y +CVVKN R
Sbjct  4    ESGEQGVTRVLFCGPHFPASQDYTREYLSQYPFIQVDEAALDDVPRVIGNYHLCVVKNKR  63

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
             +SD+I+ AK+MKL+MQFGVGLEGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+L
Sbjct  64   FDSDIIARAKQMKLLMQFGVGLEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLML  123

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GLLRK +E+  ++ Q+ LGEP+G+TL GKTV IM
Sbjct  124  GLLRKQNEIQTSVNQRKLGEPVGETLFGKTVLIM  157



>ref|XP_008802910.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X2 [Phoenix dactylifera]
 ref|XP_008802911.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=344

 Score =   222 bits (566),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +2

Query  179  GENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNL  358
             ENG +HITRVLFCG  + AS  YTREY+Q Y FIQ+D++  ++VP VI  Y ICVVKN 
Sbjct  6    AENGYNHITRVLFCGFYWSASQKYTREYLQNYPFIQIDEVALDDVPDVIDKYHICVVKNR  65

Query  359  RLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLI  538
            R++S +I+ A +MKLIMQFGVGLEGVDI AAT H IKVARIP   TGN+ SCAEMAIYL+
Sbjct  66   RMDSKVIAKAVQMKLIMQFGVGLEGVDIDAATRHKIKVARIPGSVTGNSASCAEMAIYLM  125

Query  539  LGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            LGLLRK  EMD+A+KQK LGEP GDTLLGKTV I+
Sbjct  126  LGLLRKQKEMDVAVKQKNLGEPTGDTLLGKTVLIL  160



>ref|XP_006441524.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54764.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=285

 Score =   219 bits (559),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            + K+  M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +Y 
Sbjct  73   ISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYH  132

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +CVVK +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCA
Sbjct  133  LCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCA  192

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            E+ IYL+LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  193  ELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  234



>ref|XP_006441523.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54763.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|KDO56055.1| hypothetical protein CISIN_1g0174901mg [Citrus sinensis]
Length=269

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  159



>ref|XP_010535279.1| PREDICTED: formate dehydrogenase, mitochondrial [Tarenaya hassleriana]
Length=367

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  197  HITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDL  376
             +TRVLFCGP+FP+SHNYTR Y+Q Y FIQVD +P  +VP VIK+Y +CVVK +RL+S++
Sbjct  45   QVTRVLFCGPHFPSSHNYTRGYLQKYPFIQVDVVPLSDVPDVIKNYQMCVVKTMRLDSNV  104

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            IS A +MKLIMQ+GVGLEGVDI AAT HGIKVARI S  TGNA SCAEMA+YL+LGLL+K
Sbjct  105  ISRASQMKLIMQYGVGLEGVDIDAATKHGIKVARILSDGTGNAASCAEMAMYLMLGLLKK  164

Query  557  XHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             +EM I+++ ++LG+P G+TLLGKTVFI+
Sbjct  165  QNEMQISVRDRLLGQPAGETLLGKTVFIL  193



>ref|XP_002521771.1| phosphoglycerate dehydrogenase, putative [Ricinus communis]
 gb|EEF40581.1| phosphoglycerate dehydrogenase, putative [Ricinus communis]
Length=380

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M  + S++ITRVLFCGP+FPASH YT++Y+Q Y FIQVDD+P  +VP VI +Y ICV K 
Sbjct  38   MAGDNSNYITRVLFCGPHFPASHIYTKQYLQKYPFIQVDDVPLNDVPNVIANYHICVSKT  97

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
             R++S +IS A +MKLIMQFGVGLEG++I AA+  GIKVARIP   TGNA SCAEMAIYL
Sbjct  98   TRIDSSIISRATQMKLIMQFGVGLEGINIDAASRCGIKVARIPGDFTGNAASCAEMAIYL  157

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK ++M ++IKQK LGEPIG+TLLGKTVFI+
Sbjct  158  MLGLLRKQNQMQVSIKQKKLGEPIGETLLGKTVFIL  193



>ref|XP_008667394.1| PREDICTED: uncharacterized protein LOC100217241 isoform X2 [Zea 
mays]
Length=386

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 129/169 (76%), Gaps = 4/169 (2%)
 Frame = +2

Query  149  AGILGKILKMGE----NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVP  316
            AG+ G+  KMG+    NG   +TRVLFCGP +PAS NYTREY+Q Y FIQVD++  E VP
Sbjct  42   AGLPGQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLEQVP  101

Query  317  AVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGAT  496
             VI  Y ICVVKN R++SD+I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   T
Sbjct  102  DVIHSYHICVVKNKRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTT  161

Query  497  GNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GNA SCAEMAIYL LG+LRK  EMD A+ +K LG P+GDTL GKT+ I+
Sbjct  162  GNAVSCAEMAIYLTLGILRKQKEMDTAVNRKDLGVPVGDTLFGKTILIL  210



>ref|XP_008802909.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=379

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 124/155 (80%), Gaps = 0/155 (0%)
 Frame = +2

Query  179  GENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNL  358
             ENG +HITRVLFCG  + AS  YTREY+Q Y FIQ+D++  ++VP VI  Y ICVVKN 
Sbjct  41   AENGYNHITRVLFCGFYWSASQKYTREYLQNYPFIQIDEVALDDVPDVIDKYHICVVKNR  100

Query  359  RLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLI  538
            R++S +I+ A +MKLIMQFGVGLEGVDI AAT H IKVARIP   TGN+ SCAEMAIYL+
Sbjct  101  RMDSKVIAKAVQMKLIMQFGVGLEGVDIDAATRHKIKVARIPGSVTGNSASCAEMAIYLM  160

Query  539  LGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            LGLLRK  EMD+A+KQK LGEP GDTLLGKTV I+
Sbjct  161  LGLLRKQKEMDVAVKQKNLGEPTGDTLLGKTVLIL  195



>ref|XP_010063709.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic 
isoform X1 [Eucalyptus grandis]
Length=344

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            E+G   +TRVLFCGP+FPAS +YTREY+  Y FIQVD+   ++VP VI +Y +CVVKN R
Sbjct  4    ESGEQGVTRVLFCGPHFPASQDYTREYLSQYPFIQVDEAALDDVPRVIGNYHLCVVKNKR  63

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
             +SD+I+ AK+MKL+MQFGVGLEGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+L
Sbjct  64   FDSDIIARAKQMKLLMQFGVGLEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLML  123

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GLLRK +E+  ++ Q+ LGEP+G+TL GKTV IM
Sbjct  124  GLLRKQNEIQTSVNQRKLGEPVGETLFGKTVLIM  157



>gb|KDO56049.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
Length=348

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  GILGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKD  331
            G + K+  M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +
Sbjct  20   GDISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIAN  79

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            Y +CVVK +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA S
Sbjct  80   YHLCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAAS  139

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            CAE+ IYL+LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  140  CAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  183



>ref|XP_010063710.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic 
isoform X2 [Eucalyptus grandis]
 gb|KCW70957.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=343

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 126/154 (82%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            E+G   +TRVLFCGP+FPAS +YTREY+  Y FIQVD+   ++VP VI +Y +CVVKN R
Sbjct  4    ESGEQGVTRVLFCGPHFPASQDYTREYLSQYPFIQVDEAALDDVPRVIGNYHLCVVKNKR  63

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
             +SD+I+ AK+MKL+MQFGVGLEGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+L
Sbjct  64   FDSDIIARAKQMKLLMQFGVGLEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLML  123

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GLLRK +E+  ++ Q+ LGEP+G+TL GKTV IM
Sbjct  124  GLLRKQNEIQTSVNQRKLGEPVGETLFGKTVLIM  157



>ref|XP_006441520.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 ref|XP_006441525.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54760.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54765.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=344

 Score =   219 bits (559),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            + K+  M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +Y 
Sbjct  73   ISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYH  132

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +CVVK +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCA
Sbjct  133  LCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCA  192

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            E+ IYL+LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  193  ELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  234



>ref|XP_004499721.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X2 
[Cicer arietinum]
Length=379

 Score =   220 bits (561),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            ITRVLFCGP+FPASH YT EY+Q +SFI+VD +P E VP  I +Y +C+VK +RL+S++I
Sbjct  52   ITRVLFCGPHFPASHQYTTEYLQNHSFIKVDVLPLEEVPKAISNYHVCIVKMMRLDSNII  111

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A +M+LIMQ+GVGLEG+DI AAT HGIKVARIPS  TGNA SCAEMAIYL+LGLLRK 
Sbjct  112  SRAVQMQLIMQYGVGLEGIDIDAATKHGIKVARIPSDVTGNAASCAEMAIYLMLGLLRKQ  171

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +E+ I+I+Q+ LG+PI DTL GKT+FI+
Sbjct  172  NELQISIQQRKLGDPITDTLFGKTIFIL  199



>gb|KDO56050.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
 gb|KDO56051.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
 gb|KDO56052.1| hypothetical protein CISIN_1g0174901mg, partial [Citrus sinensis]
Length=324

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  159



>ref|XP_006478175.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X3 
[Citrus sinensis]
Length=370

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = +2

Query  152  GILGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKD  331
            G + K+  M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD IP  + P VI +
Sbjct  20   GDISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVIPISDAPDVIAN  79

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            Y +CVVK +RL+S++IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA S
Sbjct  80   YHLCVVKTMRLDSNVISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAAS  139

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            CAE+ IYL+LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  140  CAELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  183



>tpg|DAA39792.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=395

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 129/169 (76%), Gaps = 4/169 (2%)
 Frame = +2

Query  149  AGILGKILKMGE----NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVP  316
            +G +G+  KMG+    NG   +TRVLFCGP +PAS NYTREY+Q Y FIQVD++  E VP
Sbjct  51   SGCVGQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLEQVP  110

Query  317  AVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGAT  496
             VI  Y ICVVKN R++SD+I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   T
Sbjct  111  DVIHSYHICVVKNKRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTT  170

Query  497  GNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GNA SCAEMAIYL LG+LRK  EMD A+ +K LG P+GDTL GKT+ I+
Sbjct  171  GNAVSCAEMAIYLTLGILRKQKEMDTAVNRKDLGVPVGDTLFGKTILIL  219



>ref|XP_008667393.1| PREDICTED: uncharacterized protein LOC100217241 isoform X1 [Zea 
mays]
Length=423

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 129/169 (76%), Gaps = 4/169 (2%)
 Frame = +2

Query  149  AGILGKILKMGE----NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVP  316
            AG+ G+  KMG+    NG   +TRVLFCGP +PAS NYTREY+Q Y FIQVD++  E VP
Sbjct  79   AGLPGQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLEQVP  138

Query  317  AVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGAT  496
             VI  Y ICVVKN R++SD+I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   T
Sbjct  139  DVIHSYHICVVKNKRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTT  198

Query  497  GNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GNA SCAEMAIYL LG+LRK  EMD A+ +K LG P+GDTL GKT+ I+
Sbjct  199  GNAVSCAEMAIYLTLGILRKQKEMDTAVNRKDLGVPVGDTLFGKTILIL  247



>gb|AFK43325.1| unknown [Medicago truncatula]
Length=344

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 128/162 (79%), Gaps = 6/162 (4%)
 Frame = +2

Query  176  MGENGS------SHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            M  NGS         TRVLFCGP FP SH YT EY+Q +S I+VD +P E +P  I +Y 
Sbjct  1    MERNGSMINDVERKTTRVLFCGPQFPCSHLYTTEYLQNHSSIKVDVLPLEEIPKAIANYH  60

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +CVVK ++L+S++IS A +MKLIMQ+GVGLEGVDI AAT HGIKVARIPSG TGN+T+CA
Sbjct  61   VCVVKMMKLDSNIISRAVQMKLIMQYGVGLEGVDIDAATKHGIKVARIPSGGTGNSTACA  120

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYL+LGLLRK +EM I+I+Q+ LGEPIGDTL GKT+FI+
Sbjct  121  EMAIYLMLGLLRKQNEMQISIQQRKLGEPIGDTLFGKTIFIL  162



>ref|XP_004499720.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X1 
[Cicer arietinum]
Length=388

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            ITRVLFCGP+FPASH YT EY+Q +SFI+VD +P E VP  I +Y +C+VK +RL+S++I
Sbjct  52   ITRVLFCGPHFPASHQYTTEYLQNHSFIKVDVLPLEEVPKAISNYHVCIVKMMRLDSNII  111

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A +M+LIMQ+GVGLEG+DI AAT HGIKVARIPS  TGNA SCAEMAIYL+LGLLRK 
Sbjct  112  SRAVQMQLIMQYGVGLEGIDIDAATKHGIKVARIPSDVTGNAASCAEMAIYLMLGLLRKQ  171

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +E+ I+I+Q+ LG+PI DTL GKT+FI+
Sbjct  172  NELQISIQQRKLGDPITDTLFGKTIFIL  199



>ref|XP_003598073.1| D-3-phosphoglycerate dehydrogenase [Medicago truncatula]
 gb|AES68324.1| D-isomer specific 2-hydroxyacid dehydrogenase domain protein 
[Medicago truncatula]
Length=382

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 128/162 (79%), Gaps = 6/162 (4%)
 Frame = +2

Query  176  MGENGS------SHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            M  NGS         TRVLFCGP FP SH YT EY+Q +S I+VD +P E +P  I +Y 
Sbjct  39   MERNGSMINDVERKTTRVLFCGPQFPCSHLYTTEYLQNHSSIKVDVLPLEEIPKAIANYH  98

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +CVVK ++L+S++IS A +MKLIMQ+GVGLEGVDI AAT HGIKVARIPSG TGN+T+CA
Sbjct  99   VCVVKMMKLDSNIISRAVQMKLIMQYGVGLEGVDIDAATKHGIKVARIPSGGTGNSTACA  158

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYL+LGLLRK +EM I+I+Q+ LGEPIGDTL GKT+FI+
Sbjct  159  EMAIYLMLGLLRKQNEMQISIQQRKLGEPIGDTLFGKTIFIL  200



>ref|XP_006441517.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 ref|XP_006441519.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 ref|XP_006441522.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54757.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54759.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54762.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=346

 Score =   218 bits (556),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYHLCVVKT  63

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  159



>ref|XP_006390689.1| hypothetical protein EUTSA_v10018793mg [Eutrema salsugineum]
 gb|ESQ27975.1| hypothetical protein EUTSA_v10018793mg [Eutrema salsugineum]
Length=350

 Score =   218 bits (556),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 129/148 (87%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            +TRVLFCGP+FP S+N+TR+YVQ Y FIQVD +P  +VP VIK+Y ICVVK+++L+S++I
Sbjct  28   VTRVLFCGPHFPDSNNFTRDYVQPYPFIQVDVVPLGDVPEVIKNYHICVVKSMQLDSNVI  87

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A +MK+IMQ+GVGLEGVDI AAT +GIKVARIPS  TGNA SC+EMAIYL+LGLL+K 
Sbjct  88   SRATKMKIIMQYGVGLEGVDIDAATKNGIKVARIPSEGTGNAASCSEMAIYLMLGLLKKQ  147

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM I+++ ++LG+P GDTLLGKTVFI+
Sbjct  148  NEMQISVQSRLLGQPTGDTLLGKTVFIL  175



>ref|XP_006478176.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X4 
[Citrus sinensis]
 ref|XP_006478177.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X5 
[Citrus sinensis]
Length=346

 Score =   218 bits (555),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD IP  + P VI +Y +CVVK 
Sbjct  4    MARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVIPISDAPDVIANYHLCVVKT  63

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            +RL+S++IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCAE+ IYL
Sbjct  64   MRLDSNVISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCAELTIYL  123

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  124  MLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  159



>ref|XP_004161907.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Cucumis sativus]
Length=337

 Score =   217 bits (553),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            E+ S  + RVLFCG  FP+SHNYT EY+  Y F+QVD +P E+VP VI +Y ICVVK ++
Sbjct  6    EDSSKGLIRVLFCGSQFPSSHNYTCEYLLNYPFVQVDIVPCEDVPKVISNYHICVVKMMK  65

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
             + DLIS A +MKLI+QFGVGL+GVD+ AAT  GIKVARIPSG TGNA SCAEMAIYL+L
Sbjct  66   FDFDLISRASQMKLIVQFGVGLDGVDVDAATKRGIKVARIPSGVTGNALSCAEMAIYLML  125

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GLLRK  EM IA+  KMLG P GDTLLGKTVFIM
Sbjct  126  GLLRKQKEMQIAVDHKMLGVPTGDTLLGKTVFIM  159



>gb|AAG51802.1|AC067754_18 phosphoglycerate dehydrogenase, putative; 33424-31403 [Arabidopsis 
thaliana]
Length=344

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            KI ++ E    H+TRVLFCGP+FP S+N+TREY+Q Y FI+VD + + +VP VIK+Y IC
Sbjct  10   KIERIVEKEDMHVTRVLFCGPHFPDSYNFTREYLQPYPFIKVDVVHYRDVPEVIKNYHIC  69

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            V   ++++S++IS A  +KLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EM
Sbjct  70   VAMTMQMDSNVISRASNIKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEM  129

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYL+LGLL+K +EM I+++ ++LGEP GDTLLGKTVFI+
Sbjct  130  AIYLMLGLLKKQNEMQISLRNRLLGEPTGDTLLGKTVFIL  169



>ref|NP_001137068.1| uncharacterized protein LOC100217241 [Zea mays]
 gb|ACF83195.1| unknown [Zea mays]
 tpg|DAA39794.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=379

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 126/165 (76%), Gaps = 4/165 (2%)
 Frame = +2

Query  161  GKILKMGE----NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            G+  KMG+    NG   +TRVLFCGP +PAS NYTREY+Q Y FIQVD++  E VP VI 
Sbjct  39   GQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLEQVPDVIH  98

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
             Y ICVVKN R++SD+I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA 
Sbjct  99   SYHICVVKNKRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAV  158

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL LG+LRK  EMD A+ +K LG P+GDTL GKT+ I+
Sbjct  159  SCAEMAIYLTLGILRKQKEMDTAVNRKDLGVPVGDTLFGKTILIL  203



>ref|NP_177364.2| D-isomer specific 2-hydroxyacid dehydrogenase domain protein 
ARA [Arabidopsis thaliana]
 gb|AEE35287.1| D-isomer specific 2-hydroxyacid dehydrogenase-like protein [Arabidopsis 
thaliana]
Length=373

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 131/160 (82%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            KI ++ E    H+TRVLFCGP+FP S+N+TREY+Q Y FI+VD + + +VP VIK+Y IC
Sbjct  39   KIERIVEKEDMHVTRVLFCGPHFPDSYNFTREYLQPYPFIKVDVVHYRDVPEVIKNYHIC  98

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            V   ++++S++IS A  +KLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EM
Sbjct  99   VAMTMQMDSNVISRASNIKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEM  158

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYL+LGLL+K +EM I+++ ++LGEP GDTLLGKTVFI+
Sbjct  159  AIYLMLGLLKKQNEMQISLRNRLLGEPTGDTLLGKTVFIL  198



>ref|XP_006478173.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X1 
[Citrus sinensis]
Length=421

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            + K+  M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD IP  + P VI +Y 
Sbjct  73   ISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVIPISDAPDVIANYH  132

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +CVVK +RL+S++IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCA
Sbjct  133  LCVVKTMRLDSNVISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCA  192

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            E+ IYL+LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  193  ELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  234



>ref|XP_006441521.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54761.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=421

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            + K+  M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +Y 
Sbjct  73   ISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYH  132

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +CVVK +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCA
Sbjct  133  LCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCA  192

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            E+ IYL+LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  193  ELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  234



>ref|XP_006478174.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like isoform X2 
[Citrus sinensis]
Length=411

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            + K+  M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD IP  + P VI +Y 
Sbjct  63   ISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVIPISDAPDVIANYH  122

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +CVVK +RL+S++IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCA
Sbjct  123  LCVVKTMRLDSNVISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCA  182

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            E+ IYL+LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  183  ELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  224



>ref|XP_006441518.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
 gb|ESR54758.1| hypothetical protein CICLE_v10020311mg [Citrus clementina]
Length=418

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            + K+  M  +   +ITRVLFCGP+FPASHNYT+EY+Q Y  IQVD +P  +VP VI +Y 
Sbjct  73   ISKMEGMARSSDKNITRVLFCGPHFPASHNYTKEYLQNYPSIQVDVVPISDVPDVIANYH  132

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +CVVK +RL+S+ IS A +MKLIMQFGVGLEGVDI AAT  GIKVARIP   TGNA SCA
Sbjct  133  LCVVKTMRLDSNCISRANQMKLIMQFGVGLEGVDINAATRCGIKVARIPGDVTGNAASCA  192

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            E+ IYL+LGLLRK +EM +AI+QK LG P G+TLLGKTVFI+
Sbjct  193  ELTIYLMLGLLRKQNEMRMAIEQKKLGVPTGETLLGKTVFIL  234



>ref|XP_006577809.1| PREDICTED: uncharacterized protein LOC100785085 isoform X1 [Glycine 
max]
 ref|XP_006577810.1| PREDICTED: uncharacterized protein LOC100785085 isoform X2 [Glycine 
max]
Length=344

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 130/162 (80%), Gaps = 6/162 (4%)
 Frame = +2

Query  176  MGENGSS------HITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            M  NG+S       ITRVLFCGP FPASH YT EY+Q +S I+VD +P E+VP  I +Y 
Sbjct  1    MESNGNSVKDAEKQITRVLFCGPRFPASHEYTIEYLQNHSHIKVDVLPLEDVPKDIANYH  60

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +C+VKN+RL+S++IS A +M+LIMQ+GVGLEGVDI AAT HGIKVARIP   +GN+ SCA
Sbjct  61   VCIVKNMRLDSEIISRAVQMQLIMQYGVGLEGVDIDAATKHGIKVARIPGDVSGNSASCA  120

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYL+LGLLRK +E+ ++I+QK LGEPI +TLLGKT+FI+
Sbjct  121  EMAIYLMLGLLRKQNELQVSIQQKKLGEPITETLLGKTIFIL  162



>ref|XP_002888861.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65120.1| oxidoreductase family protein [Arabidopsis lyrata subsp. lyrata]
Length=373

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 129/160 (81%), Gaps = 0/160 (0%)
 Frame = +2

Query  164  KILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            K  +M E    H+TRVL CGP FP S+N+TREY+Q Y FIQVD + + +VP VIK+Y IC
Sbjct  39   KTERMVEKEDMHVTRVLCCGPYFPDSYNFTREYLQPYPFIQVDVVHYRDVPEVIKNYHIC  98

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            V   ++++S++IS A +MKLIMQ+GVGL+GVD+ AAT HGIKVARIPS  TGNA SC+EM
Sbjct  99   VAMTMQMDSNVISRASKMKLIMQYGVGLDGVDVDAATKHGIKVARIPSEGTGNAASCSEM  158

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYL+LGLL+K +EM I+++ ++LGEP GDTLLGKTVFI+
Sbjct  159  AIYLMLGLLKKQNEMQISLRNRLLGEPTGDTLLGKTVFIL  198



>ref|XP_008667395.1| PREDICTED: uncharacterized protein LOC100217241 isoform X3 [Zea 
mays]
 tpg|DAA39796.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=336

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = +2

Query  185  NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRL  364
            NG   +TRVLFCGP +PAS NYTREY+Q Y FIQVD++  E VP VI  Y ICVVKN R+
Sbjct  8    NGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLEQVPDVIHSYHICVVKNKRI  67

Query  365  NSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILG  544
            +SD+I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL LG
Sbjct  68   DSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLTLG  127

Query  545  LLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LRK  EMD A+ +K LG P+GDTL GKT+ I+
Sbjct  128  ILRKQKEMDTAVNRKDLGVPVGDTLFGKTILIL  160



>gb|KHN24796.1| D-3-phosphoglycerate dehydrogenase [Glycine soja]
Length=391

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 130/162 (80%), Gaps = 6/162 (4%)
 Frame = +2

Query  176  MGENGSS------HITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            M  NG+S       ITRVLFCGP FPASH YT EY+Q +S I+VD +P E+VP  I +Y 
Sbjct  48   MESNGNSVKDAEKQITRVLFCGPRFPASHEYTIEYLQNHSHIKVDVLPLEDVPKDIANYH  107

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +C+VKN+RL+S++IS A +M+LIMQ+GVGLEGVDI AAT HGIKVARIP   +GN+ SCA
Sbjct  108  VCIVKNMRLDSEIISRAVQMQLIMQYGVGLEGVDIDAATKHGIKVARIPGDVSGNSASCA  167

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYL+LGLLRK +E+ ++I+QK LGEPI +TLLGKT+FI+
Sbjct  168  EMAIYLMLGLLRKQNELQVSIQQKKLGEPITETLLGKTIFIL  209



>ref|XP_008461934.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X2 [Cucumis melo]
Length=329

 Score =   215 bits (548),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            E+ S  + RVLFCG +FP+SHNYT EY+  Y F+QVD +P E+VP VI +Y ICV K ++
Sbjct  6    EDSSKGLIRVLFCGSHFPSSHNYTSEYLLNYPFVQVDVVPCEDVPKVISNYHICVTKMMK  65

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
             + DLIS A +MKLI+QFGVGL+GVD+ AAT  GIKVARIPSG TGNA SCAEMAIYL+L
Sbjct  66   FDFDLISRASQMKLIVQFGVGLDGVDVDAATKLGIKVARIPSGVTGNAMSCAEMAIYLML  125

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GLLRK  EM IA+  K LGEP GDTLLGKTVFI+
Sbjct  126  GLLRKQKEMQIAVDHKKLGEPTGDTLLGKTVFIL  159



>gb|KDP31626.1| hypothetical protein JCGZ_14851 [Jatropha curcas]
Length=343

 Score =   216 bits (549),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            M      HIT+VLFCGP+FPASH YT+EY+Q Y FIQVD     +VP VI +Y ICV K 
Sbjct  1    MERANDQHITKVLFCGPHFPASHIYTKEYLQSYPFIQVDVAQISDVPDVIGNYHICVSKT  60

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            +RL+S +IS A +MKLIMQFGVGL+G+DI AAT  GIKVARIP   TGNA SCAEMAIYL
Sbjct  61   VRLDSTVISRASQMKLIMQFGVGLDGIDIDAATRLGIKVARIPGVNTGNAASCAEMAIYL  120

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK +EM ++IKQK LGEPIG TLLGKTVFI+
Sbjct  121  MLGLLRKQNEMQVSIKQKKLGEPIGQTLLGKTVFIL  156



>ref|XP_008461933.1| PREDICTED: D-3-phosphoglycerate dehydrogenase, chloroplastic 
isoform X1 [Cucumis melo]
Length=337

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            E+ S  + RVLFCG +FP+SHNYT EY+  Y F+QVD +P E+VP VI +Y ICV K ++
Sbjct  6    EDSSKGLIRVLFCGSHFPSSHNYTSEYLLNYPFVQVDVVPCEDVPKVISNYHICVTKMMK  65

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
             + DLIS A +MKLI+QFGVGL+GVD+ AAT  GIKVARIPSG TGNA SCAEMAIYL+L
Sbjct  66   FDFDLISRASQMKLIVQFGVGLDGVDVDAATKLGIKVARIPSGVTGNAMSCAEMAIYLML  125

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GLLRK  EM IA+  K LGEP GDTLLGKTVFI+
Sbjct  126  GLLRKQKEMQIAVDHKKLGEPTGDTLLGKTVFIL  159



>ref|NP_001242647.1| uncharacterized protein LOC100785085 [Glycine max]
 gb|ACU23032.1| unknown [Glycine max]
Length=391

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 130/162 (80%), Gaps = 6/162 (4%)
 Frame = +2

Query  176  MGENGSS------HITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            M  NG+S       ITRVLFCGP FPASH YT EY+Q +S I+VD +P E+VP  I +Y 
Sbjct  48   MESNGNSVKDAEKQITRVLFCGPRFPASHEYTIEYLQNHSHIKVDVLPLEDVPKDIANYH  107

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            +C+VKN+RL+S++IS A +M+LIMQ+GVGLEGVDI AAT HGIKVARIP   +GN+ SCA
Sbjct  108  VCIVKNMRLDSEIISRAVQMQLIMQYGVGLEGVDIDAATKHGIKVARIPGDVSGNSASCA  167

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYL+LGLLRK +E+ ++I+QK LGEPI +TLLGKT+FI+
Sbjct  168  EMAIYLMLGLLRKQNELQVSIQQKKLGEPITETLLGKTIFIL  209



>ref|XP_002459676.1| hypothetical protein SORBIDRAFT_02g008660 [Sorghum bicolor]
 gb|EER96197.1| hypothetical protein SORBIDRAFT_02g008660 [Sorghum bicolor]
Length=385

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 126/165 (76%), Gaps = 4/165 (2%)
 Frame = +2

Query  161  GKILKMGE----NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            G   KMG+    NG   +TRVLFCGP +PAS NYT+EY+Q Y FIQVD++  E VP VI 
Sbjct  45   GHYSKMGDSSEKNGHGTLTRVLFCGPYWPASTNYTKEYLQDYPFIQVDEVGLEQVPDVID  104

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
            +Y ICVVKN R++SD+I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA 
Sbjct  105  NYHICVVKNRRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAV  164

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL LG+LRK  EMD A+ +K LG P+GDTL GKTV I+
Sbjct  165  SCAEMAIYLALGVLRKQKEMDTAVNRKDLGIPVGDTLFGKTVLIL  209



>gb|KJB55658.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55659.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
 gb|KJB55665.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=340

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 120/148 (81%), Gaps = 9/148 (6%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            ITRVLFCGP+FPAS  YTREY++ Y FIQVDD+P + VP  I +YD+CV KN+  +S+++
Sbjct  16   ITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHIGNYDLCVSKNMLFDSNVL  75

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S AK+MKLIMQFGVGLEG+DI AAT HGIKVARIP  ATGNA SCAEMAIYL LGLLR  
Sbjct  76   SRAKQMKLIMQFGVGLEGIDIDAATKHGIKVARIPGDATGNAASCAEMAIYLTLGLLR--  133

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
                   KQKMLGEPIG+TLLGKTVFIM
Sbjct  134  -------KQKMLGEPIGETLLGKTVFIM  154



>gb|KJB55663.1| hypothetical protein B456_009G087500 [Gossypium raimondii]
Length=374

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 120/148 (81%), Gaps = 9/148 (6%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            ITRVLFCGP+FPAS  YTREY++ Y FIQVDD+P + VP  I +YD+CV KN+  +S+++
Sbjct  50   ITRVLFCGPHFPASQIYTREYLEKYPFIQVDDVPLKQVPDHIGNYDLCVSKNMLFDSNVL  109

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S AK+MKLIMQFGVGLEG+DI AAT HGIKVARIP  ATGNA SCAEMAIYL LGLLR  
Sbjct  110  SRAKQMKLIMQFGVGLEGIDIDAATKHGIKVARIPGDATGNAASCAEMAIYLTLGLLR--  167

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
                   KQKMLGEPIG+TLLGKTVFIM
Sbjct  168  -------KQKMLGEPIGETLLGKTVFIM  188



>tpg|DAA39795.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=378

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/165 (64%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = +2

Query  161  GKILKMGE----NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            G+  KMG+    NG   +TRVLFCGP +PAS NYTREY+Q Y FIQVD++  E VP VI 
Sbjct  39   GQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLEQVPDVIH  98

Query  329  DYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNAT  508
             Y ICVVKN R++SD+I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA 
Sbjct  99   SYHICVVKNKRIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAV  158

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL LG+LRK  EMD A+ +K LG P+GDTL GKT+ I+
Sbjct  159  SCAEMAIYLTLGILRK-QEMDTAVNRKDLGVPVGDTLFGKTILIL  202



>ref|XP_003557318.1| PREDICTED: glyoxylate/hydroxypyruvate reductase A HPR2 [Brachypodium 
distachyon]
Length=377

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            +G N  + +TRVLFCGP +PAS  YT+EYVQ Y FIQVD++  E VP VI +Y +CVVKN
Sbjct  46   IGNNDHNDVTRVLFCGPYWPASTIYTKEYVQNYPFIQVDEVDLEQVPEVIHNYHLCVVKN  105

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
             R++SD+I+ A +MK+IMQ+GVGLEGVDI AAT H IKVARIP   TGNA +CAEMAIYL
Sbjct  106  RRIDSDIIAKATKMKIIMQYGVGLEGVDINAATEHKIKVARIPGSTTGNAIACAEMAIYL  165

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             LG+LRK  EMD A+KQK LG P+G+T+ GKTV I+
Sbjct  166  TLGVLRKQKEMDAAVKQKDLGLPVGETIFGKTVLIL  201



>ref|XP_010474292.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic-like 
[Camelina sativa]
Length=292

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  173  KMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVK  352
            +M E    ++TRVL CGP FP + N+TREY+Q Y FIQVD + + +VP VIK+Y ICV  
Sbjct  42   RMVETNEMNVTRVLCCGPYFPDACNFTREYLQPYPFIQVDIVHYRDVPEVIKNYHICVAM  101

Query  353  NLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIY  532
             ++++S +IS A +MKLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIY
Sbjct  102  TMKMDSYVISRASKMKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIY  161

Query  533  LILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            L+LGLL+K +EM ++++ ++LGEP GDTLLGKTVFI+
Sbjct  162  LMLGLLKKQNEMQVSLRSRLLGEPTGDTLLGKTVFIL  198



>ref|XP_007148628.1| hypothetical protein PHAVU_005G002200g [Phaseolus vulgaris]
 gb|ESW20622.1| hypothetical protein PHAVU_005G002200g [Phaseolus vulgaris]
Length=382

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/147 (67%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = +2

Query  203  TRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLIS  382
            TRVLFCGP+FPASH YT EY++ ++ I+VD + FE+VP  I +Y +C+VK++RLNSD+IS
Sbjct  54   TRVLFCGPHFPASHEYTIEYLKNHAHIKVDVLSFEDVPKDIANYHVCIVKSMRLNSDIIS  113

Query  383  SAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXH  562
             A +M+LIMQ+GVGLEGVDI AAT HGIKVARIPS  TGN+ SCAEMAIYL+LGLLRK +
Sbjct  114  RAVQMQLIMQYGVGLEGVDIDAATKHGIKVARIPSDVTGNSASCAEMAIYLMLGLLRKQN  173

Query  563  EMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            E+ ++I+QK LGEPI +TL GKT+FI+
Sbjct  174  ELQLSIQQKKLGEPITETLYGKTIFIL  200



>ref|XP_004984235.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like 
[Setaria italica]
Length=336

 Score =   212 bits (539),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +2

Query  179  GENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNL  358
            G N    +TRVLFCGP +PAS NYTREY+Q Y +IQVD++  E V  VI++Y ICVVKN 
Sbjct  6    GSNSHGAVTRVLFCGPYWPASTNYTREYLQNYPYIQVDEVGLEQVLDVIQNYHICVVKNK  65

Query  359  RLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLI  538
            R++SD+I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL 
Sbjct  66   RIDSDIIAKATQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLT  125

Query  539  LGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            LG+LRK  EMD A+ +K LG P+GDTL GKTV I+
Sbjct  126  LGVLRKQKEMDTAVNRKDLGVPVGDTLFGKTVLIL  160



>gb|EEC81831.1| hypothetical protein OsI_25581 [Oryza sativa Indica Group]
Length=383

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = +2

Query  185  NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRL  364
            +GS  ITRVLFCGP +PAS N+T+EY+Q Y FIQVD++  E VP VI++Y +CVVKN RL
Sbjct  55   SGSGDITRVLFCGPYWPASTNFTKEYLQSYPFIQVDEVGLEEVPDVIQNYHLCVVKNRRL  114

Query  365  NSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILG  544
            +SD+I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL LG
Sbjct  115  DSDIIAKASQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLTLG  174

Query  545  LLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LRK   MD A+K+K LG P+GDT+ GK+V I+
Sbjct  175  VLRKQKVMDTAVKRKDLGIPVGDTIFGKSVLIL  207



>ref|XP_009379261.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
isoform X2 [Pyrus x bretschneideri]
Length=390

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 131/158 (83%), Gaps = 4/158 (3%)
 Frame = +2

Query  182  ENGS----SHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVV  349
            ENG       ++R+LFCG +FPA+  YTREY++ Y FIQVDD+P ++VP VI++Y +C+V
Sbjct  49   ENGEVKNKEKVSRLLFCGSHFPAAETYTREYLKDYPFIQVDDVPHKDVPGVIQNYTMCIV  108

Query  350  KNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAI  529
            K ++L+SDL+S A++MKL++Q+GVGLEGVDI +AT  GIKVARIPS  TGNA SCAEMAI
Sbjct  109  KLMKLDSDLLSRAEKMKLVLQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAASCAEMAI  168

Query  530  YLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            YL+LGLLRK +EM I+IK + +G+P+G+TLLGKTVFI+
Sbjct  169  YLMLGLLRKQNEMQISIKLRKVGDPVGETLLGKTVFIL  206



>ref|XP_007015896.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
 gb|EOY33515.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 1 [Theobroma cacao]
Length=376

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 126/164 (77%), Gaps = 16/164 (10%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQ----------------VDDIPFENVPAVIKD  331
            ITRVLFCGP+FPAS NYTREY++ Y FIQ                VD++  ++VP  I +
Sbjct  28   ITRVLFCGPHFPASQNYTREYLEKYPFIQAICSNSHLMHLFAERFVDEVALKDVPDHIGN  87

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            Y +CVV N+RL+S++IS A +MKLIMQFGVGLEGVD+ AAT  GIKVARIP  ATGNA S
Sbjct  88   YHLCVVLNMRLDSNVISRANQMKLIMQFGVGLEGVDVDAATRLGIKVARIPGDATGNAAS  147

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            CAEMAIYLILGLLRK +EM I++KQK LGEP+G+TL GKTVFIM
Sbjct  148  CAEMAIYLILGLLRKQNEMQISVKQKKLGEPLGETLFGKTVFIM  191



>ref|XP_009379254.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
isoform X1 [Pyrus x bretschneideri]
Length=392

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 131/158 (83%), Gaps = 4/158 (3%)
 Frame = +2

Query  182  ENGS----SHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVV  349
            ENG       ++R+LFCG +FPA+  YTREY++ Y FIQVDD+P ++VP VI++Y +C+V
Sbjct  51   ENGEVKNKEKVSRLLFCGSHFPAAETYTREYLKDYPFIQVDDVPHKDVPGVIQNYTMCIV  110

Query  350  KNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAI  529
            K ++L+SDL+S A++MKL++Q+GVGLEGVDI +AT  GIKVARIPS  TGNA SCAEMAI
Sbjct  111  KLMKLDSDLLSRAEKMKLVLQYGVGLEGVDIDSATKFGIKVARIPSHVTGNAASCAEMAI  170

Query  530  YLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            YL+LGLLRK +EM I+IK + +G+P+G+TLLGKTVFI+
Sbjct  171  YLMLGLLRKQNEMQISIKLRKVGDPVGETLLGKTVFIL  208



>ref|XP_008378743.1| PREDICTED: D-3-phosphoglycerate dehydrogenase [Malus domestica]
Length=394

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 130/158 (82%), Gaps = 4/158 (3%)
 Frame = +2

Query  182  ENGS----SHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVV  349
            ENG       ITR+LFCG +FPA+  YTREY++ Y FIQVDD+P ++VP VI++Y +C+V
Sbjct  53   ENGEVKNKEKITRLLFCGSHFPAAETYTREYLKDYPFIQVDDVPHKDVPGVIQNYSMCIV  112

Query  350  KNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAI  529
            K ++L+SD++S A++MKL++Q+GVGLEGVDI +AT  GIKVARIPS  TGNA SCAEMAI
Sbjct  113  KMMKLDSDILSRAEKMKLVLQYGVGLEGVDIDSATKSGIKVARIPSHVTGNAASCAEMAI  172

Query  530  YLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            YL+LGLLRK +EM I+IK   +G+P+G+TLLGKTVFI+
Sbjct  173  YLMLGLLRKQNEMQISIKLGKVGDPVGETLLGKTVFIL  210



>gb|AER41609.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza glaberrima]
Length=373

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +2

Query  185  NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRL  364
            +GS  ITRVLFCGP +PAS N+T+EY+Q Y FIQVD++  E VP VI++Y +CVVKN RL
Sbjct  45   SGSGDITRVLFCGPYWPASTNFTKEYLQSYPFIQVDEVGLEEVPDVIQNYHLCVVKNRRL  104

Query  365  NSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILG  544
            +SD I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL LG
Sbjct  105  DSDTIAKASQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLTLG  164

Query  545  LLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LRK   MD A+K+K LG P+GDT+ GK+V I+
Sbjct  165  VLRKQKVMDTAVKRKDLGIPVGDTIFGKSVLIL  197



>ref|XP_009393478.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=375

 Score =   211 bits (537),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 125/162 (77%), Gaps = 3/162 (2%)
 Frame = +2

Query  167  ILKMG---ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
             L+MG   E   + IT VLFCG +FPAS NYTREY++GY FI+VD++P + VP VI  Y 
Sbjct  30   FLRMGDGVEKSHNDITNVLFCGFHFPASQNYTREYLKGYPFIKVDEVPLDEVPNVIHRYH  89

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
            ICVVKN R ++ +I  A +MKL+MQFGVGLEGVDI AAT   IKVARIP  +TGNA SCA
Sbjct  90   ICVVKNRRFDATVIDKAVQMKLLMQFGVGLEGVDIEAATRCNIKVARIPGSSTGNAASCA  149

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            EMAIYLILGLLRK  EMD A+K K LG P+G+TLLGKTVFI+
Sbjct  150  EMAIYLILGLLRKQKEMDNAVKLKNLGVPVGETLLGKTVFIL  191



>ref|XP_010428086.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic-like 
[Camelina sativa]
Length=371

 Score =   211 bits (537),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  173  KMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVK  352
            +M E    ++TRVL CGP FP + N+TREY+Q Y F+QVD + + +VP VIK+Y ICV  
Sbjct  40   RMVETNEMNVTRVLCCGPYFPDACNFTREYLQPYPFVQVDIVHYRDVPEVIKNYHICVAM  99

Query  353  NLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIY  532
             ++++S +IS A +MKLIMQFGVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIY
Sbjct  100  TMKMDSYVISRASKMKLIMQFGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIY  159

Query  533  LILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            L+LGLL+K +EM ++++ ++LGEP GDTLLGKTVFI+
Sbjct  160  LMLGLLKKQNEMQVSLRSRLLGEPTGDTLLGKTVFIL  196



>dbj|BAD31969.1| phosphoglycerate dehydrogenase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD30579.1| phosphoglycerate dehydrogenase-like protein [Oryza sativa Japonica 
Group]
Length=336

 Score =   210 bits (534),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +2

Query  185  NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRL  364
            +GS  ITRVLFCGP +PAS ++T+EY+Q Y FIQVD++  E VP VI++Y +CVVKN RL
Sbjct  8    SGSGDITRVLFCGPYWPASTSFTKEYLQSYPFIQVDEVGLEEVPDVIQNYHLCVVKNRRL  67

Query  365  NSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILG  544
            +SD I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL LG
Sbjct  68   DSDTIAKASQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLTLG  127

Query  545  LLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LRK   MD A+K+K LG P+GDT+ GK+V I+
Sbjct  128  VLRKQKVMDTAVKRKDLGIPVGDTIFGKSVLIL  160



>ref|XP_009393479.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009393480.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=343

 Score =   210 bits (534),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            E   + IT VLFCG +FPAS NYTREY++GY FI+VD++P + VP VI  Y ICVVKN R
Sbjct  6    EKSHNDITNVLFCGFHFPASQNYTREYLKGYPFIKVDEVPLDEVPNVIHRYHICVVKNRR  65

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
             ++ +I  A +MKL+MQFGVGLEGVDI AAT   IKVARIP  +TGNA SCAEMAIYLIL
Sbjct  66   FDATVIDKAVQMKLLMQFGVGLEGVDIEAATRCNIKVARIPGSSTGNAASCAEMAIYLIL  125

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GLLRK  EMD A+K K LG P+G+TLLGKTVFI+
Sbjct  126  GLLRKQKEMDNAVKLKNLGVPVGETLLGKTVFIL  159



>gb|KFK41640.1| hypothetical protein AALP_AA2G154000 [Arabis alpina]
Length=367

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 123/148 (83%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            +TRVLFCGP+FP S+N+TREYVQ Y FIQ D +   +VP VI +Y ICV+ +++++S++I
Sbjct  45   VTRVLFCGPHFPDSYNFTREYVQPYPFIQADVVHVHDVPEVINNYHICVIMSMQMDSNVI  104

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A  MKLIMQ+GVGLEGVDI AAT HGIKVARIPS  TGNA SC+EMAIYL+LGLL+K 
Sbjct  105  SRASNMKLIMQYGVGLEGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIYLMLGLLKKQ  164

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM I+++ ++LG+P G TLLGKTVFI+
Sbjct  165  NEMQISVQSRLLGQPTGGTLLGKTVFIL  192



>ref|NP_001059330.1| Os07g0264100 [Oryza sativa Japonica Group]
 dbj|BAF21244.1| Os07g0264100 [Oryza sativa Japonica Group]
 dbj|BAG89417.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96786.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96907.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66922.1| hypothetical protein OsJ_23776 [Oryza sativa Japonica Group]
Length=374

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
             +GS  ITRVLFCGP +PAS ++T+EY+Q Y FIQVD++  E VP VI++Y +CVVKN R
Sbjct  45   RSGSGDITRVLFCGPYWPASTSFTKEYLQSYPFIQVDEVGLEEVPDVIQNYHLCVVKNRR  104

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
            L+SD I+ A +MK+IMQ+GVGLEGVD+ AAT H IKVARIP   TGNA SCAEMAIYL L
Sbjct  105  LDSDTIAKASQMKIIMQYGVGLEGVDVNAATEHKIKVARIPGSTTGNAVSCAEMAIYLTL  164

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            G+LRK   MD A+K+K LG P+GDT+ GK+V I+
Sbjct  165  GVLRKQKVMDTAVKRKDLGIPVGDTIFGKSVLIL  198



>ref|XP_010414841.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic-like 
[Camelina sativa]
Length=373

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  173  KMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVK  352
            +M E    ++TRVL CGP FP + N+TREY+Q Y F+QVD + + +VP VIK Y ICV  
Sbjct  42   RMVETNEMNVTRVLCCGPYFPDACNFTREYLQPYPFVQVDIVHYRDVPEVIKKYHICVAM  101

Query  353  NLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIY  532
             ++++S +IS A +MKLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIY
Sbjct  102  TMKMDSYIISRASKMKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIY  161

Query  533  LILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            L+LGLL+K +EM ++++ ++LGEP GDTLLGKTVFI+
Sbjct  162  LMLGLLKKQNEMQVSLRSRLLGEPTGDTLLGKTVFIL  198



>ref|XP_006301744.1| hypothetical protein CARUB_v10022205mg, partial [Capsella rubella]
 gb|EOA34642.1| hypothetical protein CARUB_v10022205mg, partial [Capsella rubella]
Length=374

 Score =   209 bits (531),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  173  KMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVK  352
            ++ E    H+T VLFCGP FP S+N+TREY+Q Y FIQVD + + +VP VIK+Y ICV  
Sbjct  43   RIVETNDMHVTHVLFCGPYFPDSYNFTREYLQAYPFIQVDVVHYRDVPEVIKNYHICVSM  102

Query  353  NLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIY  532
             ++++S++IS A +MKLIMQ+GVGL+GVDI AAT +GIKVARIPS   GNA SC+EMAIY
Sbjct  103  TMQMDSNVISRASKMKLIMQYGVGLDGVDIDAATKNGIKVARIPSEGNGNAASCSEMAIY  162

Query  533  LILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            L+LGLL+K +EM I+++ + LGEP G TLLGKTVFI+
Sbjct  163  LMLGLLKKQNEMQISLRSRRLGEPTGGTLLGKTVFIL  199



>ref|XP_010471237.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic-like 
[Camelina sativa]
Length=370

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 123/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  197  HITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDL  376
            ++TRVL CGP FP + N+TREY+Q Y F+QVD + + +VP VIK+Y ICV   ++++S +
Sbjct  47   NVTRVLCCGPYFPDACNFTREYLQPYPFVQVDIVHYRDVPEVIKNYHICVAMTMKMDSYV  106

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            IS A +MKLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIYL+LGLL+K
Sbjct  107  ISRASKMKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIYLMLGLLKK  166

Query  557  XHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             +EM ++++ ++LGEP GDTLLGKTVFI+
Sbjct  167  QNEMQVSLRSRLLGEPTGDTLLGKTVFIL  195



>ref|XP_010415950.1| PREDICTED: LOW QUALITY PROTEIN: glyoxylate reductase/hydroxypyruvate 
reductase-like [Camelina sativa]
Length=370

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +2

Query  173  KMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVK  352
            +M  +   ++TRVL CGP FP + N+TREY+Q Y F QVD + + +VP VIK+Y ICV  
Sbjct  39   RMVXDNEMNVTRVLCCGPYFPDACNFTREYLQPYPFAQVDIVHYRDVPEVIKNYHICVAM  98

Query  353  NLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIY  532
             ++++S +IS A +MKLIMQ+GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIY
Sbjct  99   TMKMDSYIISRASKMKLIMQYGVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIY  158

Query  533  LILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            L+LGLL+K +EM ++++ + LGEP GDTLLGKTVFI+
Sbjct  159  LMLGLLKKQNEMQVSLRCRRLGEPTGDTLLGKTVFIL  195



>ref|XP_010683411.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683483.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683555.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=326

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +2

Query  194  SHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSD  373
              +TRVLFCG  F AS++YT+EY+  Y  IQVDD+   ++P VI +Y +C+ +  RL+S+
Sbjct  6    QQVTRVLFCGQQFSASYDYTKEYLSNYPHIQVDDVILSDIPNVIGNYHMCIPRMTRLDSE  65

Query  374  LISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLR  553
            +ISSAK+MKLI+QFGVGLEGVD+ AAT HGIKVARIP+  TGNA SC EMAIYL+LGLLR
Sbjct  66   IISSAKQMKLIVQFGVGLEGVDVDAATKHGIKVARIPADGTGNAASCGEMAIYLMLGLLR  125

Query  554  KXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            K  EM+I+I+ K LGEP G TL GKTVFI+
Sbjct  126  KQKEMEISIQLKRLGEPAGGTLFGKTVFIL  155



>gb|EMT11768.1| Glyoxylate reductase [Aegilops tauschii]
Length=346

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            +G NG S +TRVLFCG  +PAS  YT+EY+Q Y FIQVD++  E+VP VI++Y ICVVKN
Sbjct  26   VGGNGYSDVTRVLFCGHYWPASTIYTKEYLQNYPFIQVDEVGLEHVPDVIQNYHICVVKN  85

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
              ++SD+I+ A +MK+IMQ+GVGLEGVDI AAT   IKVARIP   TGNA +CAEMAIYL
Sbjct  86   KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEQKIKVARIPGSTTGNAIACAEMAIYL  145

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             LG+LRK  EMD A+ QK LG P+G+T+ GKT+ I+
Sbjct  146  TLGVLRKQKEMDTAVIQKDLGLPVGETIFGKTILIL  181



>gb|EMS56366.1| Glyoxylate reductase [Triticum urartu]
Length=346

 Score =   203 bits (516),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            +G NG S +TRVLFCG  +PAS  YT+EY+Q Y FIQVD++  E+VP VI++Y ICVVKN
Sbjct  26   VGGNGYSDVTRVLFCGHYWPASTIYTKEYLQNYPFIQVDEVGLEHVPDVIQNYHICVVKN  85

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
              ++SD+I+ A +MK+IMQ+GVGLEGVDI AAT   IKVARIP   TGNA +CAEMAIYL
Sbjct  86   KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEQKIKVARIPGSTTGNAIACAEMAIYL  145

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             LG+LRK  EMD A+ QK LG P+G+T+ GKT+ I+
Sbjct  146  TLGVLRKQKEMDTAVIQKDLGLPVGETIFGKTILIL  181



>dbj|BAK03270.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   202 bits (515),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            +G NG S +TRVLFCG  +PAS  YT+EY+Q Y FIQVD++  E+VP VI++Y ICVVKN
Sbjct  5    VGINGYSAVTRVLFCGHYWPASTIYTKEYLQKYPFIQVDEVGLEHVPDVIQNYHICVVKN  64

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
              ++SD+I+ A +MK+IMQ+GVGLEGVDI AAT H IKVARIP   TGNAT+CAEMAIYL
Sbjct  65   KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEHKIKVARIPGSTTGNATACAEMAIYL  124

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             LG+LRK  EM+ A+ +K LG P+G+T+ GKT+ I+
Sbjct  125  TLGVLRKQKEMNAAVIRKDLGLPVGETIFGKTILIL  160



>dbj|BAK05235.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            +G NG S +TRVLFCG  +PAS  YT+EY+Q Y FIQVD++  E+VP VI++Y ICVVKN
Sbjct  5    VGINGYSAVTRVLFCGHYWPASTIYTKEYLQKYPFIQVDEVGLEHVPDVIQNYHICVVKN  64

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
              ++SD+I+ A +MK+IMQ+GVGLEGVDI AAT H IKVARIP   TGNAT+CAEMAIYL
Sbjct  65   KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEHKIKVARIPGSTTGNATACAEMAIYL  124

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             LG+LRK  EM+ A+ +K LG P+G+T+ GKT+ I+
Sbjct  125  TLGVLRKQKEMNAAVIRKDLGLPVGETIFGKTILIL  160



>dbj|BAK02358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   202 bits (514),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            +G NG S +TRVLFCG  +PAS  YT+EY+Q Y FIQVD++  E+VP VI++Y ICVVKN
Sbjct  5    VGINGYSAVTRVLFCGHYWPASTIYTKEYLQKYPFIQVDEVGLEHVPDVIQNYHICVVKN  64

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
              ++SD+I+ A +MK+IMQ+GVGLEGVDI AAT H IKVARIP   TGNAT+CAEMAIYL
Sbjct  65   KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEHKIKVARIPGSTTGNATACAEMAIYL  124

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             LG+LRK  EM+ A+ +K LG P+G+T+ GKT+ I+
Sbjct  125  TLGVLRKQKEMNAAVIRKDLGLPVGETIFGKTILIL  160



>ref|XP_006657609.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like 
[Oryza brachyantha]
Length=336

 Score =   202 bits (514),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            ++GS+  TRVLFCGP +PAS  YT+EY+Q + FIQVD++  E VP VI++Y +CVVKN R
Sbjct  7    KSGSADTTRVLFCGPYWPASTIYTKEYLQNHPFIQVDEVGLEEVPDVIQNYHLCVVKNRR  66

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
            ++SD+I+ A +MK+IMQ+GVG+EG+D+ AAT H IKVARIP   TGNA SCAEMAIYL L
Sbjct  67   VDSDVIAKANQMKIIMQYGVGIEGIDVNAATKHKIKVARIPGSTTGNAISCAEMAIYLTL  126

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            G+LRK   MD A+K K LG P+GDT+ GK+V I+
Sbjct  127  GVLRKQKMMDTAVKCKDLGIPVGDTIFGKSVLIL  160



>dbj|BAK00574.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            +G NG S +TRVLFCG  +PAS  YT+EY+Q Y FIQVD++  E+VP VI++Y ICVVKN
Sbjct  47   VGINGYSAVTRVLFCGHYWPASTIYTKEYLQKYPFIQVDEVGLEHVPDVIQNYHICVVKN  106

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
              ++SD+I+ A +MK+IMQ+GVGLEGVDI AAT H IKVARIP   TGNAT+CAEMAIYL
Sbjct  107  KCIDSDIIAKATKMKIIMQYGVGLEGVDINAATEHKIKVARIPGSTTGNATACAEMAIYL  166

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             LG+LRK  EM+ A+ +K LG P+G+T+ GKT+ I+
Sbjct  167  TLGVLRKQKEMNAAVIRKDLGLPVGETIFGKTILIL  202



>ref|XP_004963884.1| PREDICTED: formate dehydrogenase 1, mitochondrial-like [Setaria 
italica]
Length=548

 Score =   205 bits (521),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +2

Query  179  GENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNL  358
            G NG S +TRVLFCGP +PAS  YTREY+Q Y FIQVD++  + VP VI++Y +C+V+N 
Sbjct  218  GSNGCSTVTRVLFCGPYWPASIVYTREYLQNYPFIQVDEVGLDQVPDVIQNYHLCIVRNR  277

Query  359  RLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLI  538
            R++SD+I+ A +MK+IMQ GVGLEGVDI AAT H IKVARIP   TGNA +CAEMAIYL 
Sbjct  278  RIDSDIIARATQMKIIMQNGVGLEGVDIGAATEHKIKVARIPGYTTGNAVACAEMAIYLT  337

Query  539  LGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            LG+LRK  EMD A+ ++ LG P G+T+ G+T+FI+
Sbjct  338  LGVLRKQKEMDRAVNRRELGTPAGETIHGRTIFIL  372



>emb|CDX68275.1| BnaA07g23150D [Brassica napus]
Length=372

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            +TRVLFCGP+ P S+N+TR+Y+Q Y FIQ D   F +VP VIK+Y ICV   ++++S +I
Sbjct  50   VTRVLFCGPHLPDSYNFTRDYLQPYPFIQADVAHFRDVPEVIKNYHICVTLLMQMDSFVI  109

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A  MKLIMQFGVGL+GVDI AAT HGIKVARIPS   GNA SC+EMAIYL+LGLL+K 
Sbjct  110  SRATNMKLIMQFGVGLDGVDIDAATKHGIKVARIPSEGNGNAASCSEMAIYLMLGLLKKQ  169

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM ++++ ++LG+P G TLLGKTVFI+
Sbjct  170  NEMQMSVQSRLLGQPTGGTLLGKTVFIL  197



>emb|CDY50445.1| BnaC06g24190D [Brassica napus]
Length=373

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            +TRVLFCGP+ P S+N+TR+Y+Q Y FIQ D   F +VP VIK+Y ICV   ++++S +I
Sbjct  50   VTRVLFCGPHLPDSYNFTRDYLQPYPFIQADVAHFRDVPEVIKNYHICVTLLMQMDSFVI  109

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A  MKLIMQFGVGL+GVDI AAT +GIKVARIPS  TGNA SC+EMAIYL+LGLL+K 
Sbjct  110  SRASNMKLIMQFGVGLDGVDIDAATKNGIKVARIPSEGTGNAASCSEMAIYLMLGLLKKQ  169

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM ++++ ++LG+P G TLLGKTVFI+
Sbjct  170  NEMQMSVQSRLLGQPTGGTLLGKTVFIL  197



>gb|EPS66269.1| hypothetical protein M569_08508, partial [Genlisea aurea]
Length=344

 Score =   198 bits (503),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 124/174 (71%), Gaps = 27/174 (16%)
 Frame = +2

Query  203  TRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLIS  382
            TRVLFCGPNFP SHNYT+EY+Q +  I VD IPF+ VP VI +YDICV K++++ S++I+
Sbjct  10   TRVLFCGPNFPGSHNYTQEYLQSHPSIVVDIIPFDAVPDVIGNYDICVSKDMKITSNIIA  69

Query  383  SA-KRMKLIMQFGVGLEG--------------------------VDIAAATAHGIKVARI  481
             A  R+KLIMQFGVG+EG                          +D+ AAT HGIKV RI
Sbjct  70   RAGNRLKLIMQFGVGIEGMISTSLSFFFFFRSHITQVLVFCHEGIDVGAATKHGIKVGRI  129

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            PS  TGNA+SCAEMAIYL++GLLRK +EM  ++K++ LG PIGDTLLGKTVFI+
Sbjct  130  PSDTTGNASSCAEMAIYLMMGLLRKQNEMQASLKKRSLGYPIGDTLLGKTVFIL  183



>ref|XP_009104868.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X2 [Brassica 
rapa]
Length=369

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            +TRVLFCGP+ P S+N+TR+Y+Q Y FIQ D   F +VP VIK+Y ICV   ++++S +I
Sbjct  47   VTRVLFCGPHLPDSYNFTRDYLQPYPFIQADVAHFRDVPEVIKNYHICVTLLMQMDSYVI  106

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A  MKLIMQFGVGL+GVDI AAT +GIKVARIPS   GNA SC+EMAIYL+LGLL+K 
Sbjct  107  SRATNMKLIMQFGVGLDGVDIDAATKNGIKVARIPSEGNGNAASCSEMAIYLMLGLLKKQ  166

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM ++++ ++LG+P G TLLGKTVFI+
Sbjct  167  NEMQMSVQSRLLGQPTGGTLLGKTVFIL  194



>ref|XP_009104867.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X1 [Brassica 
rapa]
Length=372

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            +TRVLFCGP+ P S+N+TR+Y+Q Y FIQ D   F +VP VIK+Y ICV   ++++S +I
Sbjct  50   VTRVLFCGPHLPDSYNFTRDYLQPYPFIQADVAHFRDVPEVIKNYHICVTLLMQMDSYVI  109

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A  MKLIMQFGVGL+GVDI AAT +GIKVARIPS   GNA SC+EMAIYL+LGLL+K 
Sbjct  110  SRATNMKLIMQFGVGLDGVDIDAATKNGIKVARIPSEGNGNAASCSEMAIYLMLGLLKKQ  169

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +EM ++++ ++LG+P G TLLGKTVFI+
Sbjct  170  NEMQMSVQSRLLGQPTGGTLLGKTVFIL  197



>ref|XP_006858573.1| hypothetical protein AMTR_s00071p00183090 [Amborella trichopoda]
 gb|ERN20040.1| hypothetical protein AMTR_s00071p00183090 [Amborella trichopoda]
Length=373

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = +2

Query  167  ILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICV  346
            + K+G+   + IT++LFC  +FP++H YTRE +Q Y FIQVDD+  ++VP VI DY IC+
Sbjct  28   VKKVGKMEGNAITKILFCSSHFPSAHEYTRECLQKYPFIQVDDVDIDDVPNVIGDYHICI  87

Query  347  VKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMA  526
             + +RL+S++IS AK+MKLIMQ+GVGLEGVDI AAT  GI+VARIPS  TGN+ SCAE A
Sbjct  88   PRMMRLDSEVISRAKQMKLIMQYGVGLEGVDIDAATMAGIRVARIPSNMTGNSFSCAEHA  147

Query  527  IYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            IYL+LGLLRK  EM+IA++++ LG P G+TL GKTVFI+
Sbjct  148  IYLVLGLLRKQKEMEIAVQERKLGWPAGETLFGKTVFIL  186



>gb|ABR18201.1| unknown [Picea sitchensis]
Length=355

 Score =   186 bits (472),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 119/160 (74%), Gaps = 4/160 (3%)
 Frame = +2

Query  176  MGENGS----SHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDIC  343
            M EN S    +  TRVLFCG +FP S  YT++Y+  Y FIQVD IP + VP +I  Y+IC
Sbjct  1    MAENSSPTAGTITTRVLFCGLSFPTSFEYTKQYLLPYPFIQVDAIPHDKVPDIIGGYEIC  60

Query  344  VVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEM  523
            VV+ ++L++++IS A++MKLI+QFGVGLEGVDI AAT  GIKVARIP   +GN+ SCAE 
Sbjct  61   VVRGMKLDANVISLARQMKLIVQFGVGLEGVDIEAATKFGIKVARIPGNTSGNSLSCAEH  120

Query  524  AIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            AIYLILGLLR    M+ A K++MLG P G+TL GKTV I+
Sbjct  121  AIYLILGLLRDQKGMEKAFKERMLGVPAGETLYGKTVHIV  160



>ref|XP_009379247.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like 
[Pyrus x bretschneideri]
Length=382

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 130/189 (69%), Gaps = 35/189 (19%)
 Frame = +2

Query  182  ENGS----SHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVV  349
            ENG       ++R+LFCG + PA+  YTREY++ Y FIQVD +P ++VP VI++Y +C+V
Sbjct  10   ENGEVKNKQKVSRLLFCGSHSPAAETYTREYLKDYPFIQVDGVPHKDVPGVIQNYSMCIV  69

Query  350  KNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAAT----------AH-------------  460
            K ++L+SDL+  A++MKL++Q+GVGLEGVDI +AT          +H             
Sbjct  70   KLMKLDSDLLYRAEKMKLVLQYGVGLEGVDIDSATKFGIKVARIPSHVTGKQYGVGLEGV  129

Query  461  --------GIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDT  616
                    GIKVARIPS  TGNA SCAEMAIYL+LGLLRK +E+ I+IK + +G+P+G+T
Sbjct  130  DIDSATKFGIKVARIPSHVTGNAASCAEMAIYLMLGLLRKQNEIQISIKLRKVGDPVGET  189

Query  617  LLGKTVFIM  643
            LLGKTVFI+
Sbjct  190  LLGKTVFIL  198



>ref|XP_006858572.1| hypothetical protein AMTR_s00071p00182560 [Amborella trichopoda]
 gb|ERN20039.1| hypothetical protein AMTR_s00071p00182560 [Amborella trichopoda]
Length=340

 Score =   184 bits (468),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            IT++LFCG  FP+   +TRE +Q Y FIQVD++  ++VP VI DY IC+ +  RL+S++I
Sbjct  6    ITKILFCGYVFPSGVQFTRENLQKYPFIQVDEVETDDVPNVIGDYHICIPRMQRLDSEVI  65

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S AK+MKLI+Q+GVGLEGVDI AAT  GI+V RIP   TGN+ SCAE AIYL+LGLLRK 
Sbjct  66   SRAKQMKLILQYGVGLEGVDIDAATRAGIRVGRIPGHMTGNSYSCAEHAIYLVLGLLRKQ  125

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
              MDIA++++ LG P+G+TL GK VFI+
Sbjct  126  KLMDIAVQERKLGWPLGETLFGKAVFIL  153



>emb|CAN70397.1| hypothetical protein VITISV_016521 [Vitis vinifera]
Length=274

 Score =   177 bits (449),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/116 (74%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  287  VDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGI  466
            VDD  FE+VP VI DYD+C+VK++RL+S++IS A +MKLIMQFGVGLEGVDI AAT  GI
Sbjct  124  VDDSSFEDVPDVIADYDMCIVKSMRLDSNIISRANKMKLIMQFGVGLEGVDINAATKCGI  183

Query  467  KVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTV  634
            KVARI SG TGNA SCAEMAIYL+LGLLRK  EM I++KQK++GEPIGDTL GKTV
Sbjct  184  KVARIASGETGNAASCAEMAIYLMLGLLRKQKEMQISLKQKIVGEPIGDTLFGKTV  239



>ref|XP_001766047.1| predicted protein [Physcomitrella patens]
 gb|EDQ69106.1| predicted protein [Physcomitrella patens]
Length=338

 Score =   176 bits (447),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 112/156 (72%), Gaps = 1/156 (1%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            MGE  S    R+LFCG  FP +  +TRE+++ Y+ + VD    E VP  I DYDICV + 
Sbjct  1    MGET-SPRPLRILFCGDEFPPAEFHTREHLKQYAHLYVDSWSREEVPGRIADYDICVPRM  59

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            +RL++++I+ AKR++LI+QFGVGLEGVD+ AAT  GIKVARIPS  TGNA SCAE  IY+
Sbjct  60   MRLDAEVIARAKRLQLIVQFGVGLEGVDVEAATKAGIKVARIPSANTGNAFSCAEHCIYM  119

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLR   +M  +I  K LGEP G TL GKTVFI+
Sbjct  120  MLGLLRHQKDMWSSIAAKRLGEPAGSTLFGKTVFIL  155



>ref|XP_002459677.1| hypothetical protein SORBIDRAFT_02g008670 [Sorghum bicolor]
 gb|EER96198.1| hypothetical protein SORBIDRAFT_02g008670 [Sorghum bicolor]
Length=360

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = +2

Query  185  NGS-SHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLR  361
            NGS S +TRVLFCGP FPAS  YT EY+Q Y FI+VD++  E VP VI +Y ICVVKN R
Sbjct  55   NGSNSKVTRVLFCGPYFPASTRYTTEYLQDYPFIEVDEVGLEQVPDVIHNYHICVVKNRR  114

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
            ++SD+I+ A +MK+IMQ+GVGLEGVD+  AT H IKVARIP   TGNA SCAEMAIYL L
Sbjct  115  IDSDVIAKATQMKIIMQYGVGLEGVDVNTATEHKIKVARIPGSMTGNAVSCAEMAIYLTL  174

Query  542  GLLRK  556
            G+LRK
Sbjct  175  GVLRK  179



>gb|KGN44470.1| hypothetical protein Csa_7G302340 [Cucumis sativus]
Length=302

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +2

Query  284  QVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHG  463
            +VD IP E+VP VI +Y ICVVK ++ + DLIS A +MKLI+QFGVGL+GVD+ AAT  G
Sbjct  5    RVDIIPCEDVPKVISNYHICVVKMMKFDFDLISRASQMKLIVQFGVGLDGVDVDAATKRG  64

Query  464  IKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            IKVARIPSG TGNA SCAEMAIYL+LGLLRK  EM IA+  KMLG P GDTLLGKTVFIM
Sbjct  65   IKVARIPSGVTGNALSCAEMAIYLMLGLLRKQKEMQIAVDHKMLGVPTGDTLLGKTVFIM  124



>ref|XP_010683622.1| PREDICTED: formate dehydrogenase 2, mitochondrial isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=302

 Score =   167 bits (424),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  194  SHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSD  373
              +TRVLFCG  F AS++YT+EY+  Y  IQVDD+   ++P VI +Y +C+ +  RL+S+
Sbjct  6    QQVTRVLFCGQQFSASYDYTKEYLSNYPHIQVDDVILSDIPNVIGNYHMCIPRMTRLDSE  65

Query  374  LISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLR  553
            +ISSAK+MKLI+QFGVGLEGVD+ AAT HGIKVARIP+  TGNA SC EMAIYL+LGLLR
Sbjct  66   IISSAKQMKLIVQFGVGLEGVDVDAATKHGIKVARIPADGTGNAASCGEMAIYLMLGLLR  125

Query  554  K  556
            K
Sbjct  126  K  126



>ref|XP_001767463.1| predicted protein [Physcomitrella patens]
 gb|EDQ67787.1| predicted protein [Physcomitrella patens]
Length=335

 Score =   165 bits (417),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 105/146 (72%), Gaps = 0/146 (0%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            R+LFCG  FPA+  YTR+ +Q Y  + +D  P   V   I DYDICV + +RL++++I+ 
Sbjct  14   RILFCGDEFPAAEFYTRKNLQQYPHLHLDSCPRTLVADRIGDYDICVPRMMRLDAEVIAR  73

Query  386  AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHE  565
            AK+++LI+QFGVGLEGVDI AAT  GIKVARIPS  TGNA +CAE  IY++LGLLR    
Sbjct  74   AKQLQLIVQFGVGLEGVDIEAATRAGIKVARIPSVNTGNALACAEHCIYMMLGLLRHQRV  133

Query  566  MDIAIKQKMLGEPIGDTLLGKTVFIM  643
            M  +I  K LGEP G TL GKT+FI+
Sbjct  134  MASSIAAKRLGEPAGSTLYGKTIFIL  159



>dbj|BAC22329.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAD31965.1| putative phosphoglycerate dehydrogenase [Oryza sativa Japonica 
Group]
Length=316

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  281  IQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAH  460
            I VD++  E VP VI++Y +C+VKN  ++SD+I+ A +MK+IMQ+GVG+EGVD+ AAT H
Sbjct  50   ILVDEVGLEEVPDVIQNYHLCIVKNRLIDSDIIAKASQMKVIMQYGVGIEGVDVNAATEH  109

Query  461  GIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFI  640
             IKVARI    TGNA SCAEMAIYL LG+LRK   MD A+K+K LG P+GDT+ GK V I
Sbjct  110  KIKVARINGSTTGNAVSCAEMAIYLTLGILRKQKMMDTAVKRKDLGSPVGDTIFGKRVLI  169

Query  641  M  643
            +
Sbjct  170  L  170



>gb|AER41584.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza brachyantha]
Length=397

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 102/168 (61%), Gaps = 43/168 (26%)
 Frame = +2

Query  182  ENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQ-------------------------  286
            ++GS+  TRVLFCGP +PAS  YT+EY+Q + FIQ                         
Sbjct  49   KSGSADTTRVLFCGPYWPASTIYTKEYLQNHPFIQFIDENMCFIYLSSNFVRAPSYSISG  108

Query  287  ------------------VDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQ  412
                              VD++  E VP VI++Y +CVVKN R++SD+I+ A +MK+IMQ
Sbjct  109  ILSTILARSCYMEGNMYTVDEVGLEEVPDVIQNYHLCVVKNRRVDSDVIAKANQMKIIMQ  168

Query  413  FGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            +GVG+EG+D+ AAT H IKVARIP   TGNA SCAEMAIYL LG+LRK
Sbjct  169  YGVGIEGIDVNAATKHKIKVARIPGSTTGNAISCAEMAIYLTLGVLRK  216



>gb|AER41608.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza glaberrima]
Length=333

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  281  IQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAH  460
            I VD++  E VP VI++Y +C+VKN  ++SD+I+ A +MK+IMQ+GVG+EG+D+ AAT H
Sbjct  50   ILVDEVGLEEVPDVIQNYHLCIVKNRLIDSDIIAKASQMKVIMQYGVGIEGIDVNAATEH  109

Query  461  GIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFI  640
             IKVARI    TGNA SCAEMAIYL LG+LRK   MD A+K+K LG P+GDT+ GK V I
Sbjct  110  KIKVARINGSTTGNAVSCAEMAIYLTLGILRKQKMMDTAVKRKDLGSPVGDTIFGKRVLI  169

Query  641  M  643
            +
Sbjct  170  L  170



>gb|AER41626.1| erythronate-4-phosphate+dehydrogenase+domain+containing+protein 
[Oryza glumipatula]
Length=337

 Score =   150 bits (378),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  281  IQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAH  460
            I VD++  E VP VI++Y +C+VKN  ++SD+I+ A +MK+IMQ+GVG+EGVD+ AAT H
Sbjct  57   ILVDEVGLEEVPDVIQNYHLCIVKNRLIDSDIIAKASQMKVIMQYGVGIEGVDVNAATEH  116

Query  461  GIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFI  640
             IKVARI    TGNA SCAEMAIYL LG+LRK   MD A+K+K LG P+GDT+ GK V +
Sbjct  117  KIKVARINGSTTGNAVSCAEMAIYLTLGILRKQKMMDTAVKRKDLGSPVGDTIFGKRVLV  176

Query  641  M  643
            +
Sbjct  177  L  177



>ref|XP_004139684.1| PREDICTED: d-3-phosphoglycerate dehydrogenase-like [Cucumis sativus]
Length=275

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/96 (74%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +2

Query  356  LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYL  535
            ++ + DLIS A +MKLI+QFGVGL+GVD+ AAT  GIKVARIPSG TGNA SCAEMAIYL
Sbjct  2    MKFDFDLISRASQMKLIVQFGVGLDGVDVDAATKRGIKVARIPSGVTGNALSCAEMAIYL  61

Query  536  ILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +LGLLRK  EM IA+  KMLG P GDTLLGKTVFIM
Sbjct  62   MLGLLRKQKEMQIAVDHKMLGVPTGDTLLGKTVFIM  97



>ref|XP_005646982.1| hypothetical protein COCSUDRAFT_37061 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22438.1| hypothetical protein COCSUDRAFT_37061 [Coccomyxa subellipsoidea 
C-169]
Length=345

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 92/148 (62%), Gaps = 0/148 (0%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            + RVLFCG  F   + +T+E +Q  + I+V   P E V   I   D+ V    RL+S ++
Sbjct  8    VFRVLFCGQEFNWGYKFTKEALQDDAEIEVSCCPREEVGQHIGSTDLAVPLMARLDSYML  67

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            S A R+K I+Q+GVG+EG+DI AAT  GI V+ IPS  TGNA SCAEMAIYL L  LR  
Sbjct  68   SRAPRLKAILQYGVGVEGIDIPAATERGIWVSNIPSEGTGNALSCAEMAIYLTLACLRSS  127

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            H    +I ++ +G P+G TL G  V I+
Sbjct  128  HACAESIAERRVGVPLGRTLFGTNVLIV  155



>gb|KCW70958.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=269

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  395  MKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDI  574
            MKL+MQFGVGLEGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+LGLLRK +E+  
Sbjct  1    MKLLMQFGVGLEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLMLGLLRKQNEIQT  60

Query  575  AIKQKMLGEPIGDTLLGKTVFIM  643
            ++ Q+ LGEP+G+TL GKTV IM
Sbjct  61   SVNQRKLGEPVGETLFGKTVLIM  83



>ref|XP_010473742.1| PREDICTED: D-3-phosphoglycerate dehydrogenase 1, chloroplastic-like 
[Camelina sativa]
Length=171

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  416  GVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKML  595
            GVGL+GVDI AAT HGIKVARIPS  TGNA SC+EMAIYL+LGLL+K +EM ++++ ++L
Sbjct  38   GVGLDGVDIDAATKHGIKVARIPSEGTGNAASCSEMAIYLMLGLLKKQNEMQVSLRSRLL  97

Query  596  GEPIGDTLLGKTVFIM  643
            GEP GDTLLGKTVFI+
Sbjct  98   GEPTGDTLLGKTVFIL  113



>ref|XP_003063700.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52073.1| predicted protein [Micromonas pusilla CCMP1545]
Length=390

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 91/147 (62%), Gaps = 1/147 (1%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            R+LFCG  FP +   T   +     ++V     E+V   I+  DI V    RL++D+I+ 
Sbjct  20   RILFCGEEFPDAARCTASSLSTDPGVEVVVCKREDVATEIERADIAVPLMTRLDADIIAR  79

Query  386  -AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXH  562
             AKR++L++QFGVGLEGVD  A    G+ VARIP+  TGNATS AEMA+YL+L  LR+ +
Sbjct  80   GAKRLRLVLQFGVGLEGVDERACAERGVLVARIPADRTGNATSTAEMAVYLVLAALRRVN  139

Query  563  EMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             M  ++K + LG P+G  L G  V I+
Sbjct  140  AMADSLKARTLGTPMGTQLKGLNVLIV  166



>gb|KDO56044.1| hypothetical protein CISIN_1g044056mg, partial [Citrus sinensis]
Length=189

 Score =   113 bits (282),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 97/161 (60%), Gaps = 14/161 (9%)
 Frame = +2

Query  158  LGKILKMGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD  337
            + K+  M  +    IT VLF GP+FPASHNY + Y+Q Y  I+     F ++ ++   Y 
Sbjct  2    INKMEGMARSSDKSITLVLFRGPHFPASHNYAKGYLQNYLSIK-GLCFFLSMHSLYASYG  60

Query  338  ICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCA  517
                + +  +S++I+ A  M LI++F VGLEGVDI A T   IK ARI    +GNA SCA
Sbjct  61   TSE-QMIASDSNVITRANPMNLIIRFRVGLEGVDIDALTNCAIKAARILGDVSGNAASCA  119

Query  518  EMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFI  640
            E++IYL+LGLLRK H +           P G+TLLGKTVFI
Sbjct  120  ELSIYLMLGLLRK-HIV-----------PTGETLLGKTVFI  148



>ref|XP_007509693.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18808.1| predicted protein [Bathycoccus prasinos]
Length=392

 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 94/170 (55%), Gaps = 22/170 (13%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSF----------IQVDDIPFENVPAVIKDYDICVV  349
            I RVLFCG  F      T+ Y +  S           ++V + P E V  +I++YD+ V 
Sbjct  23   IVRVLFCGEEFIGGFEATKRYTEASSSSSSSSSDGVTVKVQNCPRERVKDMIQEYDVLVP  82

Query  350  KNLRLNSDLISSA------------KRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGA  493
               R +  +I+SA             + KLI+QFGVGLEGV I  AT  GIKV RI S +
Sbjct  83   LMTRFDETVINSAAGNGSGDRGKKLSKCKLILQFGVGLEGVAIDLATKAGIKVGRIRSDS  142

Query  494  TGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
              NATS AEM ++L L  L+K +E  I+++ K+LG P+G++L G TV  +
Sbjct  143  NPNATSTAEMGVFLTLAALKKVNECQISVENKVLGSPMGESLFGATVLFV  192



>ref|XP_005849953.1| hypothetical protein CHLNCDRAFT_143308 [Chlorella variabilis]
 gb|EFN57851.1| hypothetical protein CHLNCDRAFT_143308 [Chlorella variabilis]
Length=330

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 87/133 (65%), Gaps = 0/133 (0%)
 Frame = +2

Query  245  NYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVG  424
             +T+E +Q    ++V       +   +   D+ V    RL++ L+ SA+R+KLI+Q+GVG
Sbjct  6    QFTKEALQHEPGVEVVQCDRSQLAHELMGADVAVPLMARLDAQLLRSARRLKLIIQYGVG  65

Query  425  LEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEP  604
            +EG+D+ +AT  GI V+ IPS  TGNA SCAE AIYL+L  LR  + M  +I+++ LG P
Sbjct  66   VEGIDMPSATELGIWVSNIPSAGTGNAASCAEHAIYLMLATLRYHNAMADSIRERRLGVP  125

Query  605  IGDTLLGKTVFIM  643
            +G TLLGKTV ++
Sbjct  126  LGQTLLGKTVLLV  138



>ref|XP_002505587.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66845.1| predicted protein [Micromonas sp. RCC299]
Length=388

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 92/151 (61%), Gaps = 5/151 (3%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPF-----ENVPAVIKDYDICVVKNLRLNS  370
            +VLFCG  FPA    TR+ ++ +  +   +  F     E V   I D D+ V    +++ 
Sbjct  23   KVLFCGKEFPAGAEETRKALEKHDAVGNCEFRFVACAREQVATEIVDADVAVPLMTKIDE  82

Query  371  DLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLL  550
             L++ A  +KL++QFGVGLEGVD  A T  GI +ARIPS  TGNA S AEMA++L+L  L
Sbjct  83   TLLAKAPILKLVLQFGVGLEGVDEEACTKRGILLARIPSEKTGNADSTAEMAVFLLLAGL  142

Query  551  RKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            R+ +++  ++  + LGEP+   L GKTV I+
Sbjct  143  RRVNQLAKSLTDRRLGEPVTVQLKGKTVTIV  173



>dbj|BAJ91330.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=295

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  176  MGENGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN  355
            +G NG S +TRVLFCG  +PAS  YT+EY+Q Y FIQVD++  E+VP VI++Y ICVVKN
Sbjct  5    VGINGYSAVTRVLFCGHYWPASTIYTKEYLQKYPFIQVDEVGLEHVPDVIQNYHICVVKN  64

Query  356  LRLNSDLISSAKRMKLIMQFGVGLE  430
              ++SD+I+ A +MK+IMQ+GVGLE
Sbjct  65   KCIDSDIIAKATKMKIIMQYGVGLE  89



>gb|KCW70959.1| hypothetical protein EUGRSUZ_F04070 [Eucalyptus grandis]
Length=270

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +2

Query  395  MKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDI  574
            M+   Q+    EGVDI AAT +GIKVARIPS  TGNA SCAEMAIYL+LGLLRK +E+  
Sbjct  1    MEFTTQYLHLHEGVDIDAATKNGIKVARIPSDVTGNAASCAEMAIYLMLGLLRKQNEIQT  60

Query  575  AIKQKMLGEPIGDTLLGKTVFIM  643
            ++ Q+ LGEP+G+TL GKTV IM
Sbjct  61   SVNQRKLGEPVGETLFGKTVLIM  83



>ref|XP_001422519.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00836.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=332

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 86/149 (58%), Gaps = 3/149 (2%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVD-DIPFENVPAVIKDYDICVVKNLRLNSDL--  376
            RVLFCG  F   + +TR YV              E+V   I   D+ V    +L+++L  
Sbjct  5    RVLFCGLEFEDGYAHTRAYVDDNDLDVDVARCAREDVAREISRCDVAVPLMTKLDAELLK  64

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            I +A  +  ++QFGVGLEGVDI  ATA G+ VARIPS  TGNATS AE+A+YL+L  LR+
Sbjct  65   IGAAGALTHVLQFGVGLEGVDIECATALGVTVARIPSEKTGNATSTAELAVYLVLAALRR  124

Query  557  XHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
               M  +++ + LG P G+ L    V I+
Sbjct  125  HDAMSASVRSRKLGAPTGNALSECEVMIL  153



>ref|WP_025420783.1| lactate dehydrogenase [Sodalis sp. HS1]
 gb|AHF75653.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding, inverted 
[Sodalis sp. HS1]
Length=314

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 83/144 (58%), Gaps = 6/144 (4%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTR--EYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            RVLF  P       Y R  + +    F+   D  F  +   + ++D  +     +++ L+
Sbjct  2    RVLFAAPEDAWGGIYARFCQALPEMEFVAASD--FRTLS--LANFDAIIPTMTPVDAALL  57

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
             SA R+KLI Q G GLEGVDIAAA A GI VA +PS ++GNA S AE+AIYL+LGL R  
Sbjct  58   QSADRLKLIQQVGAGLEGVDIAAARARGISVANVPSASSGNADSVAELAIYLMLGLARNA  117

Query  560  HEMDIAIKQKMLGEPIGDTLLGKT  631
             ++   +  + LG PIG  L+GKT
Sbjct  118  ADIPRQLHLRQLGRPIGQGLMGKT  141



>gb|KDD72690.1| hypothetical protein H632_c3019p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=330

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 71/113 (63%), Gaps = 0/113 (0%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIP  484
            E     IK+ D+ +     L    ++ A R+KLI+QFGVGLE VDI+AAT  G+ V+ +P
Sbjct  7    EETLEAIKNADVAIPLMTHLGRRELAEASRLKLILQFGVGLERVDISAATERGVWVSNVP  66

Query  485  SGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            S  TGNA SCAE A+YL L  LR    M+ A++Q  +G+P G TL G+T  ++
Sbjct  67   SQFTGNARSCAEHAMYLALACLRDGRAMEDAVRQGRVGQPAGRTLFGRTALVL  119



>ref|XP_005828939.1| hypothetical protein GUITHDRAFT_46401, partial [Guillardia theta 
CCMP2712]
 gb|EKX41959.1| hypothetical protein GUITHDRAFT_46401, partial [Guillardia theta 
CCMP2712]
Length=269

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 85/147 (58%), Gaps = 3/147 (2%)
 Frame = +2

Query  209  VLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSA  388
            +LFCG +FP S + TR     ++ +  D    E   A     D+ V    R+++ L+++A
Sbjct  4    ILFCGRDFPLSLHATRSRRPTWNLLASDRAGLEEEMAS-HAVDVVVPLMTRIDASLVATA  62

Query  389  KR--MKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXH  562
             R  +KLI QFG GLEGVD  AA  HG+ V  IP+G + NA S AE AIYL++ ++R   
Sbjct  63   SRSGVKLIHQFGAGLEGVDKDAAERHGVAVRNIPAGESANAISSAEHAIYLLMSIMRNPR  122

Query  563  EMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             M  ++++++LG P G T+  K   ++
Sbjct  123  AMRASLEERLLGLPAGTTIHSKRALVV  149



>ref|WP_039329515.1| lactate dehydrogenase [Pantoea rodasii]
 gb|KHJ68881.1| lactate dehydrogenase [Pantoea rodasii]
Length=315

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D  +    R+++ LI++A R+KLI Q GVGLEGVD+AAA   GI VA +PS  +GNA S
Sbjct  42   FDALIPGMCRVDARLIATADRLKLIQQAGVGLEGVDLAAAKQAGIMVANVPSDNSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             AE+ I++++GL R+ HE+   + Q+ LG+PIG  L+GKT
Sbjct  102  VAELGIWMMIGLARRQHEIADCLAQQRLGQPIGLGLMGKT  141



>ref|WP_021184805.1| D-3-phosphoglycerate dehydrogenase [Pantoea sp. AS-PWVM4]
 gb|ERK12456.1| D-3-phosphoglycerate dehydrogenase [Pantoea sp. AS-PWVM4]
Length=315

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 71/100 (71%), Gaps = 0/100 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D  V    R+++ L+++A R+KLI Q GVGLEGVDIAAA   GI VA +PS  +GNA S
Sbjct  42   FDALVPGMCRVDARLLATADRLKLIQQAGVGLEGVDIAAAKKAGIMVANVPSDHSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             AE+ I++++GL R+  E+   + Q++LG+PIG  L+GKT
Sbjct  102  VAELGIWMMIGLARRQQEIAQCLAQQLLGQPIGMGLMGKT  141



>ref|XP_003082919.1| oxidoreductase family protein (ISS) [Ostreococcus tauri]
 emb|CAL56874.1| D-isomer specific 2-hydroxyacid dehydrogenase,NAD-binding [Ostreococcus 
tauri]
Length=333

 Score = 99.0 bits (245),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 91/157 (58%), Gaps = 17/157 (11%)
 Frame = +2

Query  206  RVLFCGP-NFPASHNYT--------REYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNL  358
            RVLFC   +FPA    T        REYV      +       +V   I   D+ V    
Sbjct  5    RVLFCCEHSFPAGFACTLAALTSSEREYVDVVRVDRD------DVHREIAACDVAVPLMT  58

Query  359  RLNSDL--ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIY  532
            RL++ +  I +A R++L++QFGVGLEGVDI AATA G++VARIPS  TGNA+S AEMA++
Sbjct  59   RLDAQMLKIGAAGRLRLVVQFGVGLEGVDIRAATACGVRVARIPSERTGNASSTAEMAVF  118

Query  533  LILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            L+L  LR+ +EM  +I    LG P G +L    V I+
Sbjct  119  LLLAALRETNEMRASIAGSRLGNPCGRSLEDCEVMIV  155



>ref|WP_013507782.1| lactate dehydrogenase [Pantoea sp. At-9b]
 gb|ADU67914.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Pantoea sp. At-9b]
Length=315

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D  V    R+++ L+++A R+KLI Q GVGLEGVDIAAA   GI VA +PS  +GNA S
Sbjct  42   FDALVPGMCRVDAPLLATADRLKLIQQVGVGLEGVDIAAAKKAGIMVANVPSDHSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             AE+ I++++GL R+  E+   + Q+ LG+PIG  L+GKT
Sbjct  102  VAELGIWMMIGLARRHQEIAPCLAQQQLGQPIGMGLMGKT  141



>ref|XP_002179420.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC49243.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=387

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 87/156 (56%), Gaps = 14/156 (9%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQ--------VDDIPFENVPAVIKDYDICVVKNLR  361
            RV++ GP+F A  +YT+  V+     Q         D   +E  P V    D+ V     
Sbjct  58   RVVYAGPHFQAGLSYTQALVRERGLEQCVELVHAPTDAQLWELAPTV----DVAVPFMQS  113

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
              +D I  A RM+LIMQ+GVGLEGVD+ +AT HGI V+ IP+  TGNA + AE AI+L L
Sbjct  114  FRADFIERASRMRLIMQYGVGLEGVDVDSATKHGIAVSNIPAAGTGNAEATAEHAIFLSL  173

Query  542  GLLRKX-HEMDIAIKQKMLGE-PIGDTLLGKTVFIM  643
             LLR+   ++    + ++LG  PI  +L  K V ++
Sbjct  174  SLLRRAFQDLPQRFQGRILGGLPIPKSLFQKNVTVV  209



>ref|WP_034826230.1| lactate dehydrogenase [Enterobacter cancerogenus]
 gb|KGT89651.1| lactate dehydrogenase [Enterobacter cancerogenus]
Length=315

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D  +    R+++ LI++A R+KL+ Q GVGLEGVD+ AA   GI VA +PS  +GNA S
Sbjct  42   FDALIPGMCRVDARLIATADRLKLVQQAGVGLEGVDLEAAKKAGIMVANVPSDHSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             AE+ I++++GL R+ HE+   + Q+ LG+PIG  L+GKT
Sbjct  102  VAELGIWMMIGLARRQHEIADCLAQQRLGQPIGLGLMGKT  141



>ref|XP_007015903.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 5 [Theobroma cacao]
 gb|EOY33522.1| D-isomer specific 2-hydroxyacid dehydrogenase family protein 
isoform 5 [Theobroma cacao]
Length=261

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  476  RIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            RIPS ATGNA SCAEMAIYL+LGLLRK +EM I++KQK LGEP+G+TLLG+TVFIM
Sbjct  20   RIPSDATGNAASCAEMAIYLMLGLLRKQNEMQISVKQKKLGEPVGETLLGQTVFIM  75



>ref|WP_013200656.1| lactate dehydrogenase [Erwinia billingiae]
 emb|CAX58151.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding [Erwinia 
billingiae Eb661]
Length=315

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 67/100 (67%), Gaps = 0/100 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            YD  +    ++  DL+ +A R+KLI Q G GLEGVD+A+A A GI+VA +PS  +GNA S
Sbjct  42   YDALIPGMAKVTPDLLKTADRLKLIQQAGAGLEGVDLASAKALGIQVANVPSDRSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             AE+ I++++GL RK  E+   I  + LG P+G  L+GKT
Sbjct  102  VAELGIWMMIGLARKAREIPEMIATRQLGLPVGMGLMGKT  141



>ref|XP_008189273.1| PREDICTED: D-3-phosphoglycerate dehydrogenase-like [Acyrthosiphon 
pisum]
Length=326

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D  +    R+++ L+++A R++LI Q GVGLEG+D+ AA  HGI VA +PS  +GNA S
Sbjct  53   FDALIPGMCRVDARLLATADRLRLIQQAGVGLEGIDLRAAKQHGIMVANVPSDDSGNADS  112

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             AE+ I++++GL R+ +E+   + Q+ LG+PIG  L GKT
Sbjct  113  VAELGIWMMIGLARRQNEIADCLAQQKLGQPIGMGLKGKT  152



>ref|WP_031376041.1| lactate dehydrogenase [Pantoea sp. 3.5.1]
Length=315

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D  +    ++++ L+++A R+ LI Q G GLEG+DIAAA   GI VA +PS ++GNA S
Sbjct  42   FDALIPGMCKVDAALLATADRLALIQQAGTGLEGIDIAAAKQRGIMVANVPSDSSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             AE+ I++++GL R+ HE+   + Q+ LG+P+G  L GKT
Sbjct  102  VAELGIWMMIGLARRYHEIADCLAQQQLGQPVGLGLKGKT  141



>ref|WP_015906531.1| lactate dehydrogenase [Desulfobacterium autotrophicum]
 gb|ACN17821.1| SerA2 [Desulfobacterium autotrophicum HRM2]
Length=315

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 67/104 (64%), Gaps = 0/104 (0%)
 Frame = +2

Query  323  IKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGN  502
            +K  D+ +     +  +++ +  R++LI Q G GLEGVDI AAT  G+ VA +P+G +GN
Sbjct  39   LKGVDVLIPAMTWITREMMETGDRLRLIQQCGSGLEGVDIKAATDQGVSVANVPAGTSGN  98

Query  503  ATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTV  634
            A S AE+ IY+++GL R    M  +++ K +GEP+G  L GKTV
Sbjct  99   ADSVAELGIYMMIGLSRNIQGMAQSLRNKKMGEPLGMALPGKTV  142



>ref|WP_041287365.1| hypothetical protein, partial [Desulfomonile tiedjei]
Length=300

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 79/146 (54%), Gaps = 4/146 (3%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            ++LFCG  FP                Q+ +   E+V  +    D+ +    RL  +LI  
Sbjct  2    KILFCGTTFP---RAPELLALLLPEDQIVNCHSEHVKELGLGVDVIIPLMHRLEPELIER  58

Query  386  AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHE  565
                +LI Q+GVGLEGVDI AATA GI V  +P   T NA S AE A+ L+LGL R+ HE
Sbjct  59   TS-ARLIHQWGVGLEGVDIPAATARGILVCNVPGDVTVNADSTAEHALLLMLGLSRRIHE  117

Query  566  MDIAIKQKMLGEPIGDTLLGKTVFIM  643
               A ++ + G P+GD L+G+T  I+
Sbjct  118  CFEAFQKGLWGAPVGDILMGRTALIV  143



>ref|WP_034897846.1| lactate dehydrogenase [Erwinia typographi]
 gb|KGT88455.1| lactate dehydrogenase [Erwinia typographi]
Length=315

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 69/100 (69%), Gaps = 0/100 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D  +    ++ ++L+ +A R+KLI Q G GLEGVD+A+A AHG++VA +PS  +GNA S
Sbjct  42   FDALIPGMAKVTAELLKTADRLKLIQQAGAGLEGVDLASAKAHGVQVANVPSDRSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             AE+ I++++GL R+  ++   +  + LG P+G  L+GKT
Sbjct  102  VAELGIWMMIGLARRARDIPEMMATRQLGLPVGMGLMGKT  141



>gb|AFM26624.1| phosphoglycerate dehydrogenase-like oxidoreductase [Desulfomonile 
tiedjei DSM 6799]
Length=331

 Score = 92.8 bits (229),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 79/146 (54%), Gaps = 4/146 (3%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            ++LFCG  FP                Q+ +   E+V  +    D+ +    RL  +LI  
Sbjct  2    KILFCGTTFP---RAPELLALLLPEDQIVNCHSEHVKELGLGVDVIIPLMHRLEPELIER  58

Query  386  AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHE  565
                +LI Q+GVGLEGVDI AATA GI V  +P   T NA S AE A+ L+LGL R+ HE
Sbjct  59   TS-ARLIHQWGVGLEGVDIPAATARGILVCNVPGDVTVNADSTAEHALLLMLGLSRRIHE  117

Query  566  MDIAIKQKMLGEPIGDTLLGKTVFIM  643
               A ++ + G P+GD L+G+T  I+
Sbjct  118  CFEAFQKGLWGAPVGDILMGRTALIV  143



>ref|WP_028671049.1| lactate dehydrogenase [Saccharospirillum impatiens]
Length=314

 Score = 92.4 bits (228),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 68/110 (62%), Gaps = 0/110 (0%)
 Frame = +2

Query  314  PAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGA  493
            P  +  Y++ +    R+++ L+ +A R++LI Q G GLEGVD+ AA   GI VA +P+  
Sbjct  35   PGSLAGYEVVIPTMSRIDARLLQTADRLQLIQQIGAGLEGVDLDAAKQQGIAVANVPTDV  94

Query  494  TGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            +GNA S AEM IY +L L+R+  E      +  LG P+G +L+G TV I+
Sbjct  95   SGNADSVAEMVIYFMLALMRRTAEHTEQRHRMQLGVPVGRSLMGATVGIV  144



>ref|WP_015878860.1| lactate dehydrogenase [Tolumonas auensis]
 gb|ACQ93389.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding [Tolumonas 
auensis DSM 9187]
Length=315

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 68/104 (65%), Gaps = 0/104 (0%)
 Frame = +2

Query  323  IKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGN  502
            ++ +D+ +    ++++ L+++A ++KLI Q G GLEGVD+ AA  H I VA +P+  +GN
Sbjct  39   LQGFDVLIPTMTKIDARLLATADQLKLIQQIGAGLEGVDLEAAKQHQIAVANVPTDISGN  98

Query  503  ATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTV  634
            A S AE+ IY++L L R  HE+    +Q+  G P+G  L GKTV
Sbjct  99   ADSVAELGIYMMLALARNAHEIPHHFRQRESGRPMGLGLKGKTV  142



>ref|WP_038649217.1| lactate dehydrogenase [Pantoea rwandensis]
 gb|AIR87498.1| lactate dehydrogenase [Pantoea rwandensis]
Length=315

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 0/93 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D  +    R+++ LI++A R+KL+ Q GVGLEGVD+ AA   GI VA +PS  +GNA S
Sbjct  42   FDALIPGMCRVDARLIATADRLKLVQQAGVGLEGVDLEAAKKAGIMVANVPSDHSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIG  610
             AE+ I++++GL R+ HE+   + Q+ LG+PIG
Sbjct  102  VAELGIWMMIGLARRQHEIADCLAQQRLGQPIG  134



>ref|WP_029912678.1| lactate dehydrogenase [Pelobacter seleniigenes]
Length=316

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 72/101 (71%), Gaps = 0/101 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            Y++ +    R+++ L++SA R++LI Q G GLEGVDIAAA A GI VA +PSGA+GNA S
Sbjct  42   YEVLIPTMCRVDAALLASADRLQLIQQMGTGLEGVDIAAARARGIMVANVPSGASGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTV  634
             AE+ IYL+LGLLRK  E+   ++   LG P+G TL GK +
Sbjct  102  VAELGIYLLLGLLRKAWEIPAVLQAGRLGRPMGGTLQGKNI  142



>ref|WP_012107589.1| D-isomer specific 2-hydroxyacid dehydrogenase [Methanoregula 
boonei]
 ref|YP_001405177.1| D-isomer specific 2-hydroxyacid dehydrogenase [Methanoregula 
boonei 6A8]
 gb|ABS56534.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding [Methanoregula 
boonei 6A8]
Length=325

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 82/152 (54%), Gaps = 13/152 (9%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDI---PFENVPAVIKDYDICVVKNLRLNSDL  376
            ++LFCG  FP +        Q  + +  D+I   P + + + I D DI V    R++  L
Sbjct  2    KILFCGEGFPEARK------QLAALLPDDEILAFPPDQIGSHIADADIVVPTVNRVDEAL  55

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            +        I QFGVGLEGVDI AAT +GI+VARIPS  +GNA S AE AI  +L L R 
Sbjct  56   MKKGH-FAFIQQFGVGLEGVDIEAATRNGIRVARIPSEESGNAASVAEHAILFMLMLSRN  114

Query  557  XHEMDIAIKQKM---LGEPIGDTLLGKTVFIM  643
             + +  A ++      G P G  L GKTV I+
Sbjct  115  WNRLARAREENKPLPWGSPEGVALRGKTVCIV  146



>ref|XP_011399491.1| D-3-phosphoglycerate dehydrogenase [Auxenochlorella protothecoides]
 gb|KFM26553.1| D-3-phosphoglycerate dehydrogenase [Auxenochlorella protothecoides]
Length=338

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 0/109 (0%)
 Frame = +2

Query  317  AVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGAT  496
            A ++  D+ V   + + + ++ +A R+KLI+QFGVG++ +DI AAT  GI VA IPS  T
Sbjct  31   AALQHVDVVVPIAVPITAGMLGAAPRLKLIIQFGVGVDAIDIPAATRLGITVANIPSLGT  90

Query  497  GNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            GNA S AE AI+L L  LR    M  A++ + LG P G TL G TV ++
Sbjct  91   GNALSVAEHAIFLALASLRHHGAMRRALEAQRLGVPEGLTLWGSTVLVV  139



>ref|WP_024966984.1| lactate dehydrogenase [Pantoea sp. IMH]
Length=315

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 45/101 (45%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            YD  +    ++   L+ +A R+KLI Q G GLE VDI +A A GI+VA +PS  +GNA S
Sbjct  42   YDALIPGMAQIGDKLLQTADRLKLIQQAGAGLESVDINSAKALGIQVANVPSDCSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTV  634
             AE+ I++++GL R+  E+   I  + LG P+G  L GKTV
Sbjct  102  VAELGIWMMIGLARRARELPDMIATRQLGLPVGLGLSGKTV  142



>ref|WP_034949039.1| lactate dehydrogenase [Erwinia oleae]
Length=315

 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 66/100 (66%), Gaps = 0/100 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D+ +  +  +++ L+S+A R+KLI Q G GLE VDI +A+A GI VA +PS ++GNA S
Sbjct  42   FDVLIPGSAEVSASLLSTADRLKLIQQPGAGLESVDIDSASALGIPVANVPSDSSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             AE+ I+L++GL R   E+   I  +  G P+G  L GKT
Sbjct  102  VAELGIWLMIGLARGAREIPQMIATRQTGLPVGIGLAGKT  141



>ref|WP_020880970.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Desulfovibrio sp. X2]
 gb|EPR41690.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Desulfovibrio sp. X2]
Length=322

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 81/148 (55%), Gaps = 10/148 (7%)
 Frame = +2

Query  209  VLFCGPNFPASHNYTREYVQGYSFIQVDDIPF---ENVPAVIKDYDICVVKNLRLNSDLI  379
            +LFC  +FPA+H    E + G   +  D I F   E+V  +  + D+ V     ++ ++I
Sbjct  3    ILFCSKSFPAAH----ERIPG--LLPEDRIEFCGPEDVARLAPEADVLVPLITPISEEII  56

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            +S  R  LI QFGVGLE VD+ AAT HG+ VAR+PS  +GNA S AE A+ L++ L R  
Sbjct  57   ASG-RFGLIHQFGVGLEVVDMEAATRHGVMVARVPSAESGNAGSVAEHALMLMIMLSRNL  115

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
                        G P G  L+G+T  ++
Sbjct  116  GAAARNFASGRFGAPTGQALIGRTACVV  143



>ref|WP_035265554.1| lactate dehydrogenase [Desulfosarcina sp. BuS5]
Length=320

 Score = 85.9 bits (211),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 78/145 (54%), Gaps = 6/145 (4%)
 Frame = +2

Query  206  RVLFCGPN--FPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLI  379
            ++LF  P   +       R  + G++F        +N    +K YD+ +     +   +I
Sbjct  2    KILFAAPENAWGGFLGLIRSELPGHTFEATGRFRADN----LKGYDVLIPTMCSVTEQMI  57

Query  380  SSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKX  559
            +++ R++LI Q G GLEGVD+ AA  + I VA +P+  +GNA S AE+ IY+++GL R  
Sbjct  58   TASDRLRLIQQCGSGLEGVDVEAAIKNNIWVANVPTANSGNADSVAEIGIYMMIGLSRNF  117

Query  560  HEMDIAIKQKMLGEPIGDTLLGKTV  634
              M  ++    +GEP G +L GKT 
Sbjct  118  KNMAQSMLAGKMGEPRGKSLCGKTA  142



>ref|WP_034912135.1| lactate dehydrogenase [Erwinia sp. 9145]
Length=315

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 65/100 (65%), Gaps = 0/100 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D+ +  +  +++ L+S+A R+KLI Q G GLE VDI +A+A GI VA +PS ++GNA S
Sbjct  42   FDVLIPGSAEVSASLLSTADRLKLIQQPGAGLESVDIDSASALGIPVANVPSDSSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             AE+ I+L++ L R   E+   I  +  G P+G  L GKT
Sbjct  102  VAELGIWLMISLARGAREIPQMIATRQTGLPVGIGLAGKT  141



>ref|WP_017800580.1| lactate dehydrogenase [Erwinia toletana]
Length=315

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 62/93 (67%), Gaps = 0/93 (0%)
 Frame = +2

Query  332  YDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATS  511
            +D+ +    R+++ L+ +A  +KLI Q G GLEGVDI +A   GI VA +PS  +GNA S
Sbjct  42   FDVLIPGMARVDARLLQTADNLKLIQQAGAGLEGVDIHSAGEQGIIVANVPSDHSGNADS  101

Query  512  CAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIG  610
             AE+ I++++GL RK  E+  +I Q+ LG+P G
Sbjct  102  VAELGIWMMIGLARKALELPDSIAQQRLGQPTG  134



>emb|CCK81373.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding, catalytic 
region, fragment [Desulfobacula toluolica Tol2]
Length=143

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 70/122 (57%), Gaps = 4/122 (3%)
 Frame = +2

Query  245  NYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVG  424
            N  ++ + G+ FI        ++  +    D+ +    R+  + + +A +++LI Q G G
Sbjct  17   NRVKKILPGHEFIAEGRFEITDLSGI----DVLIPTMSRVTEETLKTADKLQLIQQCGAG  72

Query  425  LEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEP  604
            LE VDI AA   GI VA +P+  +GNA S AE+AIYL++GL R    M  ++K +++G P
Sbjct  73   LELVDINAARKRGIFVANVPTDVSGNADSVAELAIYLMIGLSRNTEMMKDSLKNRIMGGP  132

Query  605  IG  610
            +G
Sbjct  133  MG  134



>gb|EWM13769.1| D-3-phosphoglycerate dehydrogenase [Kutzneria sp. 744]
Length=194

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 68/118 (58%), Gaps = 5/118 (4%)
 Frame = +2

Query  302  FENVPAVIKDY----DICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIK  469
            F++ PA   +     D+       ++++L+S A     + QFGVGLE VD+ AATA G+ 
Sbjct  25   FQSSPAGFAEMADGMDVVTPIAATVDANLLSRAT-FGFVQQFGVGLETVDMDAATAAGVW  83

Query  470  VARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            VAR+P   TGNA + AE AI L L L R+  E   A++++   +P G +L G TV I+
Sbjct  84   VARLPGDVTGNADAVAEQAILLTLALSRQLDEARQALRERKWAQPAGRSLSGGTVAII  141



>ref|WP_043730098.1| hypothetical protein, partial [Kutzneria sp. 744]
Length=104

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  404  IMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK  583
            + QFGVGLE VD+ AATA G+ VAR+P   TGNA + AE AI L L L R+  E   A++
Sbjct  1    VQQFGVGLETVDMDAATAAGVWVARLPGDVTGNADAVAEQAILLTLALSRQLDEARQALR  60

Query  584  QKMLGEPIGDTLLGKTVFIM  643
            ++   +P G +L G TV I+
Sbjct  61   ERKWAQPAGRSLSGGTVAII  80



>gb|AHF97449.1| lactate dehydrogenase [Desulfurella acetivorans A63]
Length=319

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 78/147 (53%), Gaps = 4/147 (3%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            +V   G +F    NY  E +    F   + IP   +   I + D+ +    +++++LI  
Sbjct  5    KVFVAGIHFVGIQNYINECLDVLEF---EFIPESALEYRIHECDVLIPAMSKIDANLIEK  61

Query  386  AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHE  565
            A+ +KLI Q+G GL+GVDI AAT  GI VA +P+  TGNA S AE +I   + L R    
Sbjct  62   AQNLKLIHQWGAGLDGVDIVAATKKGIYVANVPTANTGNAESVAEWSIMAAIALARGFPY  121

Query  566  MDIAIKQKM-LGEPIGDTLLGKTVFIM  643
            +   +   +  G P+G +L+GK   I+
Sbjct  122  IQNNVYNAVGWGCPVGISLIGKKALII  148



>ref|WP_040401337.1| hypothetical protein, partial [Amorphus coralli]
Length=282

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 62/100 (62%), Gaps = 1/100 (1%)
 Frame = +2

Query  335  DICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSC  514
            D+ +    R++  L+ + + ++LI+QFG GLEGVD+ AA+A GI VA +P+  TGNA S 
Sbjct  2    DVLIPTMTRIDGALMDAVRGLRLIIQFGSGLEGVDVEAASARGIAVANVPTAGTGNAESV  61

Query  515  AEMAIYLILGLLRKXH-EMDIAIKQKMLGEPIGDTLLGKT  631
            AE ++   + +LRK     D        G+PIG +LLGKT
Sbjct  62   AEWSVMAAIAVLRKLPLAFDEIRGGASWGKPIGRSLLGKT  101



>ref|WP_033397128.1| lactate dehydrogenase [Desulfobacter curvatus]
Length=314

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = +2

Query  323  IKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGN  502
            +K  D+ +     +  +++ SA R+KLI Q G GLE VDI AA    I+V  +P+  +GN
Sbjct  39   LKGIDVLIPTMSAVTEEILDSADRLKLIQQCGSGLESVDIEAAQKRDIRVCNVPTDISGN  98

Query  503  ATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
            A S AE+ IY+++GL R    M   + ++ +GEP G +L GKT
Sbjct  99   ADSVAELGIYMMIGLSRNIPVMAKNMAKRKMGEPQGISLQGKT  141



>ref|WP_020711063.1| hypothetical protein [Acidobacteriaceae bacterium KBS 83]
Length=316

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 80/143 (56%), Gaps = 2/143 (1%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            R+LFCG  FP +  Y RE++   +  ++   P  ++   +   D+ + K  R+ ++ I  
Sbjct  2    RILFCGNTFPDAPEYLREHLDPGANDEIIVCPDADIVPHLAGVDVIIPKMQRIGAEAIQ-  60

Query  386  AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHE  565
            A   +L+ Q+G GLEGVDI AA   G+ VA +P+   GNA S AE A+ L L LLR   +
Sbjct  61   AGTFRLVQQWGAGLEGVDIDAARRKGVFVANVPA-TGGNAESVAEHAMLLTLALLRDLPK  119

Query  566  MDIAIKQKMLGEPIGDTLLGKTV  634
                ++  +LG P+G  L G+TV
Sbjct  120  AQTHVRTGVLGAPLGKVLAGRTV  142



>ref|WP_037135542.1| 2-hydroxyacid dehydrogenase [Rhizobium sp. CF394]
Length=313

 Score = 77.8 bits (190),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 80/143 (56%), Gaps = 5/143 (3%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            +++FCG  FP    Y  + + G   I V D   E +P  I   D+ + + L++ +  +  
Sbjct  2    KIVFCGNTFPDMPAYLEQALDGGHDITVWDGNPETMPTNI---DVLIPRALQVGAVDMDR  58

Query  386  AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHE  565
             K ++ I QFGVGL+GVD AAA A GI VA +P G  GNA S AE A+ L+L LLR+   
Sbjct  59   GK-VRFIQQFGVGLDGVDAAAARARGIPVANVP-GTGGNADSVAEHAMLLLLMLLRQGVR  116

Query  566  MDIAIKQKMLGEPIGDTLLGKTV  634
                + + +LG P G  L GKTV
Sbjct  117  AQRNVLEGILGAPTGRALSGKTV  139



>ref|WP_004073201.1| lactate dehydrogenase [Desulfobacter postgatei]
 gb|EIM63848.1| lactate dehydrogenase-like oxidoreductase [Desulfobacter postgatei 
2ac9]
Length=314

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = +2

Query  323  IKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGN  502
            +K  D+ +     +   ++ SA R+KLI Q G GLE VDI AA    I+V  +P+  +GN
Sbjct  39   LKGIDVLIPTMSPVTEKILDSADRLKLIQQCGSGLEAVDIEAAEKRNIRVCNVPTDISGN  98

Query  503  ATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
            A S AE+ IY+++GL R    M   +  + +GEP G +L GKT
Sbjct  99   ADSVAELGIYMMIGLSRNVPVMANNMANRKMGEPQGISLQGKT  141



>ref|WP_024821851.1| hypothetical protein [Aminobacterium mobile]
Length=330

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 74/140 (53%), Gaps = 3/140 (2%)
 Frame = +2

Query  209  VLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSA  388
            +LF G +F    +      QG+     DD+  ++    +   D+ +++ + +  +L+S A
Sbjct  3    ILFAGKSFLRLWDLLLPAFQGHEMDVADDLDLKDK---LPWADVLIIRPMSVTYELLSKA  59

Query  389  KRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEM  568
             R+K++ Q+GVG+EG+DI A T  GI    IPS  TGNA   AE+A+  ++ L R+    
Sbjct  60   PRLKMVQQWGVGVEGLDIEACTKLGIFACNIPSRGTGNAEGVAEIALLHMMLLARRYARS  119

Query  569  DIAIKQKMLGEPIGDTLLGK  628
               I +  +  P G TL GK
Sbjct  120  QEKISEGKIFTPPGITLWGK  139



>ref|WP_018114836.1| hypothetical protein [Rhizobium sp. JGI 0001005-K05]
Length=313

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 81/143 (57%), Gaps = 5/143 (3%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            R++F G  FP   +Y +  + G   I + D     +P+ I   D+ + +  R+ +  +  
Sbjct  2    RIVFSGHTFPDMPDYLKRSLAGEHEILLWDGELTTMPSKI---DVLIPRAQRIGAVEMDR  58

Query  386  AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHE  565
               +K I QFGVGL+GVD+AAA    I VA +P G  GNA S AE AI L+L LLR+ ++
Sbjct  59   GN-VKFIQQFGVGLDGVDLAAARCRRIPVANVP-GTGGNADSVAEHAILLLLMLLRQCNK  116

Query  566  MDIAIKQKMLGEPIGDTLLGKTV  634
            +   I+  +LG PIG  L G++V
Sbjct  117  VRENIRDGILGAPIGTALAGRSV  139



>ref|WP_013570641.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Terriglobus saanensis]
 gb|ADV84911.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Terriglobus saanensis SP1PR4]
Length=316

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 2/143 (1%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            R+LFCG NFP +  Y R+++      ++      +V   +   D+ + K LR+    +  
Sbjct  2    RILFCGNNFPDAPEYLRKHLPPGCNDEIVVCSETDVLPQLGRADVVIPKMLRMGRREME-  60

Query  386  AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHE  565
            A + +LI Q+G GLEG+D+ +A   G+ VA +P+   GNA S AE A+ LIL LLR   +
Sbjct  61   AGQFRLIQQWGAGLEGIDLESAKQKGVYVANVPA-TGGNAESVAEHALLLILALLRDLPK  119

Query  566  MDIAIKQKMLGEPIGDTLLGKTV  634
             D  ++  +LG P+G  L G+TV
Sbjct  120  ADANVRAGVLGAPLGKMLAGRTV  142



>ref|WP_022842734.1| lactate dehydrogenase [Acidobacteriaceae bacterium TAA166]
Length=316

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 79/143 (55%), Gaps = 2/143 (1%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            R+LFCG  FP +  Y RE +      ++      ++ + +   D+ + K  R+ S  + +
Sbjct  2    RILFCGNTFPNAPEYLREQLPAECNDEILTCSDSDILSKLSGVDVVIPKMQRIGSREMEA  61

Query  386  AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHE  565
             K  +LI Q+G GLEG+D+ +A   GI V+ +P+   GNA S AE A+ LIL LLR   +
Sbjct  62   GK-FRLIQQWGAGLEGIDLESARRRGIYVSNVPA-TGGNAESVAEHAMLLILALLRDLPK  119

Query  566  MDIAIKQKMLGEPIGDTLLGKTV  634
                ++  +LG P+G  L G+TV
Sbjct  120  AQSNVRSGVLGAPLGKMLAGRTV  142



>ref|XP_008461935.1| PREDICTED: formate dehydrogenase, mitochondrial isoform X3 [Cucumis 
melo]
Length=279

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  509  SCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            SCAEMAIYL+LGLLRK  EM IA+  K LGEP GDTLLGKTVFI+
Sbjct  2    SCAEMAIYLMLGLLRKQKEMQIAVDHKKLGEPTGDTLLGKTVFIL  46



>ref|WP_018335712.1| hypothetical protein [Actinomycetospora chiangmaiensis]
Length=317

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 78/147 (53%), Gaps = 2/147 (1%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVP-AVIKDYDICVVKNLRLNSDLIS  382
            R+   G  FP         +   +  ++D     +VP A     D+       ++  LI 
Sbjct  2    RIGLVGGGFPEVRRCLTAALAELAIPELDGAELVDVPHAAPAPADVLAPLGSTVDGPLID  61

Query  383  SAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXH  562
            +    +L+ QFGVG+ GVD+AAA   G+ VA +P G +GNAT+ AE+A+ L+L LLR+  
Sbjct  62   ACG-ARLVQQFGVGVSGVDLAAARERGVPVANVPGGGSGNATAVAEIALLLLLALLRRYE  120

Query  563  EMDIAIKQKMLGEPIGDTLLGKTVFIM  643
            E    + +K +G P+G  L G+TV ++
Sbjct  121  EARAGVAEKAVGSPMGVMLRGRTVAVL  147



>ref|WP_038572953.1| hypothetical protein, partial [Desulfurella acetivorans]
Length=275

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +2

Query  335  DICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSC  514
            D+ +    +++++LI  A+ +KLI Q+G GL+GVDI AAT  GI VA +P+  TGNA S 
Sbjct  1    DVLIPAMSKIDANLIEKAQNLKLIHQWGAGLDGVDIVAATKKGIYVANVPTANTGNAESV  60

Query  515  AEMAIYLILGLLRKXHEMDIAIKQKM-LGEPIGDTLLGKTVFIM  643
            AE +I   + L R    +   +   +  G P+G +L+GK   I+
Sbjct  61   AEWSIMAAIALARGFPYIQNNVYNAVGWGCPVGISLIGKKALII  104



>ref|WP_041446076.1| hypothetical protein, partial [Thermovirga lienii]
Length=309

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 74/147 (50%), Gaps = 3/147 (2%)
 Frame = +2

Query  203  TRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLIS  382
            ++VL  G  F            G   ++VD    E +   +   ++ V+  ++++  L++
Sbjct  3    SKVLLVGKAFKKLFPEVESVFDG---LEVDVCSEEELLNYLPSTEVMVIGPMKVDEALLN  59

Query  383  SAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXH  562
             A  +K I Q+GVG+E +D+ A    G+KV  +P+  TGNA    E+AI  +L L R+ +
Sbjct  60   KAPNLKFIHQWGVGVEKIDLTACAERGVKVCNVPAKGTGNAEGVGELAIMHMLLLARRWN  119

Query  563  EMDIAIKQKMLGEPIGDTLLGKTVFIM  643
                 +++K L  P G  L  KTV ++
Sbjct  120  RTQENLRKKRLYAPRGVALWKKTVTVI  146



>gb|AER67036.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Thermovirga lienii DSM 17291]
Length=321

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 74/147 (50%), Gaps = 3/147 (2%)
 Frame = +2

Query  203  TRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLIS  382
            ++VL  G  F            G   ++VD    E +   +   ++ V+  ++++  L++
Sbjct  3    SKVLLVGKAFKKLFPEVESVFDG---LEVDVCSEEELLNYLPSTEVMVIGPMKVDEALLN  59

Query  383  SAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXH  562
             A  +K I Q+GVG+E +D+ A    G+KV  +P+  TGNA    E+AI  +L L R+ +
Sbjct  60   KAPNLKFIHQWGVGVEKIDLTACAERGVKVCNVPAKGTGNAEGVGELAIMHMLLLARRWN  119

Query  563  EMDIAIKQKMLGEPIGDTLLGKTVFIM  643
                 +++K L  P G  L  KTV ++
Sbjct  120  RTQENLRKKRLYAPRGVALWKKTVTVI  146



>ref|WP_029716541.1| hypothetical protein [Atribacteria bacterium SCGC AAA255-G05]
Length=309

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 74/129 (57%), Gaps = 6/129 (5%)
 Frame = +2

Query  266  QGYSFIQVDDIPF---ENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGV  436
            +G+  I   + P    + +  VIKD D  +V   ++N  ++ +AK++K++ +FGVG + +
Sbjct  28   KGFEVISFYEDPMLSEDKLIEVIKDIDGYIVGLEKINEKVLEAAKKLKVVCKFGVGTDNI  87

Query  437  DIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDT  616
            DI AA  HG+KVA  P     N+ + AE+A+ L++ L R+  +++  +KQ      IG  
Sbjct  88   DIKAAEKHGVKVANCPG---SNSNAVAELALGLMISLARRIPQLNFEVKQDKWPYHIGAE  144

Query  617  LLGKTVFIM  643
            + GK + I+
Sbjct  145  ISGKVLGIV  153



>ref|WP_014806274.1| glyoxylate reductase [Anaerobaculum mobile]
 gb|AFM21035.1| lactate dehydrogenase-like oxidoreductase [Anaerobaculum mobile 
DSM 13181]
Length=322

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/149 (31%), Positives = 77/149 (52%), Gaps = 9/149 (6%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVP---AVIKDYDICVVKNLRLNSDL  376
            RVLF   NF            G+      +I + N+    ++++  D+ V       +++
Sbjct  2    RVLFSNRNFERLREIIEPLFMGH------EIKYANISEDVSLLEWADVLVRGTEPFTAEM  55

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            +S A  +K++ Q+GVG+EG+DI A +A G+ V  +PS  TGNA   AE+AI  +L L + 
Sbjct  56   LSFAPNLKMVCQWGVGVEGIDIEACSAKGVFVCNVPSSNTGNAEGVAEVAILHMLLLAKG  115

Query  557  XHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             ++    +K+  +  P G TL  K V I+
Sbjct  116  YNKSQENLKKGKVFSPRGLTLWRKRVCIV  144



>gb|AFZ33157.1| Glyoxylate reductase [Gloeocapsa sp. PCC 7428]
Length=321

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 71/137 (52%), Gaps = 9/137 (7%)
 Frame = +2

Query  236  ASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQF  415
            +S N  +     +S   V  +P + V     D  + V     +++ L+    +++L+ + 
Sbjct  19   SSGNLAQRIAHHFSPKTVITLPHDRVVLDAPDTFVLVPGIQPVDAALMDRLPQLRLVQRS  78

Query  416  GVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLR--KXHEMDIAIKQK  589
            GVG+E VDIAAAT  GI VA +PS  TGNA S AE+AI  +L L R  +  E+D      
Sbjct  79   GVGVENVDIAAATQRGIYVANVPSPGTGNAESVAELAILHMLALARNYRASELD------  132

Query  590  MLGEPIGDTLLGKTVFI  640
               +P G +L  KTV I
Sbjct  133  -WNQPEGQSLWKKTVGI  148



>ref|WP_041919487.1| hypothetical protein, partial [Gloeocapsa sp. PCC 7428]
Length=269

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = +2

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
            +++ L+    +++L+ + GVG+E VDIAAAT  GI VA +PS  TGNA S AE+AI  +L
Sbjct  9    VDAALMDRLPQLRLVQRSGVGVENVDIAAATQRGIYVANVPSPGTGNAESVAELAILHML  68

Query  542  GLLR--KXHEMDIAIKQKMLGEPIGDTLLGKTVFI  640
             L R  +  E+D         +P G +L  KTV I
Sbjct  69   ALARNYRASELD-------WNQPEGQSLWKKTVGI  96



>ref|WP_012940091.1| 3-phosphoglycerate dehydrogenase [Archaeoglobus profundus]
 ref|YP_003400428.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM 
5631]
 gb|ADB57755.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus profundus DSM 
5631]
Length=525

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 69/120 (58%), Gaps = 6/120 (5%)
 Frame = +2

Query  293  DIPFENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIK  469
            DI  E +  VI+DYD  +V++  R+  D+I  AK++K+I + GVG++ +D+  AT  GI 
Sbjct  29   DISHEELLEVIQDYDALIVRSRTRVTRDVIDRAKKLKIIGRAGVGVDNIDVDYATEKGIV  88

Query  470  VARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEP--IGDTLLGKTVFIM  643
            V   P    GN+ S AE  I LIL + RK  + D ++K+        +G  L GKT+ I+
Sbjct  89   VVNAPG---GNSVSAAEHTIGLILSIARKIPQADRSVKEGKWERKKFVGIELRGKTLGIV  145



>tpg|DAA39793.1| TPA: hypothetical protein ZEAMMB73_065837 [Zea mays]
Length=296

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 56/102 (55%), Gaps = 17/102 (17%)
 Frame = +2

Query  161  GKILKMGE----NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIK  328
            G+  KMG+    NG   +TRVLFCGP +PAS NYTREY+Q Y FIQVD++  E      K
Sbjct  39   GQYSKMGDPSERNGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLEQ-----K  93

Query  329  DYDICVVKNLRLNSDL---ISSAKRMKLIMQFGVGLEGVDIA  445
            + D  V +      DL   +      K I+  G G  G+++A
Sbjct  94   EMDTAVNRK-----DLGVPVGDTLFGKTILILGFGAIGIEVA  130



>gb|ACG30212.1| hypothetical protein [Zea mays]
Length=137

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  185  NGSSHITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFEN  310
            NG   +TRVLFCGP +PAS NYTREY+Q Y FIQVD++  E 
Sbjct  8    NGHGALTRVLFCGPYWPASTNYTREYLQDYPFIQVDEVGLEQ  49



>ref|WP_041306383.1| hypothetical protein, partial [Kyrpidia tusciae]
Length=315

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +2

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
            +N DL+   + ++LI Q GVG++ VD+ AAT  G+ VA +PS  +GNA S AE+A++ +L
Sbjct  53   VNRDLLEGLREVRLIHQAGVGVDSVDVEAATELGVWVANVPSYGSGNAESVAEIALWHML  112

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             L R+  +          G P+G +L  +T
Sbjct  113  TLSRRIRQARERFLSGDWGNPLGVSLRNRT  142



>gb|ADG07683.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Kyrpidia tusciae DSM 2912]
Length=328

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 54/90 (60%), Gaps = 0/90 (0%)
 Frame = +2

Query  362  LNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLIL  541
            +N DL+   + ++LI Q GVG++ VD+ AAT  G+ VA +PS  +GNA S AE+A++ +L
Sbjct  53   VNRDLLEGLREVRLIHQAGVGVDSVDVEAATELGVWVANVPSYGSGNAESVAEIALWHML  112

Query  542  GLLRKXHEMDIAIKQKMLGEPIGDTLLGKT  631
             L R+  +          G P+G +L  +T
Sbjct  113  TLSRRIRQARERFLSGDWGNPLGVSLRNRT  142



>ref|WP_026988575.1| hypothetical protein [Fodinicurvata fenggangensis]
Length=326

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +2

Query  335  DICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSC  514
            DI +    R +  L+     ++LI Q+G GLEGVDI AA   GI VA +P+  +GNA S 
Sbjct  49   DIIIPAMARFDGALMDRIAGLRLIHQWGAGLEGVDIPAAKQRGIAVANVPTAGSGNAESV  108

Query  515  AEMAIYLILGLLRKXHEMDIAIKQ-KMLGEPIGDTLLGKT  631
            AE  +   + + R+   +   I++    G P G  L+GKT
Sbjct  109  AEWCVMAAIAISRRLPVLQEGIREGSSWGGPSGHALMGKT  148



>ref|WP_009201581.1| glyoxylate reductase [Anaerobaculum hydrogeniformans]
 gb|EFD24319.1| 4-phosphoerythronate dehydrogenase [Anaerobaculum hydrogeniformans 
ATCC BAA-1850]
Length=318

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 78/149 (52%), Gaps = 9/149 (6%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENV---PAVIKDYDICVVKNLRLNSDL  376
            RVLF    F       RE ++  +  +  ++ + ++   P  +   ++ V       +++
Sbjct  2    RVLFSNKGF----ERLREIIE--TLFENHEVRYADILEDPDSLGWAEVLVKGTEPFTAEM  55

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            ++ A  MK++ Q+GVGLE +DI A T+ GI V  +PSG TGNA   AE+A+  +L L + 
Sbjct  56   LAHAHNMKMLCQWGVGLESIDIEACTSRGIYVCNVPSGNTGNAEGVAEIALLHMLLLAKG  115

Query  557  XHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             ++    +++  L  P G T+  K V I+
Sbjct  116  YNKSQENLRKGKLFSPRGLTIWRKRVCIV  144



>ref|XP_003839668.1| similar to d-3-phosphoglycerate dehydrogenase [Leptosphaeria 
maculans JN3]
 emb|CBX96189.1| similar to d-3-phosphoglycerate dehydrogenase [Leptosphaeria 
maculans JN3]
Length=620

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 60/94 (64%), Gaps = 4/94 (4%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E + ++I DYD  +V++  ++ +DL+S AK++K++ + GVG++ VD+ +AT+HGI V   
Sbjct  75   EELKSIIGDYDALIVRSETKVTADLLSQAKKLKVVARAGVGVDNVDVQSATSHGIIVVNS  134

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK  583
            PS   GN  + AE  I L++ + R   +   +IK
Sbjct  135  PS---GNINAAAEHTIALLMAVARNVADASQSIK  165



>ref|WP_041587609.1| 2-hydroxyacid dehydrogenase [Thermoanaerobacterium thermosaccharolyticum]
Length=320

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 77/146 (53%), Gaps = 8/146 (5%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDD---IPFEN--VPAVIKDYDICVVKNLRLNS  370
            +VL    +F  + N   E ++ Y +  + +    P+E   +  +IKD D  +V   ++  
Sbjct  4    KVLITPRSFGKTSNIPFEMLKKYDYEIIRNETGKPYEEDELKELIKDVDGVIVGLDKITE  63

Query  371  DLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLL  550
            D++ +AK++K+I ++GVGL+ +DI  A   GIKV   P     N  S A++A  ++LGL 
Sbjct  64   DVLKNAKKLKVITKYGVGLDNIDINYAEKLGIKVTYTPG---ANKESVADLAFTMMLGLS  120

Query  551  RKXHEMDIAIKQKMLGEPIGDTLLGK  628
            R   ++D  ++     + IG  + GK
Sbjct  121  RDIIKLDKIVRNNQWNKIIGCEIYGK  146



>gb|ADL69926.1| Glyoxylate reductase [Thermoanaerobacterium thermosaccharolyticum 
DSM 571]
Length=324

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 77/146 (53%), Gaps = 8/146 (5%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDD---IPFEN--VPAVIKDYDICVVKNLRLNS  370
            +VL    +F  + N   E ++ Y +  + +    P+E   +  +IKD D  +V   ++  
Sbjct  8    KVLITPRSFGKTSNIPFEMLKKYDYEIIRNETGKPYEEDELKELIKDVDGVIVGLDKITE  67

Query  371  DLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLL  550
            D++ +AK++K+I ++GVGL+ +DI  A   GIKV   P     N  S A++A  ++LGL 
Sbjct  68   DVLKNAKKLKVITKYGVGLDNIDINYAEKLGIKVTYTPG---ANKESVADLAFTMMLGLS  124

Query  551  RKXHEMDIAIKQKMLGEPIGDTLLGK  628
            R   ++D  ++     + IG  + GK
Sbjct  125  RDIIKLDKIVRNNQWNKIIGCEIYGK  150



>ref|WP_015740268.1| 3-phosphoglycerate dehydrogenase [Zymomonas mobilis]
 gb|ACV76072.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp. 
mobilis NCIMB 11163]
Length=527

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 6/129 (5%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN-LRLNSDL  376
            +TRVL      P +    RE  +G    Q+  +  E +  +I DYD   +++  ++  D+
Sbjct  1    MTRVLISDKMDPRAAEVFRE--RGVEVDQITGLSPEELKKIINDYDGLAIRSATKVTKDI  58

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            I+ AK +K+I + G+G++ +DI AA+A GI V   P    GN+ + AE AI L+  L R+
Sbjct  59   IAEAKNLKVIGRAGIGVDNIDIPAASAAGIVVMNTP---FGNSITTAEQAIALMFALARQ  115

Query  557  XHEMDIAIK  583
              E + + +
Sbjct  116  IPEANASTQ  124



>ref|WP_014501073.1| 3-phosphoglycerate dehydrogenase [Zymomonas mobilis]
 gb|AEH63275.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp. 
mobilis ATCC 10988]
Length=527

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 6/129 (5%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN-LRLNSDL  376
            +TRVL      P +    RE  +G    Q+  +  E +  +I DYD   +++  ++  D+
Sbjct  1    MTRVLISDKMDPRAAEVFRE--RGVEVDQITGLSPEELKKIINDYDGLAIRSATKVTKDI  58

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            I+ AK +K+I + G+G++ +DI AA+A GI V   P    GN+ + AE AI L+  L R+
Sbjct  59   IAEAKNLKVIGRAGIGVDNIDIPAASAAGIVVMNTP---FGNSITTAEQAIALMFALARQ  115

Query  557  XHEMDIAIK  583
              E + + +
Sbjct  116  IPEANASTQ  124



>ref|WP_011021352.1| glycerate dehydrogenase [Methanosarcina acetivorans]
 ref|NP_616270.1| glycerate dehydrogenase [Methanosarcina acetivorans C2A]
 gb|AAM04750.1| glycerate dehydrogenase [Methanosarcina acetivorans C2A]
Length=319

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 62/109 (57%), Gaps = 5/109 (5%)
 Frame = +2

Query  323  IKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGN  502
            IKD DI VV    ++++ + SA R+K+I  +  G + VD+  AT HG+ V+ +PS A   
Sbjct  42   IKDADIVVVGRYGVSAEALRSAPRLKMISLWQTGFDNVDLEEATDHGVIVSNVPSYAF--  99

Query  503  ATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEP--IGDTLLGKTVFIM  643
              S AE    L L LLR+ H  D+ +++ +      +G+ L+ KT+ ++
Sbjct  100  -ESVAEFVFALTLNLLRRVHLADMNLREGLFDWKYYVGNQLMSKTIGVL  147



>ref|WP_017750993.1| hypothetical protein [Clostridium tyrobutyricum]
Length=326

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 70/133 (53%), Gaps = 7/133 (5%)
 Frame = +2

Query  242  HNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGV  421
             NY +E  QG     + DI  E +   IKD D  + +N  +N  +I SAK++K+I   GV
Sbjct  16   KNYLKE--QGCEIKTIPDISEETLIKNIKDCDAVLTRNAIINEKVIKSAKKLKVISMHGV  73

Query  422  GLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQK--ML  595
            G++ +D+ AAT +GI+V   P     N  S AE  I LI+ L +     D  +++    +
Sbjct  74   GVDIIDVDAATKYGIQVTNAPE---SNKNSVAEYTIGLIIALSKNLLTYDKELRKGNFQI  130

Query  596  GEPIGDTLLGKTV  634
             + +G  L GKT+
Sbjct  131  RKVLGMDLEGKTL  143



>ref|XP_003304604.1| hypothetical protein PTT_17253 [Pyrenophora teres f. teres 0-1]
 gb|EFQ87289.1| hypothetical protein PTT_17253 [Pyrenophora teres f. teres 0-1]
Length=586

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 59/94 (63%), Gaps = 4/94 (4%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E +  +I DYD  +V++  ++ +DL+ +AK+MK++ + GVG++ VD+ +AT+HGI V   
Sbjct  41   EELKKIIGDYDALIVRSETKVTADLLGAAKKMKVVARAGVGVDNVDVQSATSHGIIVVNS  100

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK  583
            PS   GN  + AE  I L++ + R   +   +IK
Sbjct  101  PS---GNINAAAEHTIALLMAVARNVGDASQSIK  131



>ref|WP_023593659.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis]
 gb|AHB10758.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp. 
mobilis str. CP4 = NRRL B-14023]
 gb|AHJ71070.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp. 
mobilis NRRL B-12526]
 gb|AHJ72923.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp. 
mobilis str. CP4 = NRRL B-14023]
Length=527

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 70/129 (54%), Gaps = 6/129 (5%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN-LRLNSDL  376
            +TRVL      P +    RE  +G    Q+  +  E +  +I DYD   +++  ++  D+
Sbjct  1    MTRVLISDKMDPRAAEVFRE--RGVEVDQITGLSPEELKKIINDYDGLAIRSATKVTKDI  58

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            I+ AK +K+I + G+G++ +DI AA++ GI V   P    GN+ + AE AI L+  L R+
Sbjct  59   IAEAKNLKVIGRAGIGVDNIDIPAASSAGIVVMNTP---FGNSITTAEQAIALMFALARQ  115

Query  557  XHEMDIAIK  583
              E + + +
Sbjct  116  IPEANASTQ  124



>ref|WP_011241433.1| 3-phosphoglycerate dehydrogenase [Zymomonas mobilis]
 gb|AAV90309.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp. 
mobilis ZM4 = ATCC 31821]
Length=527

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 70/129 (54%), Gaps = 6/129 (5%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN-LRLNSDL  376
            +TRVL      P +    RE  +G    Q+  +  E +  +I DYD   +++  ++  D+
Sbjct  1    MTRVLISDKMDPRAAEVFRE--RGVEVDQITGLSPEELKKIINDYDGLAIRSATKVTKDI  58

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            I+ AK +K+I + G+G++ +DI AA++ GI V   P    GN+ + AE AI L+  L R+
Sbjct  59   IAEAKNLKVIGRAGIGVDNIDIPAASSAGIVVMNTP---FGNSITTAEQAIALMFALARQ  115

Query  557  XHEMDIAIK  583
              E + + +
Sbjct  116  IPEANASTQ  124



>dbj|BAE03264.1| phosphoglycerate dehydrogenase [unclutured Candidatus Nitrosocaldus 
sp.]
Length=312

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 68/119 (57%), Gaps = 10/119 (8%)
 Frame = +2

Query  281  IQVD---DIPFENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAA  448
            +QVD   DI +E + A IKDY++ VV++  ++  D+I +A+ +K+I + GVGL+ +D+  
Sbjct  26   LQVDYKPDIKYEELLATIKDYNVLVVRSRTKVRKDVIDAAQNLKIIARVGVGLDNIDVEY  85

Query  449  ATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLG  625
            A + GIKV      A    ++ AE+ I L++ L R     D  +KQ   G  I   L+G
Sbjct  86   AKSKGIKVVNAEEAAM---SAVAELVIGLMICLARGIVRADTTMKQ---GRWIKSELMG  138



>ref|WP_014736776.1| 2-hydroxyacid dehydrogenase [Thermogladius cellulolyticus]
 ref|YP_006362663.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Thermogladius cellulolyticus 1633]
 gb|AFK50525.1| D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein 
[Thermogladius cellulolyticus 1633]
Length=309

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 80/148 (54%), Gaps = 8/148 (5%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNL-RLNSDL  376
            + RVL       ++ +Y +   QG+  ++V +   + +  +IK +   +V++  R+   +
Sbjct  5    VYRVLVASKISRSAVDYLKS--QGFEVVEVHEPSEDELARLIKGFHAIIVRSKPRVTRRV  62

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            I +A ++K+I + GVGL+ +D+ AA + GIKV   P   T    + AE+ + L+L LLRK
Sbjct  63   IEAADQLKVIARAGVGLDNIDVQAAESRGIKVVNAPESVT---QAVAELTVGLMLALLRK  119

Query  557  XHEMDIAIKQKML--GEPIGDTLLGKTV  634
                D  +++ +    E +G  L GKT+
Sbjct  120  IAFSDRKMREGVWVKHEAVGTELKGKTL  147



>ref|WP_014849257.1| 3-phosphoglycerate dehydrogenase [Zymomonas mobilis]
 gb|AFN57297.1| D-3-phosphoglycerate dehydrogenase [Zymomonas mobilis subsp. 
mobilis ATCC 29191]
Length=527

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 70/129 (54%), Gaps = 6/129 (5%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN-LRLNSDL  376
            ++RVL      P +    RE  +G    Q+  +  E +  +I DYD   +++  ++  D+
Sbjct  1    MSRVLISDKMDPRAAEVFRE--RGVEVDQITGLSPEELKKIINDYDGLAIRSATKVTKDI  58

Query  377  ISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRK  556
            I+ AK +K+I + G+G++ +DI AA+A GI V   P    GN+ + AE AI L+  L R+
Sbjct  59   IAEAKNLKVIGRAGIGVDNIDIPAASAAGIVVMNTP---FGNSITTAEQAIALMFALARQ  115

Query  557  XHEMDIAIK  583
              E + + +
Sbjct  116  IPEANASTQ  124



>ref|WP_017471569.1| 3-phosphoglycerate dehydrogenase [Amphibacillus jilinensis]
Length=528

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/149 (29%), Positives = 76/149 (51%), Gaps = 7/149 (5%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKN-LRLNSDLIS  382
            RVL   P       Y        +   + D+  E +   I DYD  +V++  ++  ++I+
Sbjct  4    RVLISDP-LSEDGIYPLREADNITVDMLTDLTPEQLTEAIVDYDALLVRSQTKVTKEMIA  62

Query  383  SAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXH  562
            + K++K+I + GVG++ +D+ AAT HG+ V   P    GN  S AE  + +++ L RK  
Sbjct  63   AGKQLKIIGRAGVGVDNIDLDAATEHGVIVVNAPD---GNTNSAAEHTVAMLMALARKIP  119

Query  563  EMDIAIKQKMLGEP--IGDTLLGKTVFIM  643
            +   A+KQ+       +G  L GKT+ ++
Sbjct  120  QAYYALKQQKWDRKTHVGVELKGKTLGVI  148



>ref|WP_006111248.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Natrialba asiatica]
 gb|ELY97174.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Natrialba asiatica DSM 12278]
Length=319

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 56/93 (60%), Gaps = 3/93 (3%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIP  484
            E +   + D D  +++ + L++DLI+ A+R+K+I + GVGL+ +DI AA+  GI V   P
Sbjct  36   ETIGDQLPDADAIILRGVELDTDLIADAERLKVISKHGVGLDSIDIDAASDRGIVVCNTP  95

Query  485  SGATGNATSCAEMAIYLILGLLRKXHEMDIAIK  583
                 N+ + AE AI LIL + R   + D A++
Sbjct  96   Q---ANSRTVAEHAITLILTMRRNLLQADRAVR  125



>ref|WP_009604978.1| 3-phosphoglycerate dehydrogenase [SAR116 cluster alpha proteobacterium 
HIMB100]
 gb|EHI47750.1| D-3-phosphoglycerate dehydrogenase [SAR116 cluster alpha proteobacterium 
HIMB100]
Length=527

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 81/152 (53%), Gaps = 18/152 (12%)
 Frame = +2

Query  200  ITRVLFCGPNFPASHNYTREYVQGYSFIQVDDIP---FENVPAVIKDYDICVVKN-LRLN  367
            +T+VL      PA+ +  RE     + I+VD  P    E +  +I DYD   +++  ++ 
Sbjct  1    MTKVLISDKLAPAAADIFRE-----AGIEVDVKPGLSPEELAEIISDYDGLAIRSATKVT  55

Query  368  SDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGL  547
            ++L+  A ++K++ + G+G++ VDIAAATA G+ V   P    GNA + AE AI ++L L
Sbjct  56   AELLDKAPQLKVVGRAGIGVDNVDIAAATASGVVVMNTP---FGNAVTTAEHAISMLLAL  112

Query  548  LRKXHEMDIAI------KQKMLGEPIGDTLLG  625
             R+  +  ++       K + +G  I    LG
Sbjct  113  ARQIPQAHLSTAASKWEKSRFMGTEISGKKLG  144



>ref|WP_041076035.1| hypothetical protein [Thermotoga caldifontis]
Length=323

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 3/88 (3%)
 Frame = +2

Query  323  IKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGN  502
            I D D  +V+     +++I SA ++K+I + GVG++ +D+  A+ HGI V   P+    N
Sbjct  39   IVDCDGVIVRTAPFTAEIIRSAPKLKVIARHGVGVDNIDVEEASKHGIYVVNTPN---AN  95

Query  503  ATSCAEMAIYLILGLLRKXHEMDIAIKQ  586
            A S AE  +  IL L +K  EMD+A ++
Sbjct  96   ALSVAEATVAFILALAKKLKEMDVATRK  123



>ref|XP_007684918.1| hypothetical protein COCMIDRAFT_23723 [Bipolaris oryzae ATCC 
44560]
 gb|EUC48556.1| hypothetical protein COCMIDRAFT_23723 [Bipolaris oryzae ATCC 
44560]
Length=594

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E + ++I +YD  VV++  ++ +DL+ +AK MK++ + GVG++ VD+ +AT HGI V   
Sbjct  41   EELKSIIGEYDALVVRSETKVTADLLKAAKNMKVVARAGVGVDNVDVQSATQHGIIVVNS  100

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK--QKMLGEPIGDTLLGKTVFIM  643
            PS   GN  + AE  I L++ + R   +   +IK  +   G  +G    GKT+ I+
Sbjct  101  PS---GNINAAAEHTIALLMAVARNVGDASQSIKAGKWERGRLVGVEAKGKTLAIV  153



>ref|XP_001937038.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU49625.1| D-3-phosphoglycerate dehydrogenase [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=573

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 60/94 (64%), Gaps = 4/94 (4%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E + ++I DYD  +V++  ++ ++L+ +AK+MK++ + GVG++ VD+ +AT+HGI V   
Sbjct  41   EELKSIIGDYDALIVRSETKVTAELLGAAKKMKVVARAGVGVDNVDVQSATSHGIIVVNS  100

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK  583
            PS   GN  + AE  I L++ + R   +   +IK
Sbjct  101  PS---GNINAAAEHTITLLMAVARNVGDASQSIK  131



>ref|WP_013253378.1| phosphoglycerate dehydrogenase [Spirochaeta smaragdinae]
 gb|ADK79914.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Spirochaeta smaragdinae DSM 11293]
Length=319

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 68/121 (56%), Gaps = 8/121 (7%)
 Frame = +2

Query  293  DIP---FENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHG  463
            D+P   FE +  ++ D D  ++   R + ++ + A R+K I +FGVG++ +D++AA   G
Sbjct  35   DMPYYSFEQLRPLVADIDAAIIGMDRWDEEIFALAPRLKAIARFGVGIDNIDLSAARQRG  94

Query  464  IKVARIPSGATG-NATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFI  640
            IKV    + A G NA + AE+A+  I  ++R    ++  + + +    +G  L GKTV +
Sbjct  95   IKV----TNALGMNANAVAELAVGYIFDMVRNTIRLNADLSKGVWSRAVGHDLKGKTVGL  150

Query  641  M  643
            +
Sbjct  151  L  151



>ref|WP_039279002.1| phosphoglycerate dehydrogenase [Novosphingobium malaysiense]
 gb|KHK93241.1| phosphoglycerate dehydrogenase [Novosphingobium malaysiense]
Length=318

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 2/96 (2%)
 Frame = +2

Query  323  IKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGN  502
            + D  + V++   L  D+  S   +K I++ G G++ +DI AAT   + VA  P G   N
Sbjct  39   LADTSVIVIRTSPLGEDVFGSMSHLKAIVKHGAGVDNIDIPAATGRQVMVANTPGG--NN  96

Query  503  ATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIG  610
            +T+ AE A+ ++L LLR+  EMD  +++    E  G
Sbjct  97   STAVAEGAVSMMLALLRRVREMDALVREDRWAERWG  132



>ref|WP_035230720.1| 3-phosphoglycerate dehydrogenase [Desulfobulbus sp. Tol-SR]
 gb|KGO33875.1| 3-phosphoglycerate dehydrogenase [Desulfobulbus sp. Tol-SR]
Length=530

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 72/123 (59%), Gaps = 9/123 (7%)
 Frame = +2

Query  281  IQVDDIP---FENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAA  448
            ++VD IP    E +  +I +Y+  V+++  ++ +DL+ +A R+K++ + G+GL+ VDI A
Sbjct  22   LEVDSIPGLKPEELKKIIGNYEGLVIRSATKVTADLLEAAHRLKVVGRAGIGLDNVDIPA  81

Query  449  ATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEP--IGDTLL  622
            A+  GI V   PS   GNAT+ AE AI +++ L R   +   ++K     +   +G  L 
Sbjct  82   ASQKGIVVMNAPS---GNATTAAEHAIAMMMSLSRNIPQATASMKAGKWEKKSFMGRELT  138

Query  623  GKT  631
            GKT
Sbjct  139  GKT  141



>ref|WP_006877083.1| phosphoglycerate dehydrogenase [Anaerotruncus colihominis]
 gb|EDS08925.1| 4-phosphoerythronate dehydrogenase [Anaerotruncus colihominis 
DSM 17241]
Length=319

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 62/114 (54%), Gaps = 3/114 (3%)
 Frame = +2

Query  302  FENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            FE +     + D  ++   + N  +   A ++K++ +FGVG++ +D+ AA  HG++V   
Sbjct  41   FEELAVWAPEIDGAIIGMDQWNEQVFQIAPKLKILARFGVGVDNIDLEAAKRHGVQVV--  98

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFIM  643
             + A  NA + AE+A+ +IL  LR   E++  +        +G  LLGKTV ++
Sbjct  99   -NAAGMNANAVAELAVAMILNCLRGIPELNRKLTDGQWSRAVGRDLLGKTVGLL  151



>dbj|GAK55269.1| D-3-phosphoglycerate dehydrogenase [bacterium UASB270]
Length=323

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 69/129 (53%), Gaps = 6/129 (5%)
 Frame = +2

Query  266  QGYSFIQV---DDIPFENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGV  436
            QG + I+     D+P E +   ++  D  +V    +  +L+ SA+ +K+I++ GVGL+ +
Sbjct  27   QGCAIIECREGKDVPHERLKQAVQTADAWIVSFYPITRELLESARNLKVIVKHGVGLDNI  86

Query  437  DIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDT  616
            D+ AATA GI V   P GAT +  S  E+ + ++L L R+ HE    +         G  
Sbjct  87   DLEAATARGILVVIAP-GATEH--SVPELTLGMLLCLARRIHEAHQTVVAGQWNRFPGVG  143

Query  617  LLGKTVFIM  643
            L GKT+ I+
Sbjct  144  LYGKTLGIL  152



>ref|XP_007700157.1| hypothetical protein COCSADRAFT_142735 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD64338.1| hypothetical protein COCSADRAFT_142735 [Bipolaris sorokiniana 
ND90Pr]
Length=593

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E + ++I +YD  +V++  ++ +DL+ +AK MK++ + GVG++ VD+ +AT HGI V   
Sbjct  41   EELKSIIGEYDALIVRSETKVTADLLKAAKNMKVVARAGVGVDNVDVQSATQHGIIVVNS  100

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK--QKMLGEPIGDTLLGKTVFIM  643
            PS   GN  + AE  I L++ + R   +   +IK  +   G  +G    GKT+ I+
Sbjct  101  PS---GNINAAAEHTIALLMAVARNVGDASQSIKAGKWERGRLVGVEAKGKTLAIV  153



>gb|EUN28394.1| hypothetical protein COCVIDRAFT_25485 [Bipolaris victoriae FI3]
Length=594

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E + ++I +YD  +V++  ++ +DL+ +AK MK++ + GVG++ VD+ +AT HGI V   
Sbjct  41   EELKSIIGEYDALIVRSETKVTADLLKAAKNMKVVARAGVGVDNVDVQSATQHGIIVVNS  100

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK--QKMLGEPIGDTLLGKTVFIM  643
            PS   GN  + AE  I L++ + R   +   +IK  +   G  +G    GKT+ I+
Sbjct  101  PS---GNINAAAEHTIALLMAVARNVGDASQSIKAGKWERGRLVGVEAKGKTLAIV  153



>gb|EMD88769.1| hypothetical protein COCHEDRAFT_67241 [Bipolaris maydis C5]
 gb|ENI05516.1| hypothetical protein COCC4DRAFT_137389 [Bipolaris maydis ATCC 
48331]
Length=572

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E + ++I +YD  +V++  ++ +DL+ +AK MK++ + GVG++ VD+ +AT HGI V   
Sbjct  37   EELKSIIGEYDALIVRSETKVTADLLKAAKNMKVVARAGVGVDNVDVQSATQHGIIVVNS  96

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK--QKMLGEPIGDTLLGKTVFIM  643
            PS   GN  + AE  I L++ + R   +   +IK  +   G  +G    GKT+ I+
Sbjct  97   PS---GNINAAAEHTIALLMAVARNVGDASQSIKAGKWERGRLVGVEAKGKTLAIV  149



>ref|WP_022726624.1| lactate dehydrogenase [Fodinicurvata sediminis]
Length=326

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +2

Query  335  DICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSC  514
            D+ +      +  L+     ++LI Q+G GLEGVDI AA+  GI VA +P+  +GNA S 
Sbjct  49   DVIIPAMAHFDGALMDCISGLRLIHQWGAGLEGVDIPAASQRGIAVANVPTAGSGNAESV  108

Query  515  AEMAIYLILGLLRKXHEMDIAIKQ-KMLGEPIGDTLLGKT  631
            AE  +   + + R    +   I++    G P G  L+GKT
Sbjct  109  AEWCVMAAIAISRCLPLLQEGIRECTTWGGPSGHALMGKT  148



>ref|WP_008982449.1| hydroxyacid dehydrogenase [Ruminococcaceae bacterium D16]
 gb|EGJ45882.1| phosphoglycerate dehydrogenase [Ruminococcaceae bacterium D16]
Length=323

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 76/147 (52%), Gaps = 10/147 (7%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYDICVVKNLRLNSDLISS  385
            RVL   P  PA + + +E+  GY  +       E++ A I D D  +++  ++ + ++ +
Sbjct  4    RVLLPQPILPAGYEFLQEH--GYEVVDGRGFTEEDIIADIVDCDAAIIRTAKVTAKILDA  61

Query  386  AKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHE  565
            A ++K+I++ G G +GVD+ AA  HG+ V    +    NA S AE+ I+ +L   R   +
Sbjct  62   APKLKIIVRHGAGYDGVDLDAARKHGVLVC---TAGGSNAISVAELTIFYMLYCSRNFKK  118

Query  566  MD----IAIKQKMLGEPIGDTLLGKTV  634
            +        +Q  +G P  + L GKT+
Sbjct  119  VQNLYLTDYRQAKMGVPKTE-LEGKTL  144



>ref|WP_012966581.1| 3-phosphoglycerate dehydrogenase [Ferroglobus placidus]
 ref|YP_003436517.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 
10642]
 gb|ADC66242.1| D-3-phosphoglycerate dehydrogenase [Ferroglobus placidus DSM 
10642]
Length=527

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 59/99 (60%), Gaps = 4/99 (4%)
 Frame = +2

Query  293  DIPFENVPAVIKDYDICVVKNL-RLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIK  469
            DI  E +  VIKDYD  +V++  ++  ++I   +++K+I + GVG++ +D+ AAT  GI 
Sbjct  29   DISEEELKEVIKDYDALIVRSKPKVTREIIERGEKLKIIGRAGVGVDNIDVDAATERGII  88

Query  470  VARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQ  586
            V   P    GN  S AE+ + LI+   RK  + D ++K+
Sbjct  89   VVNAPG---GNTISTAELTMGLIISAARKIPQADRSVKE  124



>ref|WP_015590372.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus sulfaticallidus]
 ref|YP_007906766.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus sulfaticallidus 
PM70-1]
 gb|AGK60773.1| D-3-phosphoglycerate dehydrogenase [Archaeoglobus sulfaticallidus 
PM70-1]
Length=526

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E++  VI DYD  +V++  ++ +++I +AK +++I + G G++ +DI  AT  GI V   
Sbjct  33   EDLIKVIPDYDGLIVRSGTKVTAEVIEAAKNLRIIGRAGAGVDNIDIKKATEKGIVVVNA  92

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEP--IGDTLLGKTVFIM  643
            P    GN+ S AE+AI +I  + RK  + D ++K+        IG  L GKT+ ++
Sbjct  93   PG---GNSVSTAELAIAMIFAVARKIPQADRSVKEGKWERKKFIGTELRGKTLGVI  145



>ref|XP_007783912.1| D-3-phosphoglycerate dehydrogenase [Coniosporium apollinis CBS 
100218]
 gb|EON68595.1| D-3-phosphoglycerate dehydrogenase [Coniosporium apollinis CBS 
100218]
Length=599

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 67/116 (58%), Gaps = 6/116 (5%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E +  +I DYD  +V++  ++++ L+++AKR+K++ + GVG++ VD+  AT +GI V   
Sbjct  46   EQLLEIIPDYDALIVRSETKVSAQLLNAAKRLKVVARAGVGVDNVDVETATKNGIVVVNS  105

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEP--IGDTLLGKTVFIM  643
            PS   GN  + AE  I L++ + R   E   +IK         +G  L GKT+ I+
Sbjct  106  PS---GNINAAAEHTIALMMAVARNVSEASASIKAGKWERSRLVGVELKGKTLAIV  158



>ref|XP_005963039.1| PREDICTED: d-3-phosphoglycerate dehydrogenase, chloroplastic-like 
[Pantholops hodgsonii]
Length=523

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 6/127 (5%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD-ICVVKNLRLNSDLIS  382
            RVL      PA+ +  +   +G  F     +  + + AVI DYD I +    +L+ D+I+
Sbjct  5    RVLIADKLSPAAVDIFKN--RGVDFDIKTGLTKDELIAVIGDYDGIAIRSGAKLDKDVIA  62

Query  383  SAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXH  562
            +A R+++I + G+G++ VDI AATA G+ V   P    GN+ + AE AI ++  L R+  
Sbjct  63   AAHRLRVIARAGIGVDNVDIPAATAKGVVVMNTP---FGNSITTAEHAIAMMFALARQIP  119

Query  563  EMDIAIK  583
              D++ +
Sbjct  120  AADVSTQ  126



>ref|WP_020613473.1| phosphoglycerate dehydrogenase [Spirochaeta bajacaliforniensis]
Length=319

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 67/121 (55%), Gaps = 8/121 (7%)
 Frame = +2

Query  293  DIP---FENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHG  463
            D+P   FE +  ++ D D  ++   R + ++ + A R+K I +FGVG++ +D++AA   G
Sbjct  35   DMPYYSFEQLRPLVADIDAAIIGMDRWDEEIFALAPRLKAIARFGVGIDNIDLSAARQRG  94

Query  464  IKVARIPSGATG-NATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVFI  640
            IKV    + A G NA + AE+A+  I  + R    ++  + + +    +G  L GKTV +
Sbjct  95   IKV----TNALGMNANAVAELAVGYIFDMARNTIRLNADLSKGVWSRAVGHDLKGKTVGL  150

Query  641  M  643
            +
Sbjct  151  L  151



>ref|WP_006514041.1| D-3-phosphoglycerate dehydrogenase [Leptolyngbya sp. PCC 7375]
 gb|EKU99600.1| D-3-phosphoglycerate dehydrogenase [Leptolyngbya sp. PCC 7375]
Length=526

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = +2

Query  284  QVD---DIPFENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAA  451
            QVD    +P E +  +I +YD  ++++  ++ S++I +A ++K+I + GVG++ +D+AAA
Sbjct  23   QVDVKTKLPPEELVQIISNYDALMIRSGTKVTSEVIEAASQLKIIGRAGVGVDNIDVAAA  82

Query  452  TAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQ  586
            T  GI V   P    GN  + AE A+ ++L L R   E D ++K+
Sbjct  83   TRRGIVVVNSPE---GNTIAAAEHALAMMLSLSRNIPEADKSVKE  124



>ref|WP_025654948.1| phosphoglycerate dehydrogenase [Clostridiales bacterium VE202-21]
Length=318

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 60/110 (55%), Gaps = 3/110 (3%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKNLRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIP  484
            E + A++ D D  +      N ++   A R+K++ +FGVG++  D+ AA  HGI V   P
Sbjct  40   EELKAIVGDVDGVIAGVDTWNEEIFQLAPRLKVLARFGVGVDNFDLEAAKKHGITVCNCP  99

Query  485  SGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTV  634
                 N+++ AE A+ L+L LLR+  E++ +I+      P+   +  +TV
Sbjct  100  G---INSSAVAEQAMALMLALLRRVPELNKSIRSGEWTRPMFHEMKSRTV  146



>ref|XP_007716265.1| hypothetical protein COCCADRAFT_29488 [Bipolaris zeicola 26-R-13]
 gb|EUC29427.1| hypothetical protein COCCADRAFT_29488 [Bipolaris zeicola 26-R-13]
Length=594

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 67/116 (58%), Gaps = 6/116 (5%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E + ++I +YD  +V++  ++ +DL+ +AK MK++ + GVG++ VD+  AT HGI V   
Sbjct  41   EELKSIIGEYDALIVRSETKVTADLLKAAKNMKVVARAGVGVDNVDVQTATQHGIIVVNS  100

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIK--QKMLGEPIGDTLLGKTVFIM  643
            PS   GN  + AE  I L++ + R   +   +IK  +   G  +G    GKT+ I+
Sbjct  101  PS---GNINAAAEHTIALLMAVARNVGDASQSIKAGKWERGRLVGVEAKGKTLAIV  153



>ref|WP_044602197.1| 3-phosphoglycerate dehydrogenase [Candidatus Magnetoglobus multicellularis]
 gb|ETR73827.1| D-3-phosphoglycerate dehydrogenase [Candidatus Magnetoglobus 
multicellularis str. Araruama]
Length=526

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 65/112 (58%), Gaps = 7/112 (6%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            + + A+I +YD  V+++  ++  D+I +A R+K+I + G+GL+ VDI AAT  GI V   
Sbjct  34   DELKAIIGNYDALVIRSATKVTKDIIDAADRLKVIGRAGIGLDNVDIPAATQRGIVVMNT  93

Query  482  PSGATGNATSCAEMAIYLILGLLRKXHEMDIAIKQKMLGEPIGDTLLGKTVF  637
            P    GN  + AE AI ++L L R   +  +++K   +G     +L G+ VF
Sbjct  94   P---LGNVVTTAEHAISMMLALTRNIPQGTMSLK---MGRWEKKSLQGREVF  139



>ref|WP_010921048.1| 3-phosphoglycerate dehydrogenase [Caulobacter vibrioides]
 ref|NP_422009.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 ref|YP_002518694.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
 gb|AAK25177.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus CB15]
 gb|ACL96786.1| D-3-phosphoglycerate dehydrogenase [Caulobacter crescentus NA1000]
Length=526

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 6/127 (5%)
 Frame = +2

Query  206  RVLFCGPNFPASHNYTREYVQGYSFIQVDDIPFENVPAVIKDYD-ICVVKNLRLNSDLIS  382
            RVL      PA+    +   +G +F     +  + + AVI DYD I +    +L+ D+I+
Sbjct  5    RVLIADKLSPAAVEIFKN--RGLAFDIKTGLSKDELIAVIGDYDGIAIRSGAKLDKDVIA  62

Query  383  SAKRMKLIMQFGVGLEGVDIAAATAHGIKVARIPSGATGNATSCAEMAIYLILGLLRKXH  562
            +A ++++I + G+G++ VDI AATA GI V   P    GN+ + AE AI ++  L R+  
Sbjct  63   AANKLRVIARAGIGVDNVDIPAATAKGIVVMNTP---FGNSITTAEHAIAMMFALARQIP  119

Query  563  EMDIAIK  583
              D++ +
Sbjct  120  AADVSTQ  126



>ref|WP_020878515.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus multivorans]
 gb|EPR34170.1| D-3-phosphoglycerate dehydrogenase [Desulfococcus multivorans 
DSM 2059]
Length=531

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 4/84 (5%)
 Frame = +2

Query  305  ENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAAATAHGIKVARI  481
            E + ++I DYD  V+++  ++  DL+ +A R+K++ + G+GL+ VDIAAA+  G+ V   
Sbjct  34   EELKSIIGDYDALVIRSATKVTEDLLQTAGRLKVVGRAGIGLDNVDIAAASKRGVVVMNT  93

Query  482  PSGATGNATSCAEMAIYLILGLLR  553
            P   TGN  + AE AI ++L L R
Sbjct  94   P---TGNVVTTAEHAIAMMLALSR  114



>ref|WP_014026236.1| 3-phosphoglycerate dehydrogenase [Pyrolobus fumarii]
 ref|YP_004780811.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Pyrolobus fumarii 1A]
 gb|AEM38559.1| D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding protein 
[Pyrolobus fumarii 1A]
Length=343

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = +2

Query  281  IQVD---DIPFENVPAVIKDYDICVVKN-LRLNSDLISSAKRMKLIMQFGVGLEGVDIAA  448
            +QVD    +P E +  +I DYDI VV++  +++ ++I   +++K+I + GVGL+ +D+  
Sbjct  57   LQVDYRPGVPREELLKIIGDYDILVVRSRTKVDREVIDRGEKLKVIARAGVGLDNIDVQH  116

Query  449  ATAHGIKVARIPSGATGNATSCAEMAIYLILGLLR--KXHEMDIAIKQKMLGEPIGDTLL  622
            A   GIKV   P  A   A S AE+ I L++   R  K H + +  ++   G   G  L 
Sbjct  117  AIEKGIKVVNAPGAA---AQSVAELTIGLLIAAARFFKAHIVSLERREWSKGRWTGVELS  173

Query  623  GKTVFIM  643
            GKT+ ++
Sbjct  174  GKTLGVI  180



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 960833956375