BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF043E19

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS67652.1|  hypothetical protein M569_07122                         193   9e-56   Genlisea aurea
emb|CDP04854.1|  unnamed protein product                                192   3e-55   Coffea canephora [robusta coffee]
ref|XP_004240685.1|  PREDICTED: aspartic proteinase Asp1                192   8e-55   
gb|EYU20602.1|  hypothetical protein MIMGU_mgv1a007047mg                191   9e-55   Erythranthe guttata [common monkey flower]
ref|XP_009631909.1|  PREDICTED: aspartic proteinase Asp1                191   1e-54   Nicotiana tomentosiformis
ref|XP_011099684.1|  PREDICTED: aspartic proteinase Asp1                191   2e-54   Sesamum indicum [beniseed]
ref|XP_006346815.1|  PREDICTED: aspartic proteinase Asp1-like           189   1e-53   Solanum tuberosum [potatoes]
ref|XP_002273988.1|  PREDICTED: aspartic proteinase Asp1                187   4e-53   Vitis vinifera
ref|XP_009766881.1|  PREDICTED: aspartic proteinase Asp1                186   1e-52   Nicotiana sylvestris
ref|XP_007048531.1|  Aspartyl protease family protein isoform 2         181   2e-51   
dbj|BAD80835.1|  nucellin-like protein                                  182   3e-51   Daucus carota [carrots]
ref|XP_007048530.1|  Eukaryotic aspartyl protease family protein ...    182   4e-51   
ref|XP_010025734.1|  PREDICTED: aspartic proteinase Asp1-like           182   5e-51   Eucalyptus grandis [rose gum]
gb|KHG06665.1|  Asparticase Asp1                                        179   2e-50   Gossypium arboreum [tree cotton]
gb|KJB40494.1|  hypothetical protein B456_007G066800                    180   3e-50   Gossypium raimondii
ref|XP_008227592.1|  PREDICTED: aspartic proteinase Asp1                179   4e-50   Prunus mume [ume]
ref|XP_002310541.2|  hypothetical protein POPTR_0007s04800g             177   2e-49   
ref|XP_011468243.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     176   3e-49   Fragaria vesca subsp. vesca
ref|XP_007211687.1|  hypothetical protein PRUPE_ppa005961mg             177   4e-49   Prunus persica
ref|XP_011468246.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     176   6e-49   Fragaria vesca subsp. vesca
emb|CAN73001.1|  hypothetical protein VITISV_037997                     176   7e-49   Vitis vinifera
ref|XP_006412352.1|  hypothetical protein EUTSA_v10025289mg             174   3e-48   Eutrema salsugineum [saltwater cress]
ref|XP_010674354.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     173   4e-48   
ref|XP_010674353.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     173   7e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008361087.1|  PREDICTED: aspartic proteinase Asp1-like           172   2e-47   
ref|XP_004163385.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    172   3e-47   
ref|XP_004147327.1|  PREDICTED: aspartic proteinase Asp1-like           171   3e-47   
ref|XP_009355861.1|  PREDICTED: aspartic proteinase Asp1-like           171   3e-47   Pyrus x bretschneideri [bai li]
ref|XP_008460823.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     171   3e-47   Cucumis melo [Oriental melon]
ref|XP_008460822.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     171   4e-47   Cucumis melo [Oriental melon]
ref|XP_010527074.1|  PREDICTED: aspartic proteinase Asp1-like           171   7e-47   Tarenaya hassleriana [spider flower]
ref|XP_002307058.2|  nucellin family protein                            170   8e-47   
ref|XP_006382886.1|  hypothetical protein POPTR_0005s07070g             170   8e-47   
gb|ABK95151.1|  unknown                                                 170   8e-47   Populus trichocarpa [western balsam poplar]
ref|XP_009350136.1|  PREDICTED: aspartic proteinase Asp1-like           171   9e-47   Pyrus x bretschneideri [bai li]
ref|XP_010111255.1|  Aspartic proteinase Asp1                           171   9e-47   Morus notabilis
ref|XP_010437756.1|  PREDICTED: aspartic proteinase Asp1-like           169   3e-46   Camelina sativa [gold-of-pleasure]
gb|KDP24798.1|  hypothetical protein JCGZ_25323                         169   3e-46   Jatropha curcas
gb|KEH20923.1|  eukaryotic aspartyl protease family protein             164   1e-45   Medicago truncatula
ref|NP_567922.2|  aspartyl protease family protein                      167   1e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CAB38807.1|  nucellin-like protein                                  167   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190905.1|  aspartyl protease family protein                   167   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006282959.1|  hypothetical protein CARUB_v10007649mg             167   2e-45   Capsella rubella
ref|XP_002867175.1|  hypothetical protein ARALYDRAFT_328390             167   2e-45   Arabidopsis lyrata subsp. lyrata
dbj|BAC43357.1|  putative nucellin                                      166   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022861.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    167   2e-45   Populus euphratica
ref|XP_010432554.1|  PREDICTED: aspartic proteinase Asp1-like           167   2e-45   Camelina sativa [gold-of-pleasure]
gb|KFK29973.1|  hypothetical protein AALP_AA7G201200                    166   3e-45   Arabis alpina [alpine rockcress]
gb|KDO52221.1|  hypothetical protein CISIN_1g013774mg                   166   5e-45   Citrus sinensis [apfelsine]
ref|XP_006464925.1|  PREDICTED: aspartic proteinase Asp1-like           166   6e-45   Citrus sinensis [apfelsine]
emb|CDX68982.1|  BnaC01g04710D                                          166   7e-45   
gb|KDO52227.1|  hypothetical protein CISIN_1g015972mg                   161   7e-45   Citrus sinensis [apfelsine]
ref|XP_006432088.1|  hypothetical protein CICLE_v10001122mg             166   7e-45   
ref|XP_009121783.1|  PREDICTED: aspartic proteinase Asp1                165   9e-45   Brassica rapa
emb|CDX75359.1|  BnaA01g03430D                                          165   9e-45   
gb|KDO52226.1|  hypothetical protein CISIN_1g015972mg                   162   1e-44   Citrus sinensis [apfelsine]
ref|XP_011031099.1|  PREDICTED: aspartic proteinase Asp1-like           165   1e-44   Populus euphratica
gb|KEH20924.1|  eukaryotic aspartyl protease family protein             164   1e-44   Medicago truncatula
ref|XP_003630348.1|  Aspartic proteinase Asp1                           164   2e-44   Medicago truncatula
ref|XP_010447234.1|  PREDICTED: aspartic proteinase Asp1-like           164   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002522918.1|  nucellin, putative                                 164   2e-44   Ricinus communis
gb|KDO52229.1|  hypothetical protein CISIN_1g015972mg                   163   3e-44   Citrus sinensis [apfelsine]
ref|XP_004503902.1|  PREDICTED: aspartic proteinase Asp1-like           164   3e-44   Cicer arietinum [garbanzo]
gb|KDO52225.1|  hypothetical protein CISIN_1g015972mg                   162   4e-44   Citrus sinensis [apfelsine]
ref|XP_003532363.2|  PREDICTED: aspartic proteinase Asp1-like           163   5e-44   Glycine max [soybeans]
ref|XP_010547875.1|  PREDICTED: aspartic proteinase Asp1                163   6e-44   Tarenaya hassleriana [spider flower]
ref|XP_010268980.1|  PREDICTED: aspartic proteinase Asp1-like           163   8e-44   Nelumbo nucifera [Indian lotus]
ref|XP_007159874.1|  hypothetical protein PHAVU_002G275100g             162   1e-43   Phaseolus vulgaris [French bean]
ref|XP_006380399.1|  nucellin family protein                            160   2e-43   
ref|XP_010025731.1|  PREDICTED: aspartic proteinase Asp1-like           162   2e-43   
ref|XP_006432093.1|  hypothetical protein CICLE_v10001115mg             159   2e-42   
ref|XP_003602685.1|  Aspartic proteinase Asp1                           159   2e-42   
ref|XP_006432092.1|  hypothetical protein CICLE_v10001115mg             159   2e-42   
gb|AES72936.2|  eukaryotic aspartyl protease family protein             159   2e-42   Medicago truncatula
ref|XP_006464928.1|  PREDICTED: aspartic proteinase Asp1-like iso...    159   2e-42   
ref|XP_003524315.1|  PREDICTED: aspartic proteinase Asp1-like           158   3e-42   Glycine max [soybeans]
ref|XP_003522473.1|  PREDICTED: aspartic proteinase Asp1-like           158   3e-42   Glycine max [soybeans]
ref|XP_006464927.1|  PREDICTED: aspartic proteinase Asp1-like iso...    159   3e-42   
ref|XP_004502990.1|  PREDICTED: aspartic proteinase Asp1-like           157   8e-42   Cicer arietinum [garbanzo]
ref|XP_011074835.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     155   2e-41   
ref|XP_011074834.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     155   3e-41   
ref|XP_003528065.1|  PREDICTED: aspartic proteinase Asp1-like           155   6e-41   Glycine max [soybeans]
ref|XP_007137749.1|  hypothetical protein PHAVU_009G152700g             155   8e-41   Phaseolus vulgaris [French bean]
gb|EEE52860.1|  hypothetical protein OsJ_35411                          154   1e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009355862.1|  PREDICTED: aspartic proteinase Asp1-like           154   1e-40   Pyrus x bretschneideri [bai li]
ref|NP_001066301.1|  Os12g0177500                                       154   1e-40   
gb|EEC68949.1|  hypothetical protein OsI_37668                          154   1e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_009611015.1|  PREDICTED: aspartic proteinase Asp1                154   1e-40   Nicotiana tomentosiformis
ref|XP_009802241.1|  PREDICTED: aspartic proteinase Asp1                153   2e-40   Nicotiana sylvestris
ref|XP_010243511.1|  PREDICTED: aspartic proteinase Asp1                153   3e-40   Nelumbo nucifera [Indian lotus]
emb|CDP10935.1|  unnamed protein product                                152   3e-40   Coffea canephora [robusta coffee]
gb|ABA96612.2|  Eukaryotic aspartyl protease family protein, expr...    153   4e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977227.1|  PREDICTED: aspartic proteinase Asp1-like iso...    152   5e-40   
gb|EYU31770.1|  hypothetical protein MIMGU_mgv1a006482mg                152   7e-40   Erythranthe guttata [common monkey flower]
ref|XP_010930726.1|  PREDICTED: aspartic proteinase Asp1-like           152   9e-40   
ref|XP_009420564.1|  PREDICTED: aspartic proteinase Asp1-like           152   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU31771.1|  hypothetical protein MIMGU_mgv1a006482mg                151   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_009393816.1|  PREDICTED: aspartic proteinase Asp1-like           151   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004977226.1|  PREDICTED: aspartic proteinase Asp1-like iso...    151   2e-39   Setaria italica
ref|XP_011069472.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     150   3e-39   
ref|XP_011069464.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     150   5e-39   Sesamum indicum [beniseed]
ref|XP_002441914.1|  hypothetical protein SORBIDRAFT_08g004800          148   2e-38   
ref|XP_010238658.1|  PREDICTED: aspartic proteinase Asp1-like           148   3e-38   Brachypodium distachyon [annual false brome]
ref|XP_010664194.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     147   5e-38   Vitis vinifera
emb|CBI18999.3|  unnamed protein product                                146   5e-38   Vitis vinifera
ref|XP_002285867.2|  PREDICTED: aspartic proteinase Asp1 isoform X1     147   7e-38   Vitis vinifera
ref|XP_009596730.1|  PREDICTED: aspartic proteinase Asp1-like           145   2e-37   Nicotiana tomentosiformis
ref|XP_006365534.1|  PREDICTED: aspartic proteinase Asp1-like           144   4e-37   Solanum tuberosum [potatoes]
ref|XP_009758779.1|  PREDICTED: aspartic proteinase Asp1-like           144   9e-37   Nicotiana sylvestris
ref|NP_001152116.1|  aspartic proteinase Asp1 precursor                 143   1e-36   
ref|XP_009404862.1|  PREDICTED: aspartic proteinase Asp1-like           144   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW56223.1|  hypothetical protein ZEAMMB73_420944                    142   1e-36   
gb|EPS72688.1|  hypothetical protein M569_02067                         142   2e-36   Genlisea aurea
ref|XP_008460824.1|  PREDICTED: aspartic proteinase Asp1 isoform X3     142   2e-36   Cucumis melo [Oriental melon]
ref|XP_004242040.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     143   2e-36   Solanum lycopersicum
gb|KGN62238.1|  hypothetical protein Csa_2G338820                       142   2e-36   Cucumis sativus [cucumbers]
ref|NP_001131929.1|  uncharacterized protein LOC100193320 precursor     142   2e-36   
gb|ACR34528.1|  unknown                                                 142   2e-36   Zea mays [maize]
gb|ACR35418.1|  unknown                                                 137   4e-36   Zea mays [maize]
ref|XP_008661408.1|  PREDICTED: uncharacterized protein LOC100193...    142   6e-36   Zea mays [maize]
ref|XP_002449121.1|  hypothetical protein SORBIDRAFT_05g005400          139   1e-35   
ref|XP_008781591.1|  PREDICTED: aspartic proteinase Asp1-like           140   2e-35   Phoenix dactylifera
ref|XP_004240544.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     140   2e-35   Solanum lycopersicum
ref|XP_004240543.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     139   3e-35   
ref|XP_008669793.1|  PREDICTED: aspartic proteinase Asp1                139   3e-35   
gb|ACG42043.1|  aspartic proteinase Asp1 precursor                      139   3e-35   Zea mays [maize]
ref|XP_002520345.1|  nucellin, putative                                 139   4e-35   
ref|XP_006355804.1|  PREDICTED: aspartic proteinase Asp1-like iso...    138   9e-35   Solanum tuberosum [potatoes]
ref|XP_010025733.1|  PREDICTED: aspartic proteinase Asp1-like           137   1e-34   Eucalyptus grandis [rose gum]
ref|XP_010063407.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     137   3e-34   Eucalyptus grandis [rose gum]
ref|XP_010063406.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     136   4e-34   Eucalyptus grandis [rose gum]
ref|XP_010930728.1|  PREDICTED: aspartic proteinase Asp1-like           136   5e-34   Elaeis guineensis
ref|XP_011458802.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     136   5e-34   Fragaria vesca subsp. vesca
ref|XP_004290889.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     135   7e-34   Fragaria vesca subsp. vesca
gb|ACN34727.1|  unknown                                                 136   7e-34   Zea mays [maize]
dbj|BAJ86250.1|  predicted protein                                      136   9e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001048015.1|  Os02g0730700                                       135   1e-33   
gb|EEC73939.1|  hypothetical protein OsI_08807                          135   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_002452609.1|  hypothetical protein SORBIDRAFT_04g028990          135   1e-33   Sorghum bicolor [broomcorn]
ref|XP_011022860.1|  PREDICTED: aspartic proteinase Asp1-like           135   2e-33   Populus euphratica
gb|EMT28382.1|  Aspartic proteinase Asp1                                134   3e-33   
gb|EMT17344.1|  Aspartic proteinase Asp1                                128   5e-33   
gb|EEC67807.1|  hypothetical protein OsI_35373                          133   6e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_004953813.1|  PREDICTED: aspartic proteinase Asp1-like           133   6e-33   
ref|XP_010025732.1|  PREDICTED: aspartic proteinase Asp1-like           133   7e-33   Eucalyptus grandis [rose gum]
ref|XP_010680865.1|  PREDICTED: aspartic proteinase Asp1-like           133   8e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006856698.1|  hypothetical protein AMTR_s00054p00157640          132   9e-33   
gb|KDP32842.1|  hypothetical protein JCGZ_12134                         133   1e-32   Jatropha curcas
ref|NP_001065913.1|  Os11g0183900                                       132   1e-32   
ref|XP_010095410.1|  Aspartic proteinase Asp1                           132   1e-32   
ref|XP_006663866.1|  PREDICTED: aspartic proteinase Asp1-like           131   1e-32   
ref|NP_001146721.1|  uncharacterized protein LOC100280323               133   1e-32   Zea mays [maize]
gb|KDO37005.1|  hypothetical protein CISIN_1g019849mg                   130   2e-32   Citrus sinensis [apfelsine]
ref|XP_010027413.1|  PREDICTED: aspartic proteinase Asp1-like           132   2e-32   
ref|XP_003570503.1|  PREDICTED: aspartic proteinase Asp1-like           132   2e-32   Brachypodium distachyon [annual false brome]
ref|XP_003577760.1|  PREDICTED: aspartic proteinase Asp1-like           131   3e-32   Brachypodium distachyon [annual false brome]
ref|XP_006472808.1|  PREDICTED: aspartic proteinase Asp1-like iso...    131   3e-32   Citrus sinensis [apfelsine]
ref|XP_006434233.1|  hypothetical protein CICLE_v10003265mg             131   4e-32   Citrus clementina [clementine]
ref|XP_006472807.1|  PREDICTED: aspartic proteinase Asp1-like iso...    131   4e-32   Citrus sinensis [apfelsine]
ref|XP_006662787.1|  PREDICTED: aspartic proteinase Asp1-like           130   5e-32   Oryza brachyantha
emb|CDO98445.1|  unnamed protein product                                131   6e-32   Coffea canephora [robusta coffee]
ref|XP_004977228.1|  PREDICTED: aspartic proteinase Asp1-like iso...    129   9e-32   
ref|XP_004978884.1|  PREDICTED: aspartic proteinase Asp1-like           129   1e-31   Setaria italica
ref|XP_006826817.1|  hypothetical protein AMTR_s00010p00056950          130   1e-31   Amborella trichopoda
ref|XP_010265187.1|  PREDICTED: aspartic proteinase Asp1 isoform X3     130   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010265186.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     130   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010265185.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     130   1e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006656867.1|  PREDICTED: aspartic proteinase Asp1-like           129   2e-31   
emb|CBI15437.3|  unnamed protein product                                129   2e-31   Vitis vinifera
ref|XP_002511959.1|  protein with unknown function                      129   3e-31   Ricinus communis
ref|XP_004502513.1|  PREDICTED: aspartic proteinase Asp1-like           128   3e-31   Cicer arietinum [garbanzo]
ref|XP_004498348.1|  PREDICTED: aspartic proteinase Asp1-like           128   3e-31   Cicer arietinum [garbanzo]
gb|KEH40514.1|  eukaryotic aspartyl protease family protein             128   3e-31   Medicago truncatula
ref|XP_010663584.1|  PREDICTED: aspartic proteinase Asp1                129   4e-31   Vitis vinifera
gb|KEH40515.1|  eukaryotic aspartyl protease family protein             128   5e-31   Medicago truncatula
ref|XP_004171754.1|  PREDICTED: aspartic proteinase Asp1-like           127   5e-31   
ref|XP_004149806.1|  PREDICTED: aspartic proteinase Asp1-like           127   6e-31   Cucumis sativus [cucumbers]
ref|XP_004502512.1|  PREDICTED: aspartic proteinase Asp1-like           127   1e-30   Cicer arietinum [garbanzo]
ref|XP_011003438.1|  PREDICTED: aspartic proteinase Asp1-like           125   2e-30   Populus euphratica
ref|XP_007223384.1|  hypothetical protein PRUPE_ppa005622mg             125   3e-30   Prunus persica
ref|XP_007223385.1|  hypothetical protein PRUPE_ppa005622mg             125   3e-30   Prunus persica
ref|XP_007036501.1|  Eukaryotic aspartyl protease family protein,...    125   5e-30   
ref|XP_006662788.1|  PREDICTED: aspartic proteinase Asp1-like           124   6e-30   Oryza brachyantha
ref|XP_009406648.1|  PREDICTED: aspartic proteinase Asp1                125   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010322933.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     125   6e-30   Solanum lycopersicum
gb|KDO41979.1|  hypothetical protein CISIN_1g008104mg                   125   6e-30   Citrus sinensis [apfelsine]
ref|XP_010094778.1|  Aspartic proteinase Asp1                           125   8e-30   
gb|EAZ00454.1|  hypothetical protein OsI_22475                          125   9e-30   Oryza sativa Indica Group [Indian rice]
ref|XP_002306645.2|  hypothetical protein POPTR_0005s20210g             124   9e-30   
ref|NP_001057353.1|  Os06g0268700                                       125   9e-30   
gb|KDO41978.1|  hypothetical protein CISIN_1g008104mg                   125   9e-30   Citrus sinensis [apfelsine]
ref|XP_007036500.1|  Eukaryotic aspartyl protease family protein,...    125   1e-29   
gb|KHN20145.1|  Aspartic proteinase Asp1                                124   1e-29   Glycine soja [wild soybean]
ref|XP_008219614.1|  PREDICTED: aspartic proteinase Asp1-like iso...    124   1e-29   Prunus mume [ume]
ref|XP_006596210.1|  PREDICTED: aspartic proteinase Asp1-like iso...    124   1e-29   Glycine max [soybeans]
ref|XP_008813298.1|  PREDICTED: aspartic proteinase Asp1                124   1e-29   Phoenix dactylifera
ref|XP_006393742.1|  hypothetical protein EUTSA_v10011529mg             124   1e-29   Eutrema salsugineum [saltwater cress]
ref|XP_008466731.1|  PREDICTED: aspartic proteinase Asp1-like           124   1e-29   Cucumis melo [Oriental melon]
ref|XP_008219613.1|  PREDICTED: aspartic proteinase Asp1-like iso...    124   1e-29   Prunus mume [ume]
ref|XP_006440945.1|  hypothetical protein CICLE_v10019473mg             124   2e-29   Citrus clementina [clementine]
ref|XP_006355850.1|  PREDICTED: aspartic proteinase Asp1-like           123   2e-29   
gb|KDO41977.1|  hypothetical protein CISIN_1g008104mg                   124   2e-29   Citrus sinensis [apfelsine]
dbj|BAJ99780.1|  predicted protein                                      123   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB39311.1|  hypothetical protein B456_007G006200                    123   2e-29   Gossypium raimondii
ref|XP_007161478.1|  hypothetical protein PHAVU_001G072500g             123   2e-29   Phaseolus vulgaris [French bean]
ref|XP_008444185.1|  PREDICTED: aspartic proteinase Asp1-like           123   2e-29   Cucumis melo [Oriental melon]
ref|XP_004142705.1|  PREDICTED: aspartic proteinase Asp1-like           123   2e-29   Cucumis sativus [cucumbers]
ref|XP_003523437.1|  PREDICTED: aspartic proteinase Asp1-like           123   3e-29   
ref|XP_001766321.1|  predicted protein                                  122   3e-29   
ref|XP_011027498.1|  PREDICTED: aspartic proteinase Asp1-like iso...    122   3e-29   Populus euphratica
ref|XP_011027497.1|  PREDICTED: aspartic proteinase Asp1-like iso...    122   3e-29   Populus euphratica
ref|XP_003526637.1|  PREDICTED: aspartic proteinase Asp1-like           122   4e-29   Glycine max [soybeans]
gb|AAM76716.1|  nucellin-like aspartic protease                         121   4e-29   Zea mays [maize]
ref|XP_006485774.1|  PREDICTED: aspartic proteinase Asp1-like           123   5e-29   Citrus sinensis [apfelsine]
ref|XP_011027496.1|  PREDICTED: aspartic proteinase Asp1-like iso...    122   5e-29   Populus euphratica
gb|KJB39308.1|  hypothetical protein B456_007G006200                    122   5e-29   Gossypium raimondii
gb|KHG03472.1|  Asparticase Asp1                                        123   5e-29   Gossypium arboreum [tree cotton]
ref|XP_011027495.1|  PREDICTED: aspartic proteinase Asp1-like iso...    122   5e-29   Populus euphratica
gb|KJB39310.1|  hypothetical protein B456_007G006200                    122   5e-29   Gossypium raimondii
gb|EMT29613.1|  Aspartic proteinase Asp1                                122   5e-29   
ref|XP_010908260.1|  PREDICTED: aspartic proteinase Asp1                122   8e-29   Elaeis guineensis
gb|KJB39307.1|  hypothetical protein B456_007G006200                    122   8e-29   Gossypium raimondii
gb|KJB39309.1|  hypothetical protein B456_007G006200                    122   8e-29   Gossypium raimondii
gb|KCW48539.1|  hypothetical protein EUGRSUZ_K02213                     122   8e-29   Eucalyptus grandis [rose gum]
ref|XP_010036874.1|  PREDICTED: aspartic proteinase Asp1                122   1e-28   Eucalyptus grandis [rose gum]
ref|XP_008457584.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     122   2e-28   Cucumis melo [Oriental melon]
ref|XP_004137470.1|  PREDICTED: aspartic proteinase Asp1-like           122   2e-28   Cucumis sativus [cucumbers]
ref|XP_001783556.1|  predicted protein                                  120   2e-28   
gb|KDP20103.1|  hypothetical protein JCGZ_05872                         121   2e-28   Jatropha curcas
gb|KHN47012.1|  Aspartic proteinase Asp1                                120   2e-28   Glycine soja [wild soybean]
gb|KHN20610.1|  Aspartic proteinase Asp1                                120   2e-28   Glycine soja [wild soybean]
ref|XP_007019120.1|  Eukaryotic aspartyl protease family protein ...    120   2e-28   
ref|XP_008457519.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     122   2e-28   Cucumis melo [Oriental melon]
ref|XP_007019119.1|  Eukaryotic aspartyl protease family protein ...    120   3e-28   Theobroma cacao [chocolate]
ref|XP_011097005.1|  PREDICTED: aspartic proteinase Asp1                121   3e-28   Sesamum indicum [beniseed]
ref|XP_003523438.1|  PREDICTED: aspartic proteinase Asp1-like           120   3e-28   
gb|KHN32026.1|  Aspartic proteinase Asp1                                121   3e-28   Glycine soja [wild soybean]
ref|XP_006303534.1|  hypothetical protein CARUB_v10010968mg             120   3e-28   Capsella rubella
ref|XP_007152781.1|  hypothetical protein PHAVU_004G159200g             121   3e-28   Phaseolus vulgaris [French bean]
emb|CDY10133.1|  BnaC05g03760D                                          120   3e-28   Brassica napus [oilseed rape]
ref|XP_001782061.1|  predicted protein                                  120   3e-28   
ref|XP_006355805.1|  PREDICTED: aspartic proteinase Asp1-like iso...    119   3e-28   Solanum tuberosum [potatoes]
gb|EMS62785.1|  Aspartic proteinase Asp1                                119   4e-28   Triticum urartu
ref|XP_006588295.1|  PREDICTED: lysine-specific histone demethyla...    123   4e-28   
ref|XP_007152782.1|  hypothetical protein PHAVU_004G159200g             120   4e-28   Phaseolus vulgaris [French bean]
gb|ABR18371.1|  unknown                                                 119   5e-28   Picea sitchensis
ref|XP_007137426.1|  hypothetical protein PHAVU_009G126200g             119   5e-28   Phaseolus vulgaris [French bean]
ref|XP_010532199.1|  PREDICTED: aspartic proteinase Asp1                118   1e-27   Tarenaya hassleriana [spider flower]
ref|XP_002302227.1|  nucellin family protein                            118   1e-27   Populus trichocarpa [western balsam poplar]
ref|XP_003563970.2|  PREDICTED: aspartic proteinase Asp1-like           119   1e-27   
ref|XP_006386369.1|  hypothetical protein POPTR_0002s08190g             118   1e-27   Populus trichocarpa [western balsam poplar]
ref|NP_001065918.1|  Os11g0184800                                       117   2e-27   
ref|XP_010479040.1|  PREDICTED: aspartic proteinase Asp1                117   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_002893981.1|  hypothetical protein ARALYDRAFT_314121             117   2e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_006354730.1|  PREDICTED: aspartic proteinase Asp1-like           118   3e-27   Solanum tuberosum [potatoes]
ref|XP_009776622.1|  PREDICTED: aspartic proteinase Asp1                117   5e-27   Nicotiana sylvestris
ref|NP_175079.1|  aspartyl protease family protein                      116   5e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007019123.1|  Eukaryotic aspartyl protease family protein,...    116   6e-27   
emb|CDY14973.1|  BnaA10g08830D                                          116   6e-27   Brassica napus [oilseed rape]
ref|XP_006434231.1|  hypothetical protein CICLE_v10001860mg             115   6e-27   
ref|XP_009123049.1|  PREDICTED: aspartic proteinase Asp1                116   7e-27   Brassica rapa
gb|KHN20716.1|  Aspartic proteinase Asp1                                117   7e-27   Glycine soja [wild soybean]
ref|XP_006583400.1|  PREDICTED: aspartic proteinase Asp1-like           117   1e-26   Glycine max [soybeans]
gb|KEH27053.1|  eukaryotic aspartyl protease family protein             115   1e-26   Medicago truncatula
gb|KDO80579.1|  hypothetical protein CISIN_1g014185mg                   115   1e-26   Citrus sinensis [apfelsine]
ref|XP_004241624.1|  PREDICTED: aspartic proteinase Asp1                116   1e-26   
ref|XP_002888605.1|  hypothetical protein ARALYDRAFT_475850             114   2e-26   Arabidopsis lyrata subsp. lyrata
gb|KEH27052.1|  eukaryotic aspartyl protease family protein             116   2e-26   Medicago truncatula
sp|A2ZC67.2|ASP1_ORYSI  RecName: Full=Aspartic proteinase Asp1; S...    114   3e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_006472803.1|  PREDICTED: aspartic proteinase Asp1-like iso...    114   4e-26   Citrus sinensis [apfelsine]
gb|KFK42141.1|  hypothetical protein AALP_AA2G216700                    114   5e-26   Arabis alpina [alpine rockcress]
gb|EMS63812.1|  Aspartic proteinase Asp1                                114   5e-26   Triticum urartu
ref|XP_002449122.1|  hypothetical protein SORBIDRAFT_05g005410          113   5e-26   
ref|XP_011012697.1|  PREDICTED: aspartic proteinase Asp1                115   5e-26   Populus euphratica
ref|XP_004142630.1|  PREDICTED: aspartic proteinase Asp1-like           112   1e-25   Cucumis sativus [cucumbers]
ref|XP_004512995.1|  PREDICTED: lysine-specific histone demethyla...    116   1e-25   
gb|EMT12274.1|  Aspartic proteinase Asp1                                112   1e-25   
gb|AFW86305.1|  hypothetical protein ZEAMMB73_151223                    112   1e-25   
ref|XP_006302228.1|  hypothetical protein CARUB_v10020249mg             112   2e-25   Capsella rubella
gb|AAK81699.1|  aspartyl proteinase                                     112   2e-25   
gb|KJB29186.1|  hypothetical protein B456_005G088900                    111   2e-25   
gb|AAK81698.1|  aspartyl proteinase                                     112   2e-25   
gb|KJB29182.1|  hypothetical protein B456_005G088900                    112   2e-25   
gb|KJB29181.1|  hypothetical protein B456_005G088900                    112   2e-25   
ref|XP_008444184.1|  PREDICTED: aspartic proteinase Asp1-like           111   3e-25   
gb|KJB29188.1|  hypothetical protein B456_005G088900                    111   3e-25   
gb|KHG10362.1|  Asparticase Asp1                                        112   3e-25   
gb|KJB29187.1|  hypothetical protein B456_005G088900                    111   3e-25   
ref|XP_008658519.1|  PREDICTED: uncharacterized protein LOC100280...    112   3e-25   
dbj|BAJ98705.1|  predicted protein                                      112   3e-25   
ref|XP_009621932.1|  PREDICTED: aspartic proteinase Asp1                112   4e-25   
gb|EMT31650.1|  Aspartic proteinase Asp1                                111   5e-25   
gb|EMS52520.1|  Aspartic proteinase Asp1                                110   5e-25   
ref|XP_002889144.1|  hypothetical protein ARALYDRAFT_476912             111   5e-25   
ref|XP_006393315.1|  hypothetical protein EUTSA_v10011346mg             112   5e-25   
ref|XP_010416691.1|  PREDICTED: aspartic proteinase Asp1-like           110   7e-25   
ref|NP_177872.3|  aspartyl protease                                     110   7e-25   
ref|XP_010428825.1|  PREDICTED: aspartic proteinase Asp1-like           110   8e-25   
ref|XP_010471942.1|  PREDICTED: aspartic proteinase Asp1-like           110   8e-25   
ref|NP_850981.1|  aspartyl protease                                     110   9e-25   
emb|CDX87518.1|  BnaA07g33550D                                          110   1e-24   
gb|KHG10363.1|  Asparticase Asp1                                        109   1e-24   
ref|XP_010500446.1|  PREDICTED: aspartic proteinase Asp1-like           111   1e-24   
emb|CDY41786.1|  BnaC02g13700D                                          109   1e-24   
ref|XP_002891474.1|  aspartyl protease family protein                   110   1e-24   
ref|XP_010521265.1|  PREDICTED: aspartic proteinase Asp1 isoform X2     109   2e-24   
ref|XP_010521264.1|  PREDICTED: aspartic proteinase Asp1 isoform X1     109   2e-24   
ref|XP_009106403.1|  PREDICTED: aspartic proteinase Asp1                109   2e-24   
gb|KJB29191.1|  hypothetical protein B456_005G089000                    108   2e-24   
gb|KJB29195.1|  hypothetical protein B456_005G089000                    108   2e-24   
ref|XP_006304522.1|  hypothetical protein CARUB_v10011364mg             110   2e-24   
gb|KFK36042.1|  hypothetical protein AALP_AA4G070400                    110   3e-24   
gb|KJB29190.1|  hypothetical protein B456_005G089000                    108   4e-24   
gb|KJB29189.1|  hypothetical protein B456_005G089000                    108   5e-24   
ref|XP_010479334.1|  PREDICTED: aspartic proteinase Asp1-like           109   5e-24   
ref|XP_006390086.1|  hypothetical protein EUTSA_v10018497mg             108   5e-24   
ref|XP_010461710.1|  PREDICTED: aspartic proteinase Asp1-like           109   7e-24   
ref|XP_003605080.1|  Aspartic proteinase Asp1                           107   1e-23   
gb|EEC67810.1|  hypothetical protein OsI_35379                          107   1e-23   
gb|AAG51657.1|AC010704_1  nucellin-like protein; 27671-25467            106   2e-23   
ref|XP_010549131.1|  PREDICTED: aspartic proteinase Asp1                107   3e-23   
ref|XP_004965200.1|  PREDICTED: aspartic proteinase Asp1-like           107   3e-23   
ref|XP_004980239.1|  PREDICTED: aspartic proteinase Asp1-like           105   4e-23   
ref|XP_009144992.1|  PREDICTED: aspartic proteinase Asp1                106   5e-23   
ref|NP_564539.1|  aspartyl protease                                     105   9e-23   
emb|CDY04326.1|  BnaC05g25880D                                          105   1e-22   
ref|XP_006434232.1|  hypothetical protein CICLE_v10001860mg             102   2e-22   
gb|KDO80582.1|  hypothetical protein CISIN_1g014185mg                   102   2e-22   
gb|KDO80580.1|  hypothetical protein CISIN_1g014185mg                   103   2e-22   
ref|XP_007019121.1|  Eukaryotic aspartyl protease family protein        103   2e-22   
emb|CDY60079.1|  BnaA05g36440D                                          104   3e-22   
ref|XP_003605078.1|  Aspartic proteinase Asp1                           102   4e-22   
gb|AES87275.2|  eukaryotic aspartyl protease family protein             102   5e-22   
ref|XP_006472802.1|  PREDICTED: aspartic proteinase Asp1-like iso...    102   7e-22   
emb|CDX88370.1|  BnaC06g38140D                                          100   3e-21   
gb|EMT29612.1|  Aspartic proteinase Asp1                              98.6    1e-20   
gb|EEE51772.1|  hypothetical protein OsJ_33215                        99.4    3e-20   
ref|XP_006374352.1|  aspartyl protease family protein                 98.6    4e-20   
gb|EMT27436.1|  Aspartic proteinase Asp1                              94.7    2e-19   
ref|XP_002449123.1|  hypothetical protein SORBIDRAFT_05g005430        94.4    3e-19   
gb|EMS61228.1|  Aspartic proteinase Asp1                              92.8    1e-18   
gb|EMT27437.1|  Aspartic proteinase Asp1                              91.3    4e-18   
gb|EMS61227.1|  Aspartic proteinase Asp1                              90.1    7e-18   
ref|NP_001077691.1|  aspartyl protease                                90.1    1e-17   
emb|CDY12535.1|  BnaC06g00610D                                        89.7    1e-17   
dbj|BAK05301.1|  predicted protein                                    89.7    1e-17   
gb|AAB96882.1|  nucellin                                              89.7    1e-17   
gb|KDP38263.1|  hypothetical protein JCGZ_05797                       86.7    1e-17   
ref|XP_007203973.1|  hypothetical protein PRUPE_ppa025075mg           89.0    2e-17   
gb|EMT28907.1|  Aspartic proteinase Asp1                              87.8    3e-17   
gb|AAB97155.1|  EEA1                                                  87.8    7e-17   
ref|XP_010912540.1|  PREDICTED: aspartic proteinase Asp1-like         87.4    1e-16   
gb|KHN47013.1|  Aspartic proteinase Asp1                              84.7    1e-16   
gb|EMT01144.1|  Aspartic proteinase Asp1                              86.7    2e-16   
ref|XP_008807681.1|  PREDICTED: aspartic proteinase Asp1-like         83.2    3e-15   
gb|EMT23418.1|  Aspartic proteinase Asp1                              80.1    6e-15   
gb|AJA74410.1|  aspartic protease                                     82.4    8e-15   
gb|AAY23265.1|  Similar to probable aspartic proteinase (EC 3.4.2...  75.5    5e-14   
gb|EAZ04167.1|  hypothetical protein OsI_26309                        78.6    1e-13   
gb|EAZ40114.1|  hypothetical protein OsJ_24557                        78.6    1e-13   
ref|NP_001059857.1|  Os07g0533600                                     78.6    1e-13   
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048            78.6    1e-13   
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504            78.6    2e-13   
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660        76.6    8e-13   
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161            75.1    2e-12   
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  75.5    2e-12   
ref|XP_010673904.1|  PREDICTED: aspartic proteinase-like protein 2    75.5    2e-12   
ref|XP_006367587.1|  PREDICTED: aspartic proteinase-like protein ...  75.1    2e-12   
ref|XP_010909877.1|  PREDICTED: aspartic proteinase-like protein 2    75.1    3e-12   
ref|XP_002983672.1|  hypothetical protein SELMODRAFT_118648           74.3    4e-12   
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  74.3    4e-12   
gb|KCW80152.1|  hypothetical protein EUGRSUZ_C01500                   71.2    4e-12   
ref|XP_002990538.1|  hypothetical protein SELMODRAFT_131679           74.3    4e-12   
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470            73.9    5e-12   
ref|XP_011082275.1|  PREDICTED: aspartic proteinase CDR1-like         73.9    6e-12   
ref|XP_006363880.1|  PREDICTED: uncharacterized protein LOC102587886  74.7    6e-12   
ref|XP_006832952.1|  hypothetical protein AMTR_s00095p00154480        73.2    1e-11   
ref|XP_010912572.1|  PREDICTED: aspartic proteinase Asp1-like         73.2    1e-11   
ref|XP_008777581.1|  PREDICTED: aspartic proteinase-like protein 2    73.2    1e-11   
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  72.8    1e-11   
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  73.2    1e-11   
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg           72.8    2e-11   
emb|CDY51131.1|  BnaA07g37140D                                        72.4    2e-11   
gb|KJB75146.1|  hypothetical protein B456_012G026600                  72.0    2e-11   
gb|KHG26838.1|  hypothetical protein F383_06861                       72.4    2e-11   
gb|KJB75144.1|  hypothetical protein B456_012G026600                  72.4    2e-11   
ref|XP_008460202.1|  PREDICTED: uncharacterized protein LOC103499087  72.8    2e-11   
gb|KJB75145.1|  hypothetical protein B456_012G026600                  72.0    2e-11   
ref|XP_010070332.1|  PREDICTED: aspartic proteinase-like protein ...  72.0    2e-11   
ref|XP_004246049.1|  PREDICTED: aspartic proteinase CDR1-like         72.0    2e-11   
ref|XP_002514831.1|  Aspartic proteinase Asp1 precursor, putative     72.0    3e-11   
ref|XP_004239840.1|  PREDICTED: aspartic proteinase-like protein 2    72.0    3e-11   
ref|XP_010247714.1|  PREDICTED: aspartic proteinase-like protein 2    72.0    3e-11   
ref|XP_010097685.1|  putative aspartic protease                       71.6    3e-11   
emb|CDY24395.1|  BnaCnng04620D                                        71.6    3e-11   
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                  71.6    3e-11   
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.6    3e-11   
ref|XP_008799577.1|  PREDICTED: aspartic proteinase-like protein 2    71.6    4e-11   
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  71.6    4e-11   
ref|XP_010678211.1|  PREDICTED: aspartic proteinase-like protein ...  71.6    4e-11   
ref|XP_010070329.1|  PREDICTED: aspartic proteinase-like protein ...  71.6    4e-11   
ref|XP_010678212.1|  PREDICTED: aspartic proteinase-like protein ...  71.6    4e-11   
ref|XP_010070331.1|  PREDICTED: aspartic proteinase-like protein ...  71.6    4e-11   
ref|XP_010908413.1|  PREDICTED: aspartic proteinase-like protein ...  70.9    5e-11   
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein      71.2    5e-11   
gb|KDP20100.1|  hypothetical protein JCGZ_05869                       71.2    5e-11   
ref|XP_001784204.1|  predicted protein                                70.5    5e-11   
ref|XP_006361599.1|  PREDICTED: uncharacterized protein LOC102600310  71.6    5e-11   
ref|XP_010528649.1|  PREDICTED: aspartic proteinase-like protein 2    70.9    6e-11   
ref|NP_001062010.1|  Os08g0469000                                     70.9    6e-11   
gb|EMS50115.1|  Aspartic proteinase nepenthesin-2                     68.9    6e-11   
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.9    6e-11   
ref|XP_010908412.1|  PREDICTED: aspartic proteinase-like protein ...  70.9    6e-11   
gb|EAZ07296.1|  hypothetical protein OsI_29544                        70.9    7e-11   
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.9    7e-11   
ref|XP_011073923.1|  PREDICTED: aspartic proteinase CDR1-like         70.5    7e-11   
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.9    7e-11   
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.9    8e-11   
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.5    8e-11   
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.5    8e-11   
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  70.5    8e-11   
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg              70.5    9e-11   
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg           70.5    9e-11   
ref|XP_008787830.1|  PREDICTED: aspartic proteinase-like protein 2    70.1    1e-10   
ref|XP_002446566.1|  hypothetical protein SORBIDRAFT_06g018170        70.1    1e-10   
ref|XP_001773681.1|  predicted protein                                70.1    1e-10   
ref|XP_002325477.2|  hypothetical protein POPTR_0019s08250g           70.1    1e-10   
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g           70.1    1e-10   
ref|XP_009392636.1|  PREDICTED: aspartic proteinase-like protein 2    70.1    1e-10   
ref|XP_011012890.1|  PREDICTED: aspartic proteinase-like protein 2    70.1    1e-10   
gb|KDO54023.1|  hypothetical protein CISIN_1g0142942mg                67.4    1e-10   
ref|NP_001169558.1|  uncharacterized protein LOC100383437 precursor   69.7    1e-10   
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    1e-10   
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    2e-10   
gb|KJB37242.1|  hypothetical protein B456_006G195400                  69.3    2e-10   
tpg|DAA40199.1|  TPA: hypothetical protein ZEAMMB73_627989            69.3    2e-10   
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.7    2e-10   
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  69.7    2e-10   
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
emb|CDP20730.1|  unnamed protein product                              69.3    2e-10   
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...  69.3    2e-10   
ref|XP_010325698.1|  PREDICTED: aspartic proteinase CDR1-like         69.3    2e-10   
gb|EYU29013.1|  hypothetical protein MIMGU_mgv1a025477mg              69.3    2e-10   
gb|AEX12632.1|  hypothetical protein 2_5918_01                        65.9    2e-10   
ref|XP_002460315.1|  hypothetical protein SORBIDRAFT_02g026350        69.3    2e-10   
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
ref|XP_008777074.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    2e-10   
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  69.3    2e-10   
emb|CDP11850.1|  unnamed protein product                              68.9    2e-10   
ref|XP_010926618.1|  PREDICTED: aspartic proteinase-like protein ...  69.3    2e-10   
gb|AEX12643.1|  hypothetical protein 2_5918_01                        65.9    2e-10   
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    2e-10   
ref|XP_010926619.1|  PREDICTED: aspartic proteinase-like protein ...  69.3    2e-10   
gb|EYU29011.1|  hypothetical protein MIMGU_mgv1a020848mg              68.9    2e-10   
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg           68.9    3e-10   
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    3e-10   
gb|EYU29012.1|  hypothetical protein MIMGU_mgv1a020199mg              68.9    3e-10   
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    3e-10   
ref|XP_009406350.1|  PREDICTED: aspartic proteinase-like protein 2    68.9    3e-10   
ref|XP_002890686.1|  aspartyl protease family protein                 68.9    3e-10   
gb|EYU29010.1|  hypothetical protein MIMGU_mgv1a018221mg              68.9    3e-10   
ref|XP_007029277.1|  Eukaryotic aspartyl protease family protein,...  68.6    3e-10   
ref|XP_004244684.1|  PREDICTED: aspartic proteinase CDR1-like         68.9    3e-10   
emb|CDY03848.1|  BnaC07g10730D                                        68.9    3e-10   
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.9    3e-10   
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                     68.9    3e-10   
ref|XP_011073816.1|  PREDICTED: aspartic proteinase-like protein 2    68.9    3e-10   
gb|EPS61272.1|  hypothetical protein M569_13524                       68.6    3e-10   
gb|KJB26861.1|  hypothetical protein B456_004G263600                  68.6    3e-10   
ref|XP_007029276.1|  Eukaryotic aspartyl protease family protein,...  68.6    4e-10   
ref|XP_004229588.1|  PREDICTED: aspartic proteinase CDR1-like         68.6    4e-10   
emb|CDP11847.1|  unnamed protein product                              68.6    4e-10   
ref|XP_006428616.1|  hypothetical protein CICLE_v10011566mg           67.4    4e-10   
gb|KCW84586.1|  hypothetical protein EUGRSUZ_B01422                   68.2    4e-10   
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg           68.6    4e-10   
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.6    4e-10   
ref|XP_008375679.1|  PREDICTED: aspartic proteinase CDR1-like         68.6    4e-10   
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg           68.6    4e-10   
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                 68.6    4e-10   
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.6    4e-10   
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  68.2    4e-10   
ref|XP_010038337.1|  PREDICTED: aspartic proteinase-like protein 2    68.2    5e-10   
ref|XP_008355455.1|  PREDICTED: aspartic proteinase-like protein 2    68.2    5e-10   
ref|XP_009347714.1|  PREDICTED: aspartic proteinase-like protein 2    68.2    5e-10   
gb|EYU32742.1|  hypothetical protein MIMGU_mgv1a005397mg              68.2    6e-10   
ref|XP_004975767.1|  PREDICTED: aspartic proteinase nepenthesin-1...  67.8    6e-10   
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971            67.8    6e-10   
ref|XP_006857555.1|  hypothetical protein AMTR_s00061p00053670        67.8    6e-10   
dbj|BAK00673.1|  predicted protein                                    67.8    7e-10   
ref|XP_006297515.1|  hypothetical protein CARUB_v10013539mg           67.8    7e-10   
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966            67.4    7e-10   
ref|XP_002444651.1|  hypothetical protein SORBIDRAFT_07g025440        67.8    7e-10   
ref|XP_006838778.1|  hypothetical protein AMTR_s00002p00258350        67.8    7e-10   
ref|XP_010244232.1|  PREDICTED: aspartic proteinase CDR1-like         67.8    7e-10   
ref|XP_007200981.1|  hypothetical protein PRUPE_ppa004856mg           67.8    7e-10   



>gb|EPS67652.1| hypothetical protein M569_07122 [Genlisea aurea]
Length=401

 Score =   193 bits (491),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+LP+YGNVYP+GFYF QV +G PPRPYF+DPDTGSDLTWLQCDAPCV CT+  HPLY+P
Sbjct  26   IMLPVYGNVYPDGFYFVQVYLGYPPRPYFLDPDTGSDLTWLQCDAPCVRCTEGFHPLYRP  85

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV+CKDPLCASLH  DYTC++P QCDY+VEYADGGSSLGVLVND F+
Sbjct  86   SNDLVVCKDPLCASLHSSDYTCDNPEQCDYEVEYADGGSSLGVLVNDFFT  135



>emb|CDP04854.1| unnamed protein product [Coffea canephora]
Length=410

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 121/158 (77%), Gaps = 15/158 (9%)
 Frame = +2

Query  167  GSPDRLDRHQKWWKWpspgsdgassssssssssssssspvvsrggpssIVLPLYGNVYPN  346
            GS D+L   QKW KW S  S  ASSS ++  SS SS            I+  LYGNV+P+
Sbjct  5    GSRDQL---QKWCKWKSRVSTEASSSEANPVSSYSS------------ILFKLYGNVHPD  49

Query  347  GFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLC  526
            G+YFAQV++G PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHPLY+P NDLV+C+DPLC
Sbjct  50   GYYFAQVNVGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTEAPHPLYRPTNDLVVCRDPLC  109

Query  527  ASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ASLH G Y C +P QCDY+VEYADGGSS GVLVNDVFS
Sbjct  110  ASLHSGAYECPNPEQCDYEVEYADGGSSFGVLVNDVFS  147



>ref|XP_004240685.1| PREDICTED: aspartic proteinase Asp1 [Solanum lycopersicum]
Length=427

 Score =   192 bits (487),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 108/150 (72%), Gaps = 17/150 (11%)
 Frame = +2

Query  188  RHQKWWKWpspgsdgassssssssssssssspvvsrggpssIVLPLYGNVYPNGFYFAQV  367
            + QKWWKW S  S    +   SSS                 IVLPLYGNVYP G+Y+ Q+
Sbjct  30   QQQKWWKWMSSTSAAMVNPVVSSS-----------------IVLPLYGNVYPLGYYYVQL  72

Query  368  DIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCASLHVGD  547
            +IG P RP+F+DPDTGSDLTWLQCDAPCV CT APHP YKPNNDLV CKDPLCASLH   
Sbjct  73   NIGQPSRPFFLDPDTGSDLTWLQCDAPCVRCTTAPHPFYKPNNDLVPCKDPLCASLHPAG  132

Query  548  YTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            Y CESP QCDY V+YADGGSSLGVL+NDVF
Sbjct  133  YKCESPEQCDYQVDYADGGSSLGVLLNDVF  162



>gb|EYU20602.1| hypothetical protein MIMGU_mgv1a007047mg [Erythranthe guttata]
Length=422

 Score =   191 bits (486),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ PLYGNVYPNGFYF QV +G PP+PYF+DPDTGSDLTWLQCDAPCV CT   HPLY+P
Sbjct  51   IIFPLYGNVYPNGFYFVQVYLGYPPKPYFLDPDTGSDLTWLQCDAPCVRCTTGFHPLYRP  110

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLVICKDPLCASLH  DY CE+  QCDY+VEYADGGSSLGVLVND F+
Sbjct  111  SNDLVICKDPLCASLHSSDYKCENTEQCDYEVEYADGGSSLGVLVNDFFT  160



>ref|XP_009631909.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=431

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPLYGNVYP G+Y+ Q++IG P +PYF+DPDTGSDLTWLQCDAPCV CT+APHP YKP
Sbjct  58   IVLPLYGNVYPIGYYYVQLNIGQPSKPYFLDPDTGSDLTWLQCDAPCVRCTRAPHPFYKP  117

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            NNDLV CKDPLCASLH  DY CESP QCDY V+YADGGSSLGVL+NDVF+
Sbjct  118  NNDLVPCKDPLCASLHHVDYKCESPEQCDYQVDYADGGSSLGVLLNDVFN  167



>ref|XP_011099684.1| PREDICTED: aspartic proteinase Asp1 [Sesamum indicum]
Length=422

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ PLYGNVYPNGFYF QV +G PP+PYF+DPDTGSDLTWLQCDAPCV CT   HPLY+P
Sbjct  50   IIFPLYGNVYPNGFYFVQVYLGYPPKPYFLDPDTGSDLTWLQCDAPCVRCTTGFHPLYRP  109

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +N+LVICKDPLCASLH  DY C++P QCDY+VEYADGGSSLGVLVND F+
Sbjct  110  SNELVICKDPLCASLHSQDYNCDNPEQCDYEVEYADGGSSLGVLVNDFFT  159



>ref|XP_006346815.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=437

 Score =   189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPLYGNVYP G+Y+ Q++IG P RP+F+DPDTGSDLTWLQCDAPCV CT APHP YKP
Sbjct  64   IVLPLYGNVYPLGYYYVQLNIGQPSRPFFLDPDTGSDLTWLQCDAPCVRCTTAPHPFYKP  123

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            NNDLV CKDPLCASLH   Y CESP QCDY V+YADGGSSLGVL+NDVF
Sbjct  124  NNDLVPCKDPLCASLHPAGYKCESPEQCDYQVDYADGGSSLGVLLNDVF  172



>ref|XP_002273988.1| PREDICTED: aspartic proteinase Asp1 [Vitis vinifera]
 emb|CBI21613.3| unnamed protein product [Vitis vinifera]
Length=426

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PLYGNVYP G+Y+  + IG PP+PYF+DPDTGSDL+WLQCDAPCV CTKAPHPLY+P
Sbjct  53   VVFPLYGNVYPLGYYYVSLSIGQPPKPYFLDPDTGSDLSWLQCDAPCVRCTKAPHPLYRP  112

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            NN+LVICKDP+CASLH   Y CE P QCDY+VEYADGGSSLGVLV DVF
Sbjct  113  NNNLVICKDPMCASLHPPGYKCEHPEQCDYEVEYADGGSSLGVLVKDVF  161



>ref|XP_009766881.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=433

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
            LPLYGN+YP G+Y+ Q++IG P +PYF+DPDTGSDLTWLQCDAPCV CT+APHP YKPNN
Sbjct  62   LPLYGNIYPIGYYYVQLNIGQPSKPYFLDPDTGSDLTWLQCDAPCVRCTRAPHPFYKPNN  121

Query  497  DLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            DLV CKDPLCASLH  DY CESP QCDY V+YADGGSSLGVL+NDVF
Sbjct  122  DLVPCKDPLCASLHHVDYKCESPEQCDYQVDYADGGSSLGVLLNDVF  168



>ref|XP_007048531.1| Aspartyl protease family protein isoform 2 [Theobroma cacao]
 gb|EOX92688.1| Aspartyl protease family protein isoform 2 [Theobroma cacao]
Length=339

 Score =   181 bits (458),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ P++GNVYP G+Y   + IG PP+PYF+D DTGSDLTWLQCDAPCVHC +APHPLY+P
Sbjct  47   ILFPIHGNVYPTGYYNVTISIGQPPKPYFLDLDTGSDLTWLQCDAPCVHCVEAPHPLYRP  106

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             NDLV CKDPLCA+LH  GDY CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  107  TNDLVPCKDPLCAALHPPGDYKCENPEQCDYEVEYADGGSSLGVLVRDVFS  157



>dbj|BAD80835.1| nucellin-like protein [Daucus carota]
Length=426

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
            LPLYGNVYP+G+Y  Q +IG PP+PYF+DPDTGSDLTWLQCDAPC+ CT APHPLY+P N
Sbjct  55   LPLYGNVYPSGYYHVQFNIGQPPKPYFLDPDTGSDLTWLQCDAPCIQCTPAPHPLYQPTN  114

Query  497  DLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            DLV+CKDP+CASLH  +Y C+ P QCDY+VEYADGGSS+GVLVND+F
Sbjct  115  DLVVCKDPICASLHPDNYRCDDPDQCDYEVEYADGGSSIGVLVNDLF  161



>ref|XP_007048530.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX92687.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=421

 Score =   182 bits (461),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ P++GNVYP G+Y   + IG PP+PYF+D DTGSDLTWLQCDAPCVHC +APHPLY+P
Sbjct  47   ILFPIHGNVYPTGYYNVTISIGQPPKPYFLDLDTGSDLTWLQCDAPCVHCVEAPHPLYRP  106

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             NDLV CKDPLCA+LH  GDY CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  107  TNDLVPCKDPLCAALHPPGDYKCENPEQCDYEVEYADGGSSLGVLVRDVFS  157



>ref|XP_010025734.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62453.1| hypothetical protein EUGRSUZ_H05088 [Eucalyptus grandis]
Length=436

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL+GNV+P G Y   + IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+ PHPLY+P
Sbjct  62   VVFPLHGNVFPTGSYNTTLFIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTQTPHPLYRP  121

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             NDLVIC+DP+CASLH GDY C+ P QCDY+VEYADGGSSLGVLV DV S
Sbjct  122  TNDLVICRDPICASLHSGDYRCDHPEQCDYEVEYADGGSSLGVLVKDVVS  171



>gb|KHG06665.1| Asparticase Asp1 [Gossypium arboreum]
Length=383

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ P++GNVYP G+Y   ++IG+PP+PYF+D DTGSDLTWLQC+APCVHC +APHPLY+P
Sbjct  51   ILFPIHGNVYPTGYYNVTINIGHPPKPYFLDLDTGSDLTWLQCNAPCVHCIEAPHPLYQP  110

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+ PLCA+LH  DY CESP QCDY+VEYADGGSSLGVLV DVFS
Sbjct  111  SNDLVACRHPLCAALHPPDYKCESPDQCDYEVEYADGGSSLGVLVRDVFS  160



>gb|KJB40494.1| hypothetical protein B456_007G066800 [Gossypium raimondii]
Length=426

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ P++GNVYP G+Y   ++IG+PP+PYF+D DTGSDLTWLQC+APCVHC +APHPLY+P
Sbjct  51   ILFPIHGNVYPTGYYNVTINIGHPPKPYFLDLDTGSDLTWLQCNAPCVHCIEAPHPLYQP  110

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+ PLCA+LH  DY CESP QCDY+VEYADGGSSLGVLV DVFS
Sbjct  111  SNDLVACRHPLCAALHPPDYKCESPDQCDYEVEYADGGSSLGVLVRDVFS  160



>ref|XP_008227592.1| PREDICTED: aspartic proteinase Asp1 [Prunus mume]
Length=435

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLP++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHPLY+P
Sbjct  60   IVLPVHGNVYPIGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTEAPHPLYRP  119

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            NNDLV+CKDPLC +LH  G + CE+P QCDY+VEYADGGSSLGVLV D F
Sbjct  120  NNDLVVCKDPLCEALHAPGSHKCENPEQCDYEVEYADGGSSLGVLVRDAF  169



>ref|XP_002310541.2| hypothetical protein POPTR_0007s04800g [Populus trichocarpa]
 gb|EEE90991.2| hypothetical protein POPTR_0007s04800g [Populus trichocarpa]
Length=430

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 94/111 (85%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYP GFY   ++IG P +PYF+D DTGSDLTWLQCDAPCVHCT+APHP YKP
Sbjct  56   IVLPLHGNVYPTGFYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVHCTEAPHPYYKP  115

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +N+LV CKDP+C SLH  GD  CE+P QCDY+VEYADGGSSLGVLV D F+
Sbjct  116  SNNLVACKDPICQSLHTGGDQRCENPGQCDYEVEYADGGSSLGVLVKDAFN  166



>ref|XP_011468243.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=402

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLP++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  53   VVLPVHGNVYPIGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTEAPHPYYRP  112

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            NNDLV+C+DPLCASLH  G + C++P QCDY+VEYADGGSSLGVLV D F
Sbjct  113  NNDLVVCRDPLCASLHAPGAHKCDNPEQCDYEVEYADGGSSLGVLVRDAF  162



>ref|XP_007211687.1| hypothetical protein PRUPE_ppa005961mg [Prunus persica]
 gb|EMJ12886.1| hypothetical protein PRUPE_ppa005961mg [Prunus persica]
Length=435

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLP++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  60   IVLPVHGNVYPIGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTEAPHPFYRP  119

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            NNDLV+CKDPLC +LH  G + C++P QCDY+VEYADGGSSLGVLV D F
Sbjct  120  NNDLVVCKDPLCEALHAPGSHKCDNPEQCDYEVEYADGGSSLGVLVRDAF  169



>ref|XP_011468246.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=400

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLP++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  53   VVLPVHGNVYPIGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTEAPHPYYRP  112

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            NNDLV+C+DPLCASLH  G + C++P QCDY+VEYADGGSSLGVLV D F
Sbjct  113  NNDLVVCRDPLCASLHAPGAHKCDNPEQCDYEVEYADGGSSLGVLVRDAF  162



>emb|CAN73001.1| hypothetical protein VITISV_037997 [Vitis vinifera]
Length=424

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PLYGNVYP G+Y+  + IG PP PYF+DP TGSDL+WLQCDAPCV CTKA H LY+P
Sbjct  53   VVFPLYGNVYPLGYYYVSLSIGQPPXPYFLDPXTGSDLSWLQCDAPCVRCTKAXHXLYRP  112

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            NN+LVICKDP+CA LH   Y CE P QCDY+VEYADGGSSLGVLV DVF
Sbjct  113  NNNLVICKDPMCAXLHPPGYKCEHPEQCDYEVEYADGGSSLGVLVKDVF  161



>ref|XP_006412352.1| hypothetical protein EUTSA_v10025289mg [Eutrema salsugineum]
 dbj|BAJ34094.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53805.1| hypothetical protein EUTSA_v10025289mg [Eutrema salsugineum]
Length=424

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 95/111 (86%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCVHC +APHPLY+P
Sbjct  43   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVHCLEAPHPLYQP  102

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDL+ C DPLC +LH  G++ CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  103  SNDLIPCNDPLCKALHFNGNHRCETPEQCDYEVEYADGGSSLGVLVRDVFS  153



>ref|XP_010674354.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010674355.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=393

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+LP+YGNVYP GFY+  V +G+PPRPYF+DPDTGSDLTWLQCDAPCV CT+APHPLYKP
Sbjct  20   IILPVYGNVYPRGFYYVPVLVGDPPRPYFLDPDTGSDLTWLQCDAPCVRCTRAPHPLYKP  79

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            ++DL+ C+DPLCA++    Y  E+P QCDY+VEYADGGSSLGVL+ D  
Sbjct  80   SSDLIPCRDPLCAAVQPEYYRSETPEQCDYEVEYADGGSSLGVLLRDAM  128



>ref|XP_010674353.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=437

 Score =   173 bits (439),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+LP+YGNVYP GFY+  V +G+PPRPYF+DPDTGSDLTWLQCDAPCV CT+APHPLYKP
Sbjct  64   IILPVYGNVYPRGFYYVPVLVGDPPRPYFLDPDTGSDLTWLQCDAPCVRCTRAPHPLYKP  123

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            ++DL+ C+DPLCA++    Y  E+P QCDY+VEYADGGSSLGVL+ D  
Sbjct  124  SSDLIPCRDPLCAAVQPEYYRSETPEQCDYEVEYADGGSSLGVLLRDAM  172



>ref|XP_008361087.1| PREDICTED: aspartic proteinase Asp1-like [Malus domestica]
Length=430

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLP++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  54   IVLPVHGNVYPTGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVRCTQAPHPYYRP  113

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            NNDLV CKDPLC +LH  G + C+ P QCDY+VEYADGGSS+GVL+ D FS
Sbjct  114  NNDLVACKDPLCEALHSPGSHKCDVPEQCDYEVEYADGGSSIGVLLRDSFS  164



>ref|XP_004163385.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like 
[Cucumis sativus]
Length=418

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL GNVYPNGFY   + +G PP+PYF+DPDTGSDLTWLQCDAPC  CT+  HPLY+P
Sbjct  43   IVLPLQGNVYPNGFYNVTLYVGQPPKPYFLDPDTGSDLTWLQCDAPCQQCTETLHPLYQP  102

Query  491  NNDLVICKDPLCASLHVG-DYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +NDLV CKDPLC SLH   D+ CE+P QCDY+VEYADGGSSLGVLV DVF
Sbjct  103  SNDLVPCKDPLCMSLHSSMDHRCENPDQCDYEVEYADGGSSLGVLVRDVF  152



>ref|XP_004147327.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
Length=418

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL GNVYPNGFY   + +G PP+PYF+DPDTGSDLTWLQCDAPC  CT+  HPLY+P
Sbjct  43   IVLPLQGNVYPNGFYNVTLYVGQPPKPYFLDPDTGSDLTWLQCDAPCQQCTETLHPLYQP  102

Query  491  NNDLVICKDPLCASLHVG-DYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +NDLV CKDPLC SLH   D+ CE+P QCDY+VEYADGGSSLGVLV DVF
Sbjct  103  SNDLVPCKDPLCMSLHSSMDHRCENPDQCDYEVEYADGGSSLGVLVRDVF  152



>ref|XP_009355861.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=430

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  54   IVFPVHGNVYPTGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVSCTQAPHPYYRP  113

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV CKDPLC +LH  G + C++P QCDY+VEYADGGSSLGVLV D FS
Sbjct  114  SNDLVACKDPLCEALHSPGSHKCDAPEQCDYEVEYADGGSSLGVLVRDSFS  164



>ref|XP_008460823.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Cucumis melo]
Length=429

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL GNVYPNGFY   + +G PP+PYF+DPDTGSDLTWLQCDAPC  CT+  HPLY+P
Sbjct  54   IVLPLQGNVYPNGFYNVTLYVGQPPKPYFLDPDTGSDLTWLQCDAPCQQCTETLHPLYQP  113

Query  491  NNDLVICKDPLCASLHVG-DYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +NDLV CKDPLC SLH   D+ CE+P QCDY+VEYADGGSSLGVLV DVF
Sbjct  114  SNDLVPCKDPLCMSLHSSMDHRCENPDQCDYEVEYADGGSSLGVLVRDVF  163



>ref|XP_008460822.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Cucumis melo]
Length=433

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 92/110 (84%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL GNVYPNGFY   + +G PP+PYF+DPDTGSDLTWLQCDAPC  CT+  HPLY+P
Sbjct  54   IVLPLQGNVYPNGFYNVTLYVGQPPKPYFLDPDTGSDLTWLQCDAPCQQCTETLHPLYQP  113

Query  491  NNDLVICKDPLCASLHVG-DYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +NDLV CKDPLC SLH   D+ CE+P QCDY+VEYADGGSSLGVLV DVF
Sbjct  114  SNDLVPCKDPLCMSLHSSMDHRCENPDQCDYEVEYADGGSSLGVLVRDVF  163



>ref|XP_010527074.1| PREDICTED: aspartic proteinase Asp1-like [Tarenaya hassleriana]
Length=420

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP G+Y   +++G P RPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  42   IVFPVHGNVYPVGYYNVTINVGQPSRPYYLDLDTGSDLTWLQCDAPCVRCVEAPHPLYEP  101

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDL+ CKDPLC +LH  GD  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  102  SNDLIPCKDPLCKALHSHGDQRCEAPEQCDYEVEYADGGSSLGVLVRDVFS  152



>ref|XP_002307058.2| nucellin family protein [Populus trichocarpa]
 gb|EEE94054.2| nucellin family protein [Populus trichocarpa]
Length=394

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYPNG+Y   ++IG P +PYF+D DTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  20   IVLPLHGNVYPNGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVQCTEAPHPYYRP  79

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N+LV C DP+C SLH  GD+ CE+P QCDY+VEYADGGSS GVLV D F+
Sbjct  80   RNNLVPCMDPICQSLHSNGDHRCENPGQCDYEVEYADGGSSFGVLVRDTFN  130



>ref|XP_006382886.1| hypothetical protein POPTR_0005s07070g [Populus trichocarpa]
 gb|ERP60683.1| hypothetical protein POPTR_0005s07070g [Populus trichocarpa]
Length=393

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYPNG+Y   ++IG P +PYF+D DTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  20   IVLPLHGNVYPNGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVQCTEAPHPYYRP  79

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N+LV C DP+C SLH  GD+ CE+P QCDY+VEYADGGSS GVLV D F+
Sbjct  80   RNNLVPCMDPICQSLHSNGDHRCENPGQCDYEVEYADGGSSFGVLVRDTFN  130



>gb|ABK95151.1| unknown [Populus trichocarpa]
Length=393

 Score =   170 bits (430),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYPNG+Y   ++IG P +PYF+D DTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  20   IVLPLHGNVYPNGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVQCTEAPHPYYRP  79

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N+LV C DP+C SLH  GD+ CE+P QCDY+VEYADGGSS GVLV D F+
Sbjct  80   RNNLVPCMDPICQSLHSNGDHRCENPGQCDYEVEYADGGSSFGVLVTDTFN  130



>ref|XP_009350136.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=430

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  54   IVFPVHGNVYPIGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVKCTQAPHPYYRP  113

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV CKDPLC +LH  G + C++P QCDY+VEYADGGSSLGVLV D FS
Sbjct  114  SNDLVACKDPLCEALHSPGSHKCDAPEQCDYEVEYADGGSSLGVLVRDSFS  164



>ref|XP_010111255.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXC30733.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=432

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+ PHPLY+P
Sbjct  56   VVFPIHGNVYPIGFYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVQCTETPHPLYRP  115

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +NDLV C+DPLC +LH+ G   C++P QCDY+VEYADGGSSLGVLV D F
Sbjct  116  SNDLVGCRDPLCIALHLPGTPKCDNPEQCDYEVEYADGGSSLGVLVKDAF  165



>ref|XP_010437756.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   + IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTIHIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ++DL+ C DPLC +LH+ G+  CESP QCDY+VEYADGGSSLGVLV DVFS
Sbjct  106  SSDLIPCNDPLCKALHLNGNQRCESPEQCDYEVEYADGGSSLGVLVRDVFS  156



>gb|KDP24798.1| hypothetical protein JCGZ_25323 [Jatropha curcas]
Length=424

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL+GNVYP G+Y   ++IG P +PYF+D DTGSDLTWLQCDAPC  CT+APHPLY+P
Sbjct  52   LVFPLHGNVYPAGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCRQCTEAPHPLYRP  111

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +N+LV+C DPLC SL   G++ CE P QCDY+VEYADGGSSLGVLV DVF
Sbjct  112  SNNLVVCNDPLCRSLQAPGEHKCEDPEQCDYEVEYADGGSSLGVLVRDVF  161



>gb|KEH20923.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=310

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P+YGNVYP GFY   ++IG PPRPYF+D DTGS+LTWLQCDAPC  C++ PHPLYKP
Sbjct  60   IVFPIYGNVYPVGFYNVTLNIGQPPRPYFLDVDTGSELTWLQCDAPCSQCSETPHPLYKP  119

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +ND + CKDPLCASL    DYTCE P QCDY+++YAD  S+LGVL+NDV+
Sbjct  120  SNDFIPCKDPLCASLQPTDDYTCEDPNQCDYEIKYADQYSTLGVLLNDVY  169



>ref|NP_567922.2| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AEE86233.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=401

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  43   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  102

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ++DL+ C DPLC +LH+  +  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  103  SSDLIPCNDPLCKALHLNSNQRCETPEQCDYEVEYADGGSSLGVLVRDVFS  153



>emb|CAB38807.1| nucellin-like protein [Arabidopsis thaliana]
 emb|CAB80066.1| nucellin-like protein [Arabidopsis thaliana]
Length=420

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  24   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  83

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ++DL+ C DPLC +LH+  +  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  84   SSDLIPCNDPLCKALHLNSNQRCETPEQCDYEVEYADGGSSLGVLVRDVFS  134



>ref|NP_001190905.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAM64443.1| nucellin-like protein [Arabidopsis thaliana]
 gb|AEE86234.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=425

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ++DL+ C DPLC +LH+  +  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  106  SSDLIPCNDPLCKALHLNSNQRCETPEQCDYEVEYADGGSSLGVLVRDVFS  156



>ref|XP_006282959.1| hypothetical protein CARUB_v10007649mg [Capsella rubella]
 gb|EOA15857.1| hypothetical protein CARUB_v10007649mg [Capsella rubella]
Length=425

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 92/111 (83%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G+Y   + IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVNGNVYPLGYYNVTIHIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ++DL+ C DPLC +LH+ G+  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  106  SSDLIPCNDPLCKALHLNGNQRCETPEQCDYEVEYADGGSSLGVLVRDVFS  156



>ref|XP_002867175.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43434.1| hypothetical protein ARALYDRAFT_328390 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ++DL+ C DPLC +LH+  +  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  106  SSDLIPCNDPLCKALHLNSNQRCETPEQCDYEVEYADGGSSLGVLVRDVFS  156



>dbj|BAC43357.1| putative nucellin [Arabidopsis thaliana]
Length=413

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  34   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  93

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ++DL+ C DPLC +LH+  +  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  94   SSDLIPCNDPLCKALHLNSNQRCETPEQCDYEVEYADGGSSLGVLVRDVFS  144



>ref|XP_011022861.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase Asp1-like 
[Populus euphratica]
Length=429

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYP GFY   ++IG P +PYF+D DTGSDLTWLQCDAPCV CT+APHP YKP
Sbjct  56   IVLPLHGNVYPTGFYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVQCTEAPHPYYKP  115

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV  KDP+C SLH  GD   E+P QCDY+V YADGGSSLGVLV D F+
Sbjct  116  SNDLVAWKDPICQSLHTNGDQKHENPEQCDYEVXYADGGSSLGVLVKDAFN  166



>ref|XP_010432554.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   + IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTIHIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            + DL  C DPLC +LH+ G+  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  106  SGDLTPCNDPLCKALHLNGNQRCEAPEQCDYEVEYADGGSSLGVLVRDVFS  156



>gb|KFK29973.1| hypothetical protein AALP_AA7G201200 [Arabis alpina]
Length=422

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PP+PY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  43   VVFPVHGNVYPLGYYNVTINIGQPPKPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  102

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ++DL+ C DPLC +LH  G+  CE+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  103  SSDLIPCNDPLCKALHSNGNQRCETPEQCDYEVEYADGGSSLGVLVRDVFS  153



>gb|KDO52221.1| hypothetical protein CISIN_1g013774mg [Citrus sinensis]
 gb|KDO52222.1| hypothetical protein CISIN_1g013774mg [Citrus sinensis]
Length=436

 Score =   166 bits (420),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   V +G PP+PYF+D DTGSDL WLQCDAPCV C +APHPLY+P
Sbjct  63   LLFRVQGNVYPTGYYNVTVYVGQPPKPYFLDLDTGSDLIWLQCDAPCVQCVEAPHPLYRP  122

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+DP+CASLH  G + CE PTQCDY+VEYADGGSSLGVLV D F+
Sbjct  123  SNDLVPCEDPICASLHAPGQHKCEDPTQCDYEVEYADGGSSLGVLVKDAFA  173



>ref|XP_006464925.1| PREDICTED: aspartic proteinase Asp1-like [Citrus sinensis]
Length=436

 Score =   166 bits (419),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   V +G PP+PYF+D DTGSDL WLQCDAPCV C +APHPLY+P
Sbjct  63   LLFRVQGNVYPTGYYNVTVYVGQPPKPYFLDLDTGSDLIWLQCDAPCVQCVEAPHPLYRP  122

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+DP+CASLH  G + CE PTQCDY+VEYADGGSSLGVLV D F+
Sbjct  123  SNDLVPCEDPICASLHAPGQHKCEDPTQCDYEVEYADGGSSLGVLVKDAFA  173



>emb|CDX68982.1| BnaC01g04710D [Brassica napus]
Length=430

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  49   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  108

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDL+ C DPLC ++H+ G++  E+  QCDY+VEYADGGSSLGVLV DVFS
Sbjct  109  SNDLIPCSDPLCKAMHMNGNHRYEAQEQCDYEVEYADGGSSLGVLVRDVFS  159



>gb|KDO52227.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
 gb|KDO52228.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=255

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  ++GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  54   LLFQVHGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  113

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+DP+CASLH  G + CE P QCDY++EYADGGSSLGVLV D F+
Sbjct  114  SNDLVPCEDPICASLHAPGHHNCEDPAQCDYELEYADGGSSLGVLVKDAFA  164



>ref|XP_006432088.1| hypothetical protein CICLE_v10001122mg [Citrus clementina]
 gb|ESR45328.1| hypothetical protein CICLE_v10001122mg [Citrus clementina]
Length=451

 Score =   166 bits (419),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   V +G PP+PYF+D DTGSDL WLQCDAPCV C +APHPLY+P
Sbjct  78   LLFRVQGNVYPTGYYNVTVYVGQPPKPYFLDLDTGSDLIWLQCDAPCVQCVEAPHPLYRP  137

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+DP+CASLH  G + CE PTQCDY+VEYADGGSSLGVLV D F+
Sbjct  138  SNDLVPCEDPICASLHAPGQHKCEDPTQCDYEVEYADGGSSLGVLVKDAFA  188



>ref|XP_009121783.1| PREDICTED: aspartic proteinase Asp1 [Brassica rapa]
Length=427

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDL+ C DPLC ++H+ G++  E+  QCDY+VEYADGGSSLGVLV DVFS
Sbjct  106  SNDLIPCSDPLCKAMHMNGNHRYEAQEQCDYEVEYADGGSSLGVLVRDVFS  156



>emb|CDX75359.1| BnaA01g03430D [Brassica napus]
Length=429

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   ++IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  48   VVFPVHGNVYPLGYYNVTINIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  107

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDL+ C DPLC ++H+ G++  E+  QCDY+VEYADGGSSLGVLV DVFS
Sbjct  108  SNDLIPCSDPLCKAMHMNGNHRYEAQEQCDYEVEYADGGSSLGVLVRDVFS  158



>gb|KDO52226.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=305

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  ++GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  54   LLFQVHGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  113

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+DP+CASLH  G + CE P QCDY++EYADGGSSLGVLV D F+
Sbjct  114  SNDLVPCEDPICASLHAPGHHNCEDPAQCDYELEYADGGSSLGVLVKDAFA  164



>ref|XP_011031099.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
 ref|XP_011016209.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=432

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYPNG+Y   ++IG P +PYF+D DTGSDLTWLQCDAPCV C +APHP Y+P
Sbjct  56   IVLPLHGNVYPNGYYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDAPCVQCLEAPHPYYRP  115

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +N+LV C DP+C SL   GD+ CE+P QCDY+V YADGGSS GVLV D F+
Sbjct  116  SNNLVACTDPICQSLQSNGDHRCENPGQCDYEVAYADGGSSFGVLVRDTFN  166



>gb|KEH20924.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=410

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P+YGNVYP GFY   ++IG PPRPYF+D DTGS+LTWLQCDAPC  C++ PHPLYKP
Sbjct  60   IVFPIYGNVYPVGFYNVTLNIGQPPRPYFLDVDTGSELTWLQCDAPCSQCSETPHPLYKP  119

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +ND + CKDPLCASL    DYTCE P QCDY+++YAD  S+LGVL+NDV+
Sbjct  120  SNDFIPCKDPLCASLQPTDDYTCEDPNQCDYEIKYADQYSTLGVLLNDVY  169



>ref|XP_003630348.1| Aspartic proteinase Asp1 [Medicago truncatula]
 gb|AET04824.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=435

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P+YGNVYP GFY   ++IG PPRPYF+D DTGS+LTWLQCDAPC  C++ PHPLYKP
Sbjct  60   IVFPIYGNVYPVGFYNVTLNIGQPPRPYFLDVDTGSELTWLQCDAPCSQCSETPHPLYKP  119

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +ND + CKDPLCASL    DYTCE P QCDY+++YAD  S+LGVL+NDV+
Sbjct  120  SNDFIPCKDPLCASLQPTDDYTCEDPNQCDYEIKYADQYSTLGVLLNDVY  169



>ref|XP_010447234.1| PREDICTED: aspartic proteinase Asp1-like [Camelina sativa]
Length=425

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP G+Y   + IG PPRPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  46   VVFPVHGNVYPLGYYNVTIHIGQPPRPYYLDLDTGSDLTWLQCDAPCVRCLEAPHPLYQP  105

Query  491  NNDLVICKDPLCASLHVGD-YTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ++DL+ C DPLC +LH+ D    E+P QCDY+VEYADGGSSLGVLV DVFS
Sbjct  106  SSDLIPCNDPLCKALHLNDNQRSEAPEQCDYEVEYADGGSSLGVLVRDVFS  156



>ref|XP_002522918.1| nucellin, putative [Ricinus communis]
 gb|EEF39461.1| nucellin, putative [Ricinus communis]
Length=433

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL+GNVYP G+Y   + IG P +PYF+D DTGSDLTWLQCDAPC  C +APHPLY+P
Sbjct  57   LVFPLHGNVYPAGYYNVTLSIGQPAKPYFLDVDTGSDLTWLQCDAPCRQCIEAPHPLYRP  116

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +N+LVIC+DPLCASL   G + C+ P QCDY+VEYADGGSSLGVLV DVF
Sbjct  117  SNNLVICEDPLCASLQPPGVHNCQDPDQCDYEVEYADGGSSLGVLVKDVF  166



>gb|KDO52229.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=380

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  ++GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  37   LLFQVHGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  96

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+DP+CASLH  G + CE P QCDY++EYADGGSSLGVLV D F+
Sbjct  97   SNDLVPCEDPICASLHAPGHHNCEDPAQCDYELEYADGGSSLGVLVKDAFA  147



>ref|XP_004503902.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=437

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP GFY   ++IG PPRPYF D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  62   IVFPVFGNVYPVGFYNVTLNIGQPPRPYFFDVDTGSDLTWLQCDAPCSQCSETPHPLYRP  121

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +ND V CKDPLCASL    DYTCE P QCDY++EYAD  S+LGVL+NDV+
Sbjct  122  SNDFVPCKDPLCASLQPNNDYTCEDPNQCDYEIEYADHYSTLGVLLNDVY  171



>gb|KDO52225.1| hypothetical protein CISIN_1g015972mg [Citrus sinensis]
Length=397

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  ++GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  54   LLFQVHGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  113

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+DP+CASLH  G + CE P QCDY++EYADGGSSLGVLV D F+
Sbjct  114  SNDLVPCEDPICASLHAPGHHNCEDPAQCDYELEYADGGSSLGVLVKDAFA  164



>ref|XP_003532363.2| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN16936.1| Aspartic proteinase Asp1 [Glycine soja]
Length=431

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 88/110 (80%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPLYGNVYP GFY   ++IG P RPYF+D DTGSDLTWLQCDAPC HC++ PHPLY+P
Sbjct  57   IVLPLYGNVYPVGFYNVTLNIGQPARPYFLDVDTGSDLTWLQCDAPCTHCSETPHPLYRP  116

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +ND V C+DPLCASL    DY CE P QCDY++ YAD  S+ GVL+NDV+
Sbjct  117  SNDFVPCRDPLCASLQPTEDYNCEHPDQCDYEINYADQYSTFGVLLNDVY  166



>ref|XP_010547875.1| PREDICTED: aspartic proteinase Asp1 [Tarenaya hassleriana]
Length=425

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP G+Y   ++IG P RPY++D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  43   IVFPVHGNVYPVGYYNVTINIGQPSRPYYLDLDTGSDLTWLQCDAPCVRCVEAPHPLYEP  102

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            ++DL+ C DPLC +LH  GD   E P QCDY+VEYADGGSS GVLV DVFS
Sbjct  103  SSDLITCNDPLCKALHSNGDRIYEKPEQCDYEVEYADGGSSQGVLVRDVFS  153



>ref|XP_010268980.1| PREDICTED: aspartic proteinase Asp1-like [Nelumbo nucifera]
 ref|XP_010268981.1| PREDICTED: aspartic proteinase Asp1-like [Nelumbo nucifera]
Length=457

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP+G Y+  + IG PP+PYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P
Sbjct  58   VVFPVRGNVYPDGLYYVTLFIGQPPKPYFLDIDTGSDLTWLQCDAPCVRCSKVPHPLYRP  117

Query  491  NNDLVICKDPLCASLHV-GDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             N+LV C+DP+CASLH  G+Y C+ PT QCDYD+EYAD GSSLGVL+ D F
Sbjct  118  KNNLVFCQDPICASLHHPGNYRCDRPTDQCDYDIEYADSGSSLGVLLKDEF  168



>ref|XP_007159874.1| hypothetical protein PHAVU_002G275100g [Phaseolus vulgaris]
 gb|ESW31868.1| hypothetical protein PHAVU_002G275100g [Phaseolus vulgaris]
Length=431

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V+PL+GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC HC++ PHPLY+P
Sbjct  57   VVIPLHGNVYPVGFYNVTLNIGQPPRPYFLDVDTGSDLTWLQCDAPCTHCSETPHPLYRP  116

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +ND V CKDPLCASL    DY CE P QCDY++ YAD  S+ GVL+NDV+
Sbjct  117  SNDFVPCKDPLCASLQPSDDYNCEHPDQCDYEINYADQYSTFGVLLNDVY  166



>ref|XP_006380399.1| nucellin family protein [Populus trichocarpa]
 gb|ERP58196.1| nucellin family protein [Populus trichocarpa]
Length=387

 Score =   160 bits (406),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYP GFY   ++IG P +PYF+D DTGSDLTWLQCD P   CT+APHP YKP
Sbjct  14   IVLPLHGNVYPTGFYNVTLNIGQPSKPYFLDVDTGSDLTWLQCDVPRAQCTEAPHPYYKP  73

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +N+LV   DP+C SLH  GD  CE+P QCDY+VEYADGGSSLGVLV D F+
Sbjct  74   SNNLVAWNDPICQSLHTGGDQRCENPGQCDYEVEYADGGSSLGVLVKDAFN  124



>ref|XP_010025731.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62451.1| hypothetical protein EUGRSUZ_H05086 [Eucalyptus grandis]
Length=435

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLPL GNV+P G Y A V +G PP+PYF+DPDTGSDLTWLQCD P  HCT  PHP Y P
Sbjct  58   VVLPLDGNVHPIGSYNATVYVGQPPKPYFLDPDTGSDLTWLQCDVPGAHCTPTPHPRYPP  117

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            + D+V C DP+CASLH GDY C+ P QCDY+VEYADGGSSLG LV DV S
Sbjct  118  SPDIVDCSDPICASLHSGDYRCDHPEQCDYEVEYADGGSSLGALVKDVVS  167



>ref|XP_006432093.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
 ref|XP_006464929.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Citrus sinensis]
 gb|ESR45333.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
Length=408

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  35   LLFQVRGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  94

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +N+LV  +DP+CASLH  G + CE PTQCDY++EYADGGSSLGVLV D F+
Sbjct  95   SNNLVPFEDPICASLHAPGHHNCEDPTQCDYELEYADGGSSLGVLVKDAFA  145



>ref|XP_003602685.1| Aspartic proteinase Asp1 [Medicago truncatula]
Length=440

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  71   VVFPVHGNVYPVGFYNVTINIGYPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  130

Query  491  NNDLVICKDPLCASLHVGD-YTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +NDLV C+ PLCAS+H  D Y CE   QCDY+VEYAD  SSLGVLVNDV+
Sbjct  131  SNDLVPCRHPLCASVHQTDNYECEVEHQCDYEVEYADHYSSLGVLVNDVY  180



>ref|XP_006432092.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
 gb|ESR45332.1| hypothetical protein CICLE_v10001115mg [Citrus clementina]
Length=453

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  80   LLFQVRGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  139

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +N+LV  +DP+CASLH  G + CE PTQCDY++EYADGGSSLGVLV D F+
Sbjct  140  SNNLVPFEDPICASLHAPGHHNCEDPTQCDYELEYADGGSSLGVLVKDAFA  190



>gb|AES72936.2| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=445

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  71   VVFPVHGNVYPVGFYNVTINIGYPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  130

Query  491  NNDLVICKDPLCASLHVGD-YTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +NDLV C+ PLCAS+H  D Y CE   QCDY+VEYAD  SSLGVLVNDV+
Sbjct  131  SNDLVPCRHPLCASVHQTDNYECEVEHQCDYEVEYADHYSSLGVLVNDVY  180



>ref|XP_006464928.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=427

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  54   LLFQVRGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  113

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +N+LV  +DP+CASLH  G + CE PTQCDY++EYADGGSSLGVLV D F+
Sbjct  114  SNNLVPFEDPICASLHAPGHHNCEDPTQCDYELEYADGGSSLGVLVKDAFA  164



>ref|XP_003524315.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN17403.1| Aspartic proteinase Asp1 [Glycine soja]
Length=431

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV PLYGNVYP GFY   ++IG P RPYF+D DTGSDLTWLQCDAPC HC++ PHPL++P
Sbjct  57   IVFPLYGNVYPVGFYNVTLNIGQPARPYFLDVDTGSDLTWLQCDAPCTHCSETPHPLHRP  116

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +ND V C+DPLCASL    DY CE P QCDY++ YAD  S+ GVL+NDV+
Sbjct  117  SNDFVPCRDPLCASLQPTEDYNCEHPDQCDYEINYADQYSTYGVLLNDVY  166



>ref|XP_003522473.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
Length=440

 Score =   158 bits (400),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  65   VVFPVHGNVYPVGFYNVTLNIGQPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  124

Query  491  NNDLVICKDPLCASLHVGD-YTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+  LCASLH+ D Y CE P QCDY+V+YAD  SSLGVL++DV++
Sbjct  125  SNDLVPCRHALCASLHLSDNYDCEVPHQCDYEVQYADHYSSLGVLLHDVYT  175



>ref|XP_006464927.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=459

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++  + GNVYP G+Y   + IG P RPYF+D DTGSDLTWLQCDAPCV C +APHPLY+P
Sbjct  86   LLFQVRGNVYPTGYYNVTMYIGQPARPYFLDLDTGSDLTWLQCDAPCVRCVEAPHPLYRP  145

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +N+LV  +DP+CASLH  G + CE PTQCDY++EYADGGSSLGVLV D F+
Sbjct  146  SNNLVPFEDPICASLHAPGHHNCEDPTQCDYELEYADGGSSLGVLVKDAFA  196



>ref|XP_004502990.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=434

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 88/110 (80%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  60   VVFPVHGNVYPVGFYNVTLNIGQPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  119

Query  491  NNDLVICKDPLCASLHVGD-YTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            +NDLV C+D LCAS+H  D Y CE   QCDY+VEYAD  SSLGVLVND +
Sbjct  120  SNDLVPCRDSLCASVHQTDNYDCEVQHQCDYEVEYADHYSSLGVLVNDAY  169



>ref|XP_011074835.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Sesamum indicum]
Length=372

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 88/112 (79%), Gaps = 3/112 (3%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ PL GNVYP G+Y+  ++IG PP+PYF+D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  35   VIFPLSGNVYPEGYYYVTINIGRPPKPYFLDIDTGSDLTWLQCDAPCKKCTPAPHNLYKP  94

Query  491  NNDLVICKDPLCASLH--VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N +L+ C+DP+C SLH     +TC++P  QCDY+VEYAD GSSLGVLV D F
Sbjct  95   NRNLITCQDPICTSLHGPGKHHTCQTPEEQCDYEVEYADHGSSLGVLVKDSF  146



>ref|XP_011074834.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Sesamum indicum]
Length=403

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 88/112 (79%), Gaps = 3/112 (3%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ PL GNVYP G+Y+  ++IG PP+PYF+D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  35   VIFPLSGNVYPEGYYYVTINIGRPPKPYFLDIDTGSDLTWLQCDAPCKKCTPAPHNLYKP  94

Query  491  NNDLVICKDPLCASLH--VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N +L+ C+DP+C SLH     +TC++P  QCDY+VEYAD GSSLGVLV D F
Sbjct  95   NRNLITCQDPICTSLHGPGKHHTCQTPEEQCDYEVEYADHGSSLGVLVKDSF  146



>ref|XP_003528065.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN09648.1| Aspartic proteinase Asp1 [Glycine soja]
Length=438

 Score =   155 bits (392),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  63   VVFPVHGNVYPVGFYNVTLNIGQPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  122

Query  491  NNDLVICKDPLCASLHVGD-YTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +ND V C+  LCASLH  D Y CE P QCDY+V+YAD  SSLGVL++DV++
Sbjct  123  SNDFVPCRHSLCASLHHSDNYDCEVPHQCDYEVQYADHYSSLGVLLHDVYT  173



>ref|XP_007137749.1| hypothetical protein PHAVU_009G152700g [Phaseolus vulgaris]
 gb|ESW09743.1| hypothetical protein PHAVU_009G152700g [Phaseolus vulgaris]
Length=438

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V  ++GNVYP GFY   ++IG PPRPYF+D DTGSDLTWLQCDAPC  C++ PHPLY+P
Sbjct  63   VVFAVHGNVYPVGFYNVTLNIGQPPRPYFLDIDTGSDLTWLQCDAPCSRCSQTPHPLYRP  122

Query  491  NNDLVICKDPLCASLHVGD-YTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +NDLV C+  LCASLH  D Y CE P QCDY+VEYAD  SSLGVL++DV++
Sbjct  123  SNDLVPCRHALCASLHHTDNYDCEVPHQCDYEVEYADHYSSLGVLLHDVYT  173



>gb|EEE52860.1| hypothetical protein OsJ_35411 [Oryza sativa Japonica Group]
Length=395

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 89/114 (78%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V PLYG+VYP+G Y+  + IGNPPRPYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P 
Sbjct  45   VFPLYGDVYPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPT  104

Query  491  NNDLVICKDPLCASLH---VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C D +CA+LH    G + C+SP  QCDY+++YAD GSSLGVLV D F+
Sbjct  105  KNKLVPCVDQMCAALHGGLTGRHKCDSPKQQCDYEIKYADQGSSLGVLVTDSFA  158



>ref|XP_009355862.1| PREDICTED: aspartic proteinase Asp1-like [Pyrus x bretschneideri]
Length=428

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P++GNVYP G Y   ++IG PP+PYF+DPDTGSDLTWLQCDAPCV CT+APHP Y+P
Sbjct  54   IVFPVHGNVYPTGSYNVTLNIGQPPKPYFLDPDTGSDLTWLQCDAPCVSCTQAPHPYYRP  113

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            + DLV CKDPLC +LH  G + C+ P +C  +VEYADGG  LGVLV D FS
Sbjct  114  SKDLVACKDPLCEALHSPGSHKCDVPERC--EVEYADGGKFLGVLVRDSFS  162



>ref|NP_001066301.1| Os12g0177500 [Oryza sativa Japonica Group]
 gb|ABA96613.2| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29320.1| Os12g0177500 [Oryza sativa Japonica Group]
 dbj|BAG89196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=421

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 89/114 (78%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V PLYG+VYP+G Y+  + IGNPPRPYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P 
Sbjct  45   VFPLYGDVYPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPT  104

Query  491  NNDLVICKDPLCASLH---VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C D +CA+LH    G + C+SP  QCDY+++YAD GSSLGVLV D F+
Sbjct  105  KNKLVPCVDQMCAALHGGLTGRHKCDSPKQQCDYEIKYADQGSSLGVLVTDSFA  158



>gb|EEC68949.1| hypothetical protein OsI_37668 [Oryza sativa Indica Group]
Length=421

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 89/114 (78%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V PLYG+VYP+G Y+  + IGNPPRPYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P 
Sbjct  45   VFPLYGDVYPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPT  104

Query  491  NNDLVICKDPLCASLH---VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C D +CA+LH    G + C+SP  QCDY+++YAD GSSLGVLV D F+
Sbjct  105  KNKLVPCVDQMCAALHGGLTGRHKCDSPKQQCDYEIKYADQGSSLGVLVTDSFA  158



>ref|XP_009611015.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
 ref|XP_009611017.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana tomentosiformis]
Length=417

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPC  C  APH LYKP
Sbjct  48   LVFPLAGNVYPKGYYQVTINVGQPPKPYFLDIDTGSDLTWLQCDAPCAKCAPAPHSLYKP  107

Query  491  NNDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N ++V CKDP+CASLH+  ++ C +P  QCDY+VEYAD GSSLGVLV D F
Sbjct  108  NKNIVKCKDPVCASLHLPANHHCHTPDEQCDYEVEYADHGSSLGVLVKDAF  158



>ref|XP_009802241.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802242.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802243.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
 ref|XP_009802244.1| PREDICTED: aspartic proteinase Asp1 [Nicotiana sylvestris]
Length=417

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  48   LVFPLAGNVYPKGYYQVTLNVGQPPKPYFLDIDTGSDLTWLQCDAPCAKCTPAPHSLYKP  107

Query  491  NNDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N ++V CKDP+CASLH+  +  C +P  QCDY+VEYAD GSSLGVLV D F
Sbjct  108  NKNIVKCKDPVCASLHLTANNHCHTPDEQCDYEVEYADHGSSLGVLVKDAF  158



>ref|XP_010243511.1| PREDICTED: aspartic proteinase Asp1 [Nelumbo nucifera]
Length=460

 Score =   153 bits (387),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+ GNVYP G Y+  + IG  P+PY++D DTGSDLTWLQCDAPCV C++ PHPLY+P
Sbjct  58   VVFPVRGNVYPEGLYYVTLYIGQQPKPYYLDIDTGSDLTWLQCDAPCVSCSQVPHPLYRP  117

Query  491  NNDLVICKDPLCASL-HVGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             N+LV C+DP+CAS+ H G++ CE P  QCDYD+EYAD GSSLGVLV D F
Sbjct  118  KNNLVYCQDPICASVNHPGNHKCERPKDQCDYDIEYADHGSSLGVLVKDEF  168



>emb|CDP10935.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 84/110 (76%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y   V+IG PP+PYF+D DTGSDLTWLQCDAPC  CT APH  YKP
Sbjct  49   VIFPVSGNVYPKGYYQVTVNIGQPPKPYFLDIDTGSDLTWLQCDAPCAKCTPAPHSPYKP  108

Query  491  NNDLVICKDPLCASLH-VGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            N +LV CKDPLC SL+    + CES  QCDY VEYAD GSSLGVLV D+F
Sbjct  109  NKNLVTCKDPLCVSLYWPTSHQCESLDQCDYQVEYADRGSSLGVLVQDLF  158



>gb|ABA96612.2| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
Length=451

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 89/114 (78%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V PLYG+VYP+G Y+  + IGNPPRPYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P 
Sbjct  45   VFPLYGDVYPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPT  104

Query  491  NNDLVICKDPLCASLH---VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C D +CA+LH    G + C+SP  QCDY+++YAD GSSLGVLV D F+
Sbjct  105  KNKLVPCVDQMCAALHGGLTGRHKCDSPKQQCDYEIKYADQGSSLGVLVTDSFA  158



>ref|XP_004977227.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Setaria 
italica]
Length=422

 Score =   152 bits (385),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 88/114 (77%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            + PLYG+VYP+G Y+  ++IGNP RPYF+D DTGSDLTWLQCDAPCV C K PHPLY+P 
Sbjct  45   IFPLYGDVYPHGLYYVSMNIGNPSRPYFLDVDTGSDLTWLQCDAPCVSCNKVPHPLYRPI  104

Query  491  NNDLVICKDPLCASLH---VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C D LCASLH    G + C+SP  QCDY++ YAD GSS+GVLVND F+
Sbjct  105  KNKLVPCVDQLCASLHGGLSGRHKCDSPHQQCDYEIRYADQGSSIGVLVNDSFA  158



>gb|EYU31770.1| hypothetical protein MIMGU_mgv1a006482mg [Erythranthe guttata]
Length=410

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y   + IG PP+PYF D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  41   VIFPVSGNVYPKGYYHVSISIGEPPKPYFFDIDTGSDLTWLQCDAPCTKCTPAPHSLYKP  100

Query  491  NNDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
              +L+ C+DP+CASLH  G++ C SP  QCDY V+YAD GSSLGV+V D F
Sbjct  101  KQNLITCQDPICASLHEPGNHDCRSPHDQCDYQVDYADNGSSLGVMVKDSF  151



>ref|XP_010930726.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=429

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 90/113 (80%), Gaps = 4/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYK-P  490
            V P+YG+VYP+G Y+A ++IGNPP+PYF+D DTGSD+TWLQCDAPC  C+K PHPLY+ P
Sbjct  57   VFPVYGDVYPHGIYYATMNIGNPPKPYFMDVDTGSDITWLQCDAPCQRCSKVPHPLYQPP  116

Query  491  NNDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N L+ C++PLC ++H      +TCESP QCDY+V+YAD GSS+GVLV D  +
Sbjct  117  KNRLIPCENPLCYAVHASTHQKHTCESPNQCDYEVQYADHGSSMGVLVADTLA  169



>ref|XP_009420564.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=433

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 88/111 (79%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+YG+VYP+G Y+  + IG+PP+PYF+D DTGSDLTWLQCDAPCV C+K PHP Y+P
Sbjct  59   VVFPIYGDVYPHGLYYVAMSIGDPPKPYFLDIDTGSDLTWLQCDAPCVRCSKGPHPWYRP  118

Query  491  -NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
              N LV C+DPLCA+LHVG    E+  QCDY ++Y D GSSLGVL++D F+
Sbjct  119  TRNKLVPCRDPLCAALHVGTIHDENCDQCDYQIQYEDRGSSLGVLISDAFN  169



>gb|EYU31771.1| hypothetical protein MIMGU_mgv1a006482mg [Erythranthe guttata]
Length=442

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y   + IG PP+PYF D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  41   VIFPVSGNVYPKGYYHVSISIGEPPKPYFFDIDTGSDLTWLQCDAPCTKCTPAPHSLYKP  100

Query  491  NNDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
              +L+ C+DP+CASLH  G++ C SP  QCDY V+YAD GSSLGV+V D F
Sbjct  101  KQNLITCQDPICASLHEPGNHDCRSPHDQCDYQVDYADNGSSLGVMVKDSF  151



>ref|XP_009393816.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 1/110 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P++G+VYP G Y+ +++IGNPP+PYF+D DTGSDLTW+QCDAPCV C+K PHP Y+P 
Sbjct  46   VFPIHGDVYPRGLYYVEMNIGNPPKPYFLDVDTGSDLTWIQCDAPCVRCSKGPHPWYRPK  105

Query  494  N-DLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
              +LV C++P CA+LH G    ++  QCDY++EYAD GSSLGVLV D FS
Sbjct  106  RTNLVPCRNPFCAALHSGTAQDQNCGQCDYEIEYADSGSSLGVLVADAFS  155



>ref|XP_004977226.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Setaria 
italica]
Length=451

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 88/114 (77%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            + PLYG+VYP+G Y+  ++IGNP RPYF+D DTGSDLTWLQCDAPCV C K PHPLY+P 
Sbjct  45   IFPLYGDVYPHGLYYVSMNIGNPSRPYFLDVDTGSDLTWLQCDAPCVSCNKVPHPLYRPI  104

Query  491  NNDLVICKDPLCASLH---VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C D LCASLH    G + C+SP  QCDY++ YAD GSS+GVLVND F+
Sbjct  105  KNKLVPCVDQLCASLHGGLSGRHKCDSPHQQCDYEIRYADQGSSIGVLVNDSFA  158



>ref|XP_011069472.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Sesamum indicum]
Length=408

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  39   VIFPVSGNVYPKGYYHVTINVGQPPKPYFLDIDTGSDLTWLQCDAPCTKCTPAPHSLYKP  98

Query  491  NNDLVICKDPLCASLHV-GDYTCE-SPTQCDYDVEYADGGSSLGVLVNDVF  637
              +L++C+DPLCASLH  G + C  S  QCDY+V+YAD GSSLGVLV D F
Sbjct  99   KRNLIMCQDPLCASLHGPGIHDCHASQEQCDYEVDYADHGSSLGVLVKDSF  149



>ref|XP_011069464.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Sesamum indicum]
Length=440

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++ P+ GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  39   VIFPVSGNVYPKGYYHVTINVGQPPKPYFLDIDTGSDLTWLQCDAPCTKCTPAPHSLYKP  98

Query  491  NNDLVICKDPLCASLHV-GDYTCE-SPTQCDYDVEYADGGSSLGVLVNDVF  637
              +L++C+DPLCASLH  G + C  S  QCDY+V+YAD GSSLGVLV D F
Sbjct  99   KRNLIMCQDPLCASLHGPGIHDCHASQEQCDYEVDYADHGSSLGVLVKDSF  149



>ref|XP_002441914.1| hypothetical protein SORBIDRAFT_08g004800 [Sorghum bicolor]
 gb|EES15752.1| hypothetical protein SORBIDRAFT_08g004800 [Sorghum bicolor]
Length=429

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  53   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDTGSDLTWLQCDAPCRSCNKVPHPLYRPT  112

Query  491  NNDLVICKDPLCASLHVG---DYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C D LCASLH G    + C+SP  QCDY ++YAD GSS GVLVND F+
Sbjct  113  KNKLVPCVDQLCASLHNGLNRKHKCDSPYEQCDYVIKYADQGSSTGVLVNDSFA  166



>ref|XP_010238658.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=451

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V  LYG+VYP+G Y+  + IGNPPRPYF+D DTGSDLTWLQCDAPCV C K PHPLY+P 
Sbjct  45   VFQLYGDVYPHGLYYVAMSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCNKVPHPLYRPT  104

Query  491  NNDLVICKDPLCASLH---VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
             N +V C D LC+SLH    G + C+SP  QCDY+++YAD GSSLGVL+ D F+
Sbjct  105  KNKIVPCVDQLCSSLHGGLSGKHKCDSPKQQCDYEIKYADQGSSLGVLLTDSFA  158



>ref|XP_010664194.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Vitis vinifera]
Length=423

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 85/112 (76%), Gaps = 2/112 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP GFY   + IGNPP+PY +D D+GSDLTWLQCDAPCV CTKAPHP YKP
Sbjct  54   VVFPLQGNVYPQGFYSVSLRIGNPPKPYTLDIDSGSDLTWLQCDAPCVSCTKAPHPPYKP  113

Query  491  NNDLVICKDPLCASLH-VGDYTCE-SPTQCDYDVEYADGGSSLGVLVNDVFS  640
            N   + C DP+C++LH      C+ S  QCDY+V YAD GSSLGVLV+D+FS
Sbjct  114  NKGPITCNDPMCSALHWPSKPPCKASHEQCDYEVSYADHGSSLGVLVHDIFS  165



>emb|CBI18999.3| unnamed protein product [Vitis vinifera]
Length=390

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 85/112 (76%), Gaps = 2/112 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP GFY   + IGNPP+PY +D D+GSDLTWLQCDAPCV CTKAPHP YKP
Sbjct  21   VVFPLQGNVYPQGFYSVSLRIGNPPKPYTLDIDSGSDLTWLQCDAPCVSCTKAPHPPYKP  80

Query  491  NNDLVICKDPLCASLH-VGDYTCE-SPTQCDYDVEYADGGSSLGVLVNDVFS  640
            N   + C DP+C++LH      C+ S  QCDY+V YAD GSSLGVLV+D+FS
Sbjct  81   NKGPITCNDPMCSALHWPSKPPCKASHEQCDYEVSYADHGSSLGVLVHDIFS  132



>ref|XP_002285867.2| PREDICTED: aspartic proteinase Asp1 isoform X1 [Vitis vinifera]
Length=453

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 85/112 (76%), Gaps = 2/112 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP GFY   + IGNPP+PY +D D+GSDLTWLQCDAPCV CTKAPHP YKP
Sbjct  54   VVFPLQGNVYPQGFYSVSLRIGNPPKPYTLDIDSGSDLTWLQCDAPCVSCTKAPHPPYKP  113

Query  491  NNDLVICKDPLCASLH-VGDYTCE-SPTQCDYDVEYADGGSSLGVLVNDVFS  640
            N   + C DP+C++LH      C+ S  QCDY+V YAD GSSLGVLV+D+FS
Sbjct  114  NKGPITCNDPMCSALHWPSKPPCKASHEQCDYEVSYADHGSSLGVLVHDIFS  165



>ref|XP_009596730.1| PREDICTED: aspartic proteinase Asp1-like [Nicotiana tomentosiformis]
Length=455

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV PL GNVYP G+Y   +++G PP+PY +D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  49   IVFPLAGNVYPKGYYQVTLEVGQPPKPYSLDIDTGSDLTWLQCDAPCAKCTPAPHSLYKP  108

Query  491  NNDLVICKDPLCASLH-VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N ++V CKDP+C SLH   ++ C  P  QCDY+V YAD GSSLGVLV D F
Sbjct  109  NENVVTCKDPVCTSLHWPENHPCHGPDEQCDYEVAYADRGSSLGVLVKDAF  159



>ref|XP_006365534.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=441

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   +++G PP+PYF D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  36   LVFPLAGNVYPIGYYQVTLEVGQPPKPYFFDIDTGSDLTWLQCDAPCAKCTPAPHHLYKP  95

Query  491  NNDLVICKDPLCASLH-VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            + ++V CKDP+C SLH   ++ C  P  QCDY+V YAD GSSLGVLV D F
Sbjct  96   HRNVVTCKDPVCTSLHWPENHPCHDPNEQCDYEVAYADSGSSLGVLVKDTF  146



>ref|XP_009758779.1| PREDICTED: aspartic proteinase Asp1-like [Nicotiana sylvestris]
Length=455

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
             V PL GNVYP G+Y   +++G PP+PY +D DTGSDLTWLQCDAPC  CT APH LYKP
Sbjct  49   FVFPLAGNVYPKGYYQVTLEVGQPPKPYSLDIDTGSDLTWLQCDAPCAKCTPAPHSLYKP  108

Query  491  NNDLVICKDPLCASLH-VGDYTCES-PTQCDYDVEYADGGSSLGVLVNDVF  637
            N ++V+CKDPLC SLH   ++ C     QCDY+V YAD GSSLGVLV D+F
Sbjct  109  NKNVVMCKDPLCTSLHWPKNHPCHGLDEQCDYEVAYADRGSSLGVLVKDMF  159



>ref|NP_001152116.1| aspartic proteinase Asp1 precursor [Zea mays]
 gb|ACG45850.1| aspartic proteinase Asp1 precursor [Zea mays]
Length=432

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 86/115 (75%), Gaps = 6/115 (5%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D D+GSDLTWLQCDAPC  C + PHPLY+P 
Sbjct  51   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDSGSDLTWLQCDAPCRSCNEVPHPLYRPT  110

Query  491  NNDLVICKDPLCASLH----VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS  640
             + LV C   LCASLH     G + CESP  QCDY ++YAD GSS GVLVND F+
Sbjct  111  KSKLVPCVHRLCASLHNALTGGKHRCESPHEQCDYVIKYADQGSSTGVLVNDSFA  165



>ref|XP_009404862.1| PREDICTED: aspartic proteinase Asp1-like [Musa acuminata subsp. 
malaccensis]
Length=452

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 85/111 (77%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V P+YG+VYP+G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPCV C+K PHP Y+P
Sbjct  62   VVFPIYGDVYPHGLYYVVMNIGDPSKPYFLDVDTGSDLTWLQCDAPCVSCSKGPHPWYRP  121

Query  491  -NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
              + LV   DPLCA+LH G    E+  QCDY+++Y D GSSLGVL+ D FS
Sbjct  122  KKSKLVPSGDPLCAALHSGIAQGENSGQCDYEIQYEDRGSSLGVLLYDAFS  172



>gb|AFW56223.1| hypothetical protein ZEAMMB73_420944 [Zea mays]
Length=383

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D D+GSDLTWLQCDAPC  C + PHPLY+P 
Sbjct  53   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDSGSDLTWLQCDAPCRSCNEVPHPLYRPT  112

Query  491  NNDLVICKDPLCASLH---VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS  640
             + LV C   LCASLH    G + C+SP  QCDY ++YAD GSS GVL+ND F+
Sbjct  113  KSKLVPCVHRLCASLHNGLTGKHRCDSPHEQCDYVIKYADQGSSTGVLINDSFA  166



>gb|EPS72688.1| hypothetical protein M569_02067 [Genlisea aurea]
Length=404

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 82/109 (75%), Gaps = 2/109 (2%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
             P+ GN YPNG+Y+  ++IG P +PYF+D DTGSD+TWLQCDAPC  C  APHP YKP+ 
Sbjct  37   FPISGNAYPNGYYYVAINIGQPAKPYFLDIDTGSDITWLQCDAPCAKCQPAPHPPYKPSK  96

Query  497  DLVICKDPLCASLH-VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             +++C+DP+C SL   G+  C++P  QCDY+V YAD GSSLGVL+ D F
Sbjct  97   SIILCQDPICTSLQGSGNLLCKAPKEQCDYEVSYADSGSSLGVLLKDYF  145



>ref|XP_008460824.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Cucumis melo]
Length=391

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +2

Query  380  PPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCASLHVG-DYTC  556
            PP+PYF+DPDTGSDLTWLQCDAPC  CT+  HPLY+P+NDLV CKDPLC SLH   D+ C
Sbjct  35   PPKPYFLDPDTGSDLTWLQCDAPCQQCTETLHPLYQPSNDLVPCKDPLCMSLHSSMDHRC  94

Query  557  ESPTQCDYDVEYADGGSSLGVLVNDVF  637
            E+P QCDY+VEYADGGSSLGVLV DVF
Sbjct  95   ENPDQCDYEVEYADGGSSLGVLVRDVF  121



>ref|XP_004242040.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Solanum lycopersicum]
Length=441

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 82/111 (74%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   +++G PP+PYF D DTGSDLTWLQCDAPC  C+ APH LYKP
Sbjct  36   LVFPLAGNVYPVGYYQVTLEVGRPPKPYFFDIDTGSDLTWLQCDAPCAKCSPAPHNLYKP  95

Query  491  NNDLVICKDPLCASLH-VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            + ++V CKDP+C SLH    + C  P  QCDY+V YAD GSSLGVLV D F
Sbjct  96   HRNVVTCKDPVCTSLHWPESHPCHDPNEQCDYEVAYADSGSSLGVLVKDTF  146



>gb|KGN62238.1| hypothetical protein Csa_2G338820 [Cucumis sativus]
Length=387

 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +2

Query  380  PPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCASLHVG-DYTC  556
            PP+PYF+DPDTGSDLTWLQCDAPC  CT+  HPLY+P+NDLV CKDPLC SLH   D+ C
Sbjct  35   PPKPYFLDPDTGSDLTWLQCDAPCQQCTETLHPLYQPSNDLVPCKDPLCMSLHSSMDHRC  94

Query  557  ESPTQCDYDVEYADGGSSLGVLVNDVF  637
            E+P QCDY+VEYADGGSSLGVLV DVF
Sbjct  95   ENPDQCDYEVEYADGGSSLGVLVRDVF  121



>ref|NP_001131929.1| uncharacterized protein LOC100193320 precursor [Zea mays]
 gb|ACF80557.1| unknown [Zea mays]
Length=424

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D D+GSDLTWLQCDAPC  C + PHPLY+P 
Sbjct  44   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDSGSDLTWLQCDAPCRSCNEVPHPLYRPT  103

Query  491  NNDLVICKDPLCASLH---VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS  640
             + LV C   LCASLH    G + C+SP  QCDY ++YAD GSS GVL+ND F+
Sbjct  104  KSKLVPCVHRLCASLHNGLTGKHRCDSPHEQCDYVIKYADQGSSTGVLINDSFA  157



>gb|ACR34528.1| unknown [Zea mays]
 gb|AFW56222.1| aspartic proteinase Asp1 [Zea mays]
Length=433

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D D+GSDLTWLQCDAPC  C + PHPLY+P 
Sbjct  53   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDSGSDLTWLQCDAPCRSCNEVPHPLYRPT  112

Query  491  NNDLVICKDPLCASLH---VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS  640
             + LV C   LCASLH    G + C+SP  QCDY ++YAD GSS GVL+ND F+
Sbjct  113  KSKLVPCVHRLCASLHNGLTGKHRCDSPHEQCDYVIKYADQGSSTGVLINDSFA  166



>gb|ACR35418.1| unknown [Zea mays]
Length=205

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  77   LLPIKGNVFPDGQYYTSIFIGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPA  136

Query  494  NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
             + ++  +D LC  L      CE+  QCDY++EYAD  SS+GVL  D
Sbjct  137  KEKIVPPRDLLCQELQGNQNYCETCKQCDYEIEYADQSSSMGVLARD  183



>ref|XP_008661408.1| PREDICTED: uncharacterized protein LOC100193320 isoform X1 [Zea 
mays]
Length=471

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V PLYG+VYP+G Y+  ++IGNPP+PYF+D D+GSDLTWLQCDAPC  C + PHPLY+P 
Sbjct  53   VFPLYGDVYPHGLYYVAMNIGNPPKPYFLDVDSGSDLTWLQCDAPCRSCNEVPHPLYRPT  112

Query  491  NNDLVICKDPLCASLH---VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS  640
             + LV C   LCASLH    G + C+SP  QCDY ++YAD GSS GVL+ND F+
Sbjct  113  KSKLVPCVHRLCASLHNGLTGKHRCDSPHEQCDYVIKYADQGSSTGVLINDSFA  166



>ref|XP_002449121.1| hypothetical protein SORBIDRAFT_05g005400 [Sorghum bicolor]
 gb|EES08109.1| hypothetical protein SORBIDRAFT_05g005400 [Sorghum bicolor]
Length=358

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +  L GNVYP G Y+  ++IGNP +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  41   IFQLQGNVYPTGHYYVTMNIGNPAKPYFLDVDTGSDLTWLQCDAPCRSCNKVPHPLYRPT  100

Query  494  -NDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C + LC +LH G   +  C SP QCDY ++Y D  SS GVL+ND FS
Sbjct  101  ANSLVPCANALCTALHSGHGSNNKCPSPKQCDYQIKYTDSASSQGVLINDNFS  153



>ref|XP_008781591.1| PREDICTED: aspartic proteinase Asp1-like [Phoenix dactylifera]
Length=461

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 84/112 (75%), Gaps = 4/112 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYK-P  490
            V  L GNVYPNG Y+  ++IGNPP+PY++D DTGSD+TWLQCDAPC  C+K PHPLYK P
Sbjct  59   VFRLRGNVYPNGAYYTTMNIGNPPKPYYMDVDTGSDITWLQCDAPCQRCSKVPHPLYKPP  118

Query  491  NNDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
             + LV C++ LC ++H      + CESP QCDY+V+YAD GSS+GVLV D  
Sbjct  119  KSSLVPCENALCYAVHASIHQKHKCESPWQCDYEVQYADHGSSIGVLVADTL  170



>ref|XP_004240544.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Solanum lycopersicum]
Length=418

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL+GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPCV C  APH  YKP
Sbjct  46   VVFPLFGNVYPKGYYQVTLNVGQPPKPYFLDIDTGSDLTWLQCDAPCVKCIPAPHSPYKP  105

Query  491  NNDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N +++  KDP+CASLH   ++   SP  QCDY+VEYAD  SSLGVLV D F
Sbjct  106  NKNVIKHKDPICASLHSPANHPRYSPDDQCDYEVEYADHCSSLGVLVRDAF  156



>ref|XP_004240543.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Solanum lycopersicum]
Length=426

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL+GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPCV C  APH  YKP
Sbjct  46   VVFPLFGNVYPKGYYQVTLNVGQPPKPYFLDIDTGSDLTWLQCDAPCVKCIPAPHSPYKP  105

Query  491  NNDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N +++  KDP+CASLH   ++   SP  QCDY+VEYAD  SSLGVLV D F
Sbjct  106  NKNVIKHKDPICASLHSPANHPRYSPDDQCDYEVEYADHCSSLGVLVRDAF  156



>ref|XP_008669793.1| PREDICTED: aspartic proteinase Asp1 [Zea mays]
 gb|ACL53484.1| unknown [Zea mays]
 gb|ACL54629.1| unknown [Zea mays]
 tpg|DAA38945.1| TPA: nucellin-like aspartic protease [Zea mays]
Length=415

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G+VYP G Y+  ++IGNP +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  40   VFQLQGDVYPTGHYYVTMNIGNPAKPYFLDVDTGSDLTWLQCDAPCRSCNKVPHPLYRPT  99

Query  494  -NDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C + LC +LH G   +  C SP QCDY ++Y D  SS GVL+ND FS
Sbjct  100  ANRLVPCANALCTALHSGQGSNNKCPSPKQCDYQIKYTDSASSQGVLINDSFS  152



>gb|ACG42043.1| aspartic proteinase Asp1 precursor [Zea mays]
Length=415

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L G+VYP G Y+  ++IGNP +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  40   VFQLQGDVYPTGHYYVTMNIGNPAKPYFLDVDTGSDLTWLQCDAPCRSCNKVPHPLYRPT  99

Query  494  -NDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C + LC +LH G   +  C SP QCDY ++Y D  SS GVL+ND FS
Sbjct  100  ANRLVPCANALCTALHSGQGSNNKCPSPKQCDYQIKYTDSASSQGVLINDSFS  152



>ref|XP_002520345.1| nucellin, putative [Ricinus communis]
 gb|EEF42131.1| nucellin, putative [Ricinus communis]
Length=424

 Score =   139 bits (350),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLP++GNVYP G+Y   + IGNPP+ + +D DTGSDLTW+QCDAPC  CTK  H LYKP
Sbjct  53   LVLPVFGNVYPLGYYSVSLYIGNPPKLFELDIDTGSDLTWVQCDAPCTGCTKPLHHLYKP  112

Query  491  NNDLVICKDPLCASLH-VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             N+L+ C DPLC+++   G Y C+S T QCDY+++YAD GSSLGVLV D F
Sbjct  113  RNNLLSCIDPLCSAVQNSGTYQCQSATDQCDYEIQYADEGSSLGVLVTDYF  163



>ref|XP_006355804.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Solanum 
tuberosum]
Length=418

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   +++G PP+PYF+D DTGSDLTWLQCDAPCV C  APH  YKP
Sbjct  46   VVFPLVGNVYPKGYYQVTLNVGQPPKPYFLDIDTGSDLTWLQCDAPCVKCIPAPHSPYKP  105

Query  491  NNDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N ++V  KDP+CASLH   ++   +P  QCDY+VEYAD  SSLGVLV D F
Sbjct  106  NKNVVKHKDPICASLHSPANHPRHTPDDQCDYEVEYADHCSSLGVLVRDAF  156



>ref|XP_010025733.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
 gb|KCW62452.1| hypothetical protein EUGRSUZ_H05087 [Eucalyptus grandis]
Length=434

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 78/109 (72%), Gaps = 0/109 (0%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLPL+GNVYP G Y   V IG PP+PYF+DPDTGSDLTWLQC+APCV CT  PHPLY P
Sbjct  60   VVLPLHGNVYPTGSYNVTVYIGQPPKPYFLDPDTGSDLTWLQCNAPCVRCTPTPHPLYPP  119

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            ++DLV   D +C SL   +   +   +C Y ++YADGGS+ G LV DV 
Sbjct  120  SDDLVDSSDQICRSLQPSNNKSDRLKRCSYGIQYADGGSTRGFLVKDVI  168



>ref|XP_010063407.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Eucalyptus grandis]
 ref|XP_010063408.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Eucalyptus grandis]
 gb|KCW70627.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
 gb|KCW70628.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
Length=418

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
             VLPL GNVYP G+Y   + IG+P + + +D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  47   FVLPLSGNVYPLGYYSVSLSIGHPAKAFDLDIDTGSDLTWVQCDAPCTACTKPLDSLYKP  106

Query  491  NNDLVICKDPLCASLHV-GDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
            NN+L+ C++PLCA+++  G+  C++P+ QCDY+VEYAD GSS GVLVND FS
Sbjct  107  NNNLMHCENPLCAAINTSGNQPCKTPSDQCDYEVEYADQGSSFGVLVNDYFS  158



>ref|XP_010063406.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Eucalyptus grandis]
 gb|KCW70626.1| hypothetical protein EUGRSUZ_F03801 [Eucalyptus grandis]
Length=438

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 86/112 (77%), Gaps = 2/112 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
             VLPL GNVYP G+Y   + IG+P + + +D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  47   FVLPLSGNVYPLGYYSVSLSIGHPAKAFDLDIDTGSDLTWVQCDAPCTACTKPLDSLYKP  106

Query  491  NNDLVICKDPLCASLHV-GDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
            NN+L+ C++PLCA+++  G+  C++P+ QCDY+VEYAD GSS GVLVND FS
Sbjct  107  NNNLMHCENPLCAAINTSGNQPCKTPSDQCDYEVEYADQGSSFGVLVNDYFS  158



>ref|XP_010930728.1| PREDICTED: aspartic proteinase Asp1-like [Elaeis guineensis]
Length=429

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PL G+VYPN  ++A ++IGNPP+PYF+  DTGSD+TWLQCDAPC  C+K PHPLYKP 
Sbjct  57   VFPLSGDVYPNEVFYATMNIGNPPKPYFMHVDTGSDITWLQCDAPCQKCSKVPHPLYKPK  116

Query  494  NDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
              L+ C++ LC ++H      + C++P QCDY+V+YAD GSS GVLV D  +
Sbjct  117  R-LIPCENALCYAVHASTHQKHECQTPNQCDYEVQYADHGSSAGVLVFDTLA  167



>ref|XP_011458802.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Fragaria vesca 
subsp. vesca]
 ref|XP_011458803.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PL GNVYP G+Y   + IGNP + + +D DTGSDLTW+QCDAPC  CTK    LYKP 
Sbjct  46   VFPLQGNVYPLGYYSVSLSIGNPGKRFDLDIDTGSDLTWVQCDAPCTGCTKPREHLYKPK  105

Query  494  NDLVICKDPLCASLHV-GDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            N+LV C+DPLC++ H+   Y C +P+ QCDY+VEYAD GSSLGVLV D F
Sbjct  106  NNLVQCEDPLCSAFHLPASYPCNTPSDQCDYEVEYADQGSSLGVLVKDYF  155



>ref|XP_004290889.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=446

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PL GNVYP G+Y   + IGNP + + +D DTGSDLTW+QCDAPC  CTK    LYKP 
Sbjct  46   VFPLQGNVYPLGYYSVSLSIGNPGKRFDLDIDTGSDLTWVQCDAPCTGCTKPREHLYKPK  105

Query  494  NDLVICKDPLCASLHV-GDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            N+LV C+DPLC++ H+   Y C +P+ QCDY+VEYAD GSSLGVLV D F
Sbjct  106  NNLVQCEDPLCSAFHLPASYPCNTPSDQCDYEVEYADQGSSLGVLVKDYF  155



>gb|ACN34727.1| unknown [Zea mays]
 gb|AFW63800.1| hypothetical protein ZEAMMB73_012138 [Zea mays]
Length=557

 Score =   136 bits (343),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  174  LLPIKGNVFPDGQYYTSIFIGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPA  233

Query  494  NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
             + ++  +D LC  L      CE+  QCDY++EYAD  SS+GVL  D
Sbjct  234  KEKIVPPRDLLCQELQGNQNYCETCKQCDYEIEYADQSSSMGVLARD  280



>dbj|BAJ86250.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP
Sbjct  177  VLLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKP  236

Query  491  NNDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              + ++  +D LC  L      CE+  QCDY++EYAD  SS+GVL  D
Sbjct  237  AKEKIVPPRDSLCQELQGDQNYCETCKQCDYEIEYADRSSSMGVLAKD  284



>ref|NP_001048015.1| Os02g0730700 [Oryza sativa Japonica Group]
 dbj|BAD15929.1| putative nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 dbj|BAD16368.1| putative nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 dbj|BAF09929.1| Os02g0730700 [Oryza sativa Japonica Group]
 dbj|BAG91015.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57744.1| hypothetical protein OsJ_08261 [Oryza sativa Japonica Group]
Length=573

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  190  LLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPA  249

Query  494  NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
             + ++  KD LC  L      CE+  QCDY++EYAD  SS+GVL  D
Sbjct  250  KEKIVPPKDLLCQELQGNQNYCETCKQCDYEIEYADRSSSMGVLARD  296



>gb|EEC73939.1| hypothetical protein OsI_08807 [Oryza sativa Indica Group]
Length=574

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  191  LLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPA  250

Query  494  NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
             + ++  KD LC  L      CE+  QCDY++EYAD  SS+GVL  D
Sbjct  251  KEKIVPPKDLLCQELQGNQNYCETCKQCDYEIEYADRSSSMGVLARD  297



>ref|XP_002452609.1| hypothetical protein SORBIDRAFT_04g028990 [Sorghum bicolor]
 gb|EES05585.1| hypothetical protein SORBIDRAFT_04g028990 [Sorghum bicolor]
Length=557

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 78/107 (73%), Gaps = 1/107 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  174  LLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPT  233

Query  494  NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
             + ++  +D LC  L      CE+  QCDY++EYAD  SS+GVL  D
Sbjct  234  KEKIVPPRDLLCQELQGNQNYCETCKQCDYEIEYADQSSSMGVLARD  280



>ref|XP_011022860.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=429

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IVLPL+GNVYP GFY   ++IG P +PYF+D DTGSDLT+LQCD P   CT+APHP YKP
Sbjct  56   IVLPLHGNVYPIGFYNVTLNIGQPSKPYFLDVDTGSDLTYLQCDTPRSQCTEAPHPYYKP  115

Query  491  NNDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            +N+LV   DP+C  L    D   E+P  C Y+V YADGGSS G+LV D F+
Sbjct  116  SNNLVAWSDPICQYLRTSSDKGGENPGPCYYEVVYADGGSSFGILVKDAFN  166



>gb|EMT28382.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=473

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C + PHPLYKP
Sbjct  95   VLLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAQGPHPLYKP  154

Query  491  NNDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              + ++  +D LC  L      CE+  QCDY++EYAD  SS+GVL  D
Sbjct  155  AKEKIVPPRDLLCQELQGDQNYCETCKQCDYEIEYADRSSSMGVLAKD  202



>gb|EMT17344.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=191

 Score =   128 bits (322),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 76/97 (78%), Gaps = 5/97 (5%)
 Frame = +2

Query  365  VDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-NNDLVICKDPLCASLHV  541
            + IGNP +PYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P  N LV C D LC SLH 
Sbjct  1    MSIGNPAKPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPTKNKLVPCVDQLCTSLHG  60

Query  542  G---DYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
            G   ++ C+SP  QCDY+V+YAD GSSLGVLVND F+
Sbjct  61   GLSKNHKCDSPKQQCDYEVKYADQGSSLGVLVNDSFA  97



>gb|EEC67807.1| hypothetical protein OsI_35373 [Oryza sativa Indica Group]
Length=418

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 78/113 (69%), Gaps = 4/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V  L G+VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  44   VFLLSGDVYPTGHYYVTMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCNKVPHPLYRPT  103

Query  491  NNDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C + +C +LH G   +  C +  QCDY ++Y D  SSLGVLV D FS
Sbjct  104  KNKLVPCANSICTALHSGSSPNKKCTTQQQCDYQIKYTDKASSLGVLVTDSFS  156



>ref|XP_004953813.1| PREDICTED: aspartic proteinase Asp1-like [Setaria italica]
Length=473

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C   PHPLYKP 
Sbjct  119  LLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCANGPHPLYKPT  178

Query  494  NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
             + ++  +D LC  L      CE+  QCDY++EYAD  SS+GVL  D
Sbjct  179  KEKIVPPRDLLCQELQGEQNYCETCKQCDYEIEYADQSSSMGVLARD  225



>ref|XP_010025732.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
Length=436

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLPL GNV+P G Y   + IG PP+PY++DPDT SDLTWLQCDAPCV CT+ PHPLY P
Sbjct  61   VVLPLDGNVFPIGSYNTTIYIGQPPKPYYLDPDTDSDLTWLQCDAPCVRCTRTPHPLYPP  120

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
            +++LV   DP+C SL  GD       +C Y+V+YADGGSS G LV D
Sbjct  121  SDELVDSSDPICGSLQSGDCV----ERCGYEVQYADGGSSRGFLVKD  163



>ref|XP_010680865.1| PREDICTED: aspartic proteinase Asp1-like [Beta vulgaris subsp. 
vulgaris]
Length=437

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 82/110 (75%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  + GNV+P+G+++  + IG PP+PY +D DTGSDLTWL CDAPCV+C K+PH  YKP 
Sbjct  44   VFRVQGNVFPDGYFYTTLSIGEPPKPYHLDIDTGSDLTWLHCDAPCVNCPKSPHEPYKPQ  103

Query  494  NDLVICKDPLCASL-HVGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            N+ + CKD LC  L H  +Y C +P+ QCDY++EYAD GSS+GVLV D F
Sbjct  104  NNALTCKDSLCTFLQHPPNYPCRNPSDQCDYEIEYADHGSSIGVLVKDNF  153



>ref|XP_006856698.1| hypothetical protein AMTR_s00054p00157640, partial [Amborella 
trichopoda]
 gb|ERN18165.1| hypothetical protein AMTR_s00054p00157640, partial [Amborella 
trichopoda]
Length=406

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 75/98 (77%), Gaps = 3/98 (3%)
 Frame = +2

Query  353  YFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-NNDLVICKDPLCA  529
            Y+  +DIGNPP+PYF+  DTGSDLTWLQCDAPC  C+K PHP Y+P  N LV CKDPLC 
Sbjct  2    YYVSIDIGNPPKPYFLHVDTGSDLTWLQCDAPCRSCSKGPHPFYRPTKNKLVSCKDPLCI  61

Query  530  SLH-VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            SL  +  Y C+ PT QCDY++EYAD GSSLGVLV D F
Sbjct  62   SLKSLRSYPCDDPTQQCDYEIEYADHGSSLGVLVRDSF  99



>gb|KDP32842.1| hypothetical protein JCGZ_12134 [Jatropha curcas]
Length=478

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
             VLP+ GNVYP G+Y   V+IGNPP+ + +D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  58   FVLPISGNVYPLGYYSVSVNIGNPPKLFDLDIDTGSDLTWVQCDAPCTGCTKPVDHLYKP  117

Query  491  NNDLVICKDPLCASLHVGD-YTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             N+LV C +P C+++H  + + CES   QCDY+V+YAD GSS+GVLV+D F
Sbjct  118  RNNLVPCSNPFCSAMHSSENHQCESSNDQCDYEVQYADEGSSIGVLVSDHF  168



>ref|NP_001065913.1| Os11g0183900 [Oryza sativa Japonica Group]
 gb|AAY23257.1| nucellin-like aspartic protease [Oryza sativa Japonica Group]
 gb|ABA91814.1| Eukaryotic aspartyl protease family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27758.1| Os11g0183900 [Oryza sativa Japonica Group]
 gb|EEE51770.1| hypothetical protein OsJ_33210 [Oryza sativa Japonica Group]
Length=418

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 78/113 (69%), Gaps = 4/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V  L G+VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P 
Sbjct  44   VFLLSGDVYPTGHYYVTMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCNKVPHPLYRPT  103

Query  491  NNDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C + +C +LH G   +  C +  QCDY ++Y D  SSLGVLV D FS
Sbjct  104  KNKLVPCANSICTALHSGSSPNKKCTTQQQCDYQIKYTDKASSLGVLVMDSFS  156



>ref|XP_010095410.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXB60102.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=458

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+YGNVYP G+Y   + IGNPP+ Y +D D+GSDLTW+QCDAPC  CTK    LYKP 
Sbjct  51   VFPIYGNVYPLGYYSVSLKIGNPPKVYDLDIDSGSDLTWVQCDAPCTGCTKPRDQLYKPK  110

Query  494  NDLVICKDPLCASLHVG-DYTCESPT-QCDYDVEYADGGSSLGVLVND  631
            N+ + C DP+C+++H   ++ C+SPT QCDY++EYAD GSS GVLV D
Sbjct  111  NNTMHCADPICSAIHSSNNHPCKSPTDQCDYEIEYADRGSSFGVLVRD  158



>ref|XP_006663866.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=360

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/96 (67%), Positives = 75/96 (78%), Gaps = 5/96 (5%)
 Frame = +2

Query  365  VDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-NNDLVICKDPLCASLH-  538
            + IGNPPRPYF+D DTGSDLTWLQCDAPCV C+K PHPLY+P  N LV C DP+CA+LH 
Sbjct  1    MSIGNPPRPYFLDVDTGSDLTWLQCDAPCVSCSKVPHPLYRPTKNKLVPCVDPMCAALHG  60

Query  539  --VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
               G + C+SP  QCDY++ YAD GSSLGV+V D F
Sbjct  61   SLTGRHRCDSPQQQCDYEIRYADQGSSLGVVVKDSF  96



>ref|NP_001146721.1| uncharacterized protein LOC100280323 [Zea mays]
 gb|ACL54620.1| unknown [Zea mays]
Length=557

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 77/107 (72%), Gaps = 1/107 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +  K PHPLYKP 
Sbjct  174  LLPIKGNVFPDGQYYTSIFIGNPPRPYFLDVDTGSDLTWIQCDAPCTNFAKGPHPLYKPA  233

Query  494  NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
             + ++  +D LC  L      CE+  QCDY++EYAD  SS+GVL  D
Sbjct  234  KEKIVPPRDLLCQELQGNQNYCETCKQCDYEIEYADQSSSMGVLARD  280



>gb|KDO37005.1| hypothetical protein CISIN_1g019849mg [Citrus sinensis]
Length=335

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QC+APC  CT  P  LY P 
Sbjct  50   VFPITGNVYPLGYYSVTLKIGNPPKLYELDIDTGSDLTWVQCNAPCTGCTLPPESLYHPK  109

Query  494  NDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            N+LV C DP C++ H+  +  CE+  QCDY+V YAD GSSLGVLV D F
Sbjct  110  NNLVACNDPFCSAFHLPENIRCEANDQCDYEVLYADHGSSLGVLVTDHF  158



>ref|XP_010027413.1| PREDICTED: aspartic proteinase Asp1-like [Eucalyptus grandis]
Length=435

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 77/107 (72%), Gaps = 2/107 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLPL+GNV+P G Y A V IG PP+PYF+DPDTGSDLTWLQC      CT  PHPLY P
Sbjct  61   VVLPLHGNVFPIGSYNATVYIGQPPKPYFLDPDTGSDLTWLQCKVRGARCT--PHPLYPP  118

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
            +++LV   DP+C SL  GDY  +   +C Y+V+YADGGSS G LV D
Sbjct  119  SDELVDSSDPICRSLQSGDYKSDCVERCGYEVQYADGGSSRGFLVKD  165



>ref|XP_003570503.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=564

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 78/108 (72%), Gaps = 1/108 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            ++LP+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP
Sbjct  180  VLLPIKGNVFPDGQYYTSIFVGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKP  239

Query  491  NNDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              + ++  +D LC  L      C +  QCDY++EYAD  SS+GVL  D
Sbjct  240  AKEKIVPPRDLLCQELQGDQNYCATCKQCDYEIEYADRSSSMGVLAKD  287



>ref|XP_003577760.1| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=413

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 76/113 (67%), Gaps = 4/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V  L G+VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHPLYKP 
Sbjct  39   VFQLNGDVYPTGHYYVTMNIGDPAKPYFLDIDTGSDLTWLQCDAPCQSCNKVPHPLYKPT  98

Query  491  NNDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C   +C +LH     +  C  P QCDY ++Y D  SSLGVLV D F+
Sbjct  99   KNKLVPCAASICTTLHSAQSPNKKCAVPQQCDYQIKYTDSASSLGVLVTDNFT  151



>ref|XP_006472808.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Citrus sinensis]
Length=418

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QC+APC  CT  P  LY P 
Sbjct  50   VFPITGNVYPLGYYSVTLKIGNPPKLYELDIDTGSDLTWVQCNAPCTGCTLPPESLYHPK  109

Query  494  NDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            N+LV C DP C++ H+  +  CE+  QCDY+V YAD GSSLGVLV D F
Sbjct  110  NNLVACNDPFCSAFHLPENIRCEANDQCDYEVLYADHGSSLGVLVTDHF  158



>ref|XP_006434233.1| hypothetical protein CICLE_v10003265mg [Citrus clementina]
 gb|ESR47473.1| hypothetical protein CICLE_v10003265mg [Citrus clementina]
Length=459

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QC+APC  CT  P  LY P 
Sbjct  50   VFPITGNVYPLGYYSVTLKIGNPPKLYELDIDTGSDLTWVQCNAPCTGCTLPPESLYHPK  109

Query  494  NDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            N+LV C DP C++ H+  +  CE+  QCDY+V YAD GSSLGVLV D F
Sbjct  110  NNLVACNDPFCSAFHLPENIRCEANDQCDYEVLYADHGSSLGVLVTDHF  158



>ref|XP_006472807.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Citrus sinensis]
Length=458

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QC+APC  CT  P  LY P 
Sbjct  50   VFPITGNVYPLGYYSVTLKIGNPPKLYELDIDTGSDLTWVQCNAPCTGCTLPPESLYHPK  109

Query  494  NDLVICKDPLCASLHV-GDYTCESPTQCDYDVEYADGGSSLGVLVNDVF  637
            N+LV C DP C++ H+  +  CE+  QCDY+V YAD GSSLGVLV D F
Sbjct  110  NNLVACNDPFCSAFHLPENIRCEANDQCDYEVLYADHGSSLGVLVTDHF  158



>ref|XP_006662787.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=422

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 77/113 (68%), Gaps = 4/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V  L G+VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHP Y+P 
Sbjct  48   VFLLSGDVYPVGHYYVTMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCNKVPHPWYRPT  107

Query  491  NNDLVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N LV C + LC +LH G   +  C S  QCDY ++Y D  SSLGVLV D FS
Sbjct  108  KNKLVPCANSLCTALHSGLSSNNKCASQQQCDYQIKYTDKASSLGVLVTDSFS  160



>emb|CDO98445.1| unnamed protein product [Coffea canephora]
Length=568

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 75/110 (68%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            VLPL GN+YP+G Y+  V +G PPRPYF+D DTGSDLTW+QCDAPC  C K  HP YKP 
Sbjct  185  VLPLKGNIYPDGLYYTYVLVGTPPRPYFLDMDTGSDLTWIQCDAPCTSCAKGAHPFYKPA  244

Query  491  NNDLVICKDPLCASLHVGDYT-CESPTQCDYDVEYADGGSSLGVLVNDVF  637
             N ++   D  CA + +   T C +  QCDY++EYAD  SS+GVL  D F
Sbjct  245  ANTIIRSDDSYCAEVQINQRTNCATCHQCDYEIEYADHSSSIGVLARDKF  294



>ref|XP_004977228.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Setaria 
italica]
Length=390

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 75/97 (77%), Gaps = 5/97 (5%)
 Frame = +2

Query  365  VDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-NNDLVICKDPLCASLH-  538
            ++IGNP RPYF+D DTGSDLTWLQCDAPCV C K PHPLY+P  N LV C D LCASLH 
Sbjct  1    MNIGNPSRPYFLDVDTGSDLTWLQCDAPCVSCNKVPHPLYRPIKNKLVPCVDQLCASLHG  60

Query  539  --VGDYTCESP-TQCDYDVEYADGGSSLGVLVNDVFS  640
               G + C+SP  QCDY++ YAD GSS+GVLVND F+
Sbjct  61   GLSGRHKCDSPHQQCDYEIRYADQGSSIGVLVNDSFA  97



>ref|XP_004978884.1| PREDICTED: aspartic proteinase Asp1-like [Setaria italica]
Length=419

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = +2

Query  323  LYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN-ND  499
            L+G+VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P    
Sbjct  46   LHGDVYPTGHYYITMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCNKVPHPLYRPAPKK  105

Query  500  LVICKDPLCASLHVG---DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
            LV C D LC +LH G      C SP QCDY ++Y D  +S GVL+ D FS
Sbjct  106  LVPCADSLCTALHSGLGSGNRCPSPKQCDYRIKYTDSATSQGVLIADNFS  155



>ref|XP_006826817.1| hypothetical protein AMTR_s00010p00056950 [Amborella trichopoda]
 gb|ERM94054.1| hypothetical protein AMTR_s00010p00056950 [Amborella trichopoda]
Length=545

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 77/109 (71%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + P+ GNVYP+G Y+  + +GNP RPY++D DTGSDLTW+QC+APC +C K PHPLY P+
Sbjct  160  IFPVKGNVYPDGLYYISILVGNPRRPYYLDMDTGSDLTWIQCNAPCTNCAKGPHPLYNPS  219

Query  494  -NDLVICKDPLCASLHVGDYT--CESPTQCDYDVEYADGGSSLGVLVND  631
              +LV  KDP C  + V D      +  QCDYD+EYAD  SS+GVLV D
Sbjct  220  KQNLVPSKDPFCLEVQVNDKGKFAGASHQCDYDIEYADQSSSMGVLVRD  268



>ref|XP_010265187.1| PREDICTED: aspartic proteinase Asp1 isoform X3 [Nelumbo nucifera]
Length=504

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GN+YP+G Y+A + +G+PP+PY++D DTGSDLTW+QCDAPC+ C K PHPLYKP+
Sbjct  190  VFPVRGNIYPDGLYYASIYVGSPPKPYYLDMDTGSDLTWIQCDAPCISCAKGPHPLYKPS  249

Query  494  NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
               ++  +D LC  +     +CE+  QCDY++EYAD  SS+GVL  D
Sbjct  250  KGKIVPPRDSLCLEVQTSG-SCETCQQCDYEIEYADRSSSMGVLAMD  295



>ref|XP_010265186.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Nelumbo nucifera]
Length=574

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GN+YP+G Y+A + +G+PP+PY++D DTGSDLTW+QCDAPC+ C K PHPLYKP+
Sbjct  190  VFPVRGNIYPDGLYYASIYVGSPPKPYYLDMDTGSDLTWIQCDAPCISCAKGPHPLYKPS  249

Query  494  NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
               ++  +D LC  +     +CE+  QCDY++EYAD  SS+GVL  D
Sbjct  250  KGKIVPPRDSLCLEVQTSG-SCETCQQCDYEIEYADRSSSMGVLAMD  295



>ref|XP_010265185.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Nelumbo nucifera]
Length=585

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GN+YP+G Y+A + +G+PP+PY++D DTGSDLTW+QCDAPC+ C K PHPLYKP+
Sbjct  190  VFPVRGNIYPDGLYYASIYVGSPPKPYYLDMDTGSDLTWIQCDAPCISCAKGPHPLYKPS  249

Query  494  NDLVI-CKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
               ++  +D LC  +     +CE+  QCDY++EYAD  SS+GVL  D
Sbjct  250  KGKIVPPRDSLCLEVQTSG-SCETCQQCDYEIEYADRSSSMGVLAMD  295



>ref|XP_006656867.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=410

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 75/108 (69%), Gaps = 1/108 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VLP  GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC  C K PHPLYKP
Sbjct  17   VVLPTRGNVFPDGQYYTTMFIGNPPRPYFLDVDTGSDLTWIQCDAPCTSCAKGPHPLYKP  76

Query  491  -NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
               ++V  +D  C  L      C++  QCDY++ YAD  SS+GVL  D
Sbjct  77   AKQNIVHPRDSYCQELQGNQNYCDTCKQCDYEIAYADRSSSMGVLARD  124



>emb|CBI15437.3| unnamed protein product [Vitis vinifera]
Length=473

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + P+ G+VYPNG YF  + +G+PPR YF+D DTGSDLTW+QCDAPC  C K P+PLYKP 
Sbjct  88   IFPVRGDVYPNGLYFTHIFVGSPPRRYFLDMDTGSDLTWIQCDAPCTSCAKGPNPLYKPK  147

Query  494  N-DLVICKDPLCASLHVGDYT--CESPTQCDYDVEYADGGSSLGVLVND  631
              +LV  KD LC  +     T  CE+  QCDY++EYAD  SS+GVL +D
Sbjct  148  KGNLVPLKDSLCVEVQRNLKTGYCETCEQCDYEIEYADHSSSMGVLASD  196



>ref|XP_002511959.1| protein with unknown function [Ricinus communis]
 gb|EEF50628.1| protein with unknown function [Ricinus communis]
Length=583

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 74/109 (68%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP+G YF  + +GNPPRPY++D DT SDLTW+QCDAPC  C K  + LYKP 
Sbjct  195  VFPVRGNVYPDGLYFTYILVGNPPRPYYLDIDTASDLTWIQCDAPCTSCAKGANALYKPR  254

Query  494  NDLVIC-KDPLCASLHVGDYT--CESPTQCDYDVEYADGGSSLGVLVND  631
             D ++  KD LC  LH       CE+  QCDY++EYAD  SS+GVL  D
Sbjct  255  RDNIVTPKDSLCVELHRNQKAGYCETCQQCDYEIEYADHSSSMGVLARD  303



>ref|XP_004502513.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=417

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 81/109 (74%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +  + GNVYP GFY   ++IGNPP+PY +D DTGSD+TW+QCDAPC  CTK    LYKP+
Sbjct  50   IYSIQGNVYPLGFYTVTLNIGNPPKPYDLDIDTGSDITWIQCDAPCTGCTKPIEQLYKPH  109

Query  494  NDLVICKDPLCASLHVGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            N++V C DP+CA++   ++ C+ P  QCDY+V YAD GSSLGVLV D F
Sbjct  110  NNIVKCTDPICAAIQ--NHHCDDPNHQCDYEVVYADHGSSLGVLVRDPF  156



>ref|XP_004498348.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=444

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P++GNVYP G+Y   ++IG PP+ Y +D D+GSDLTW+QCDAPC  CTK    LYKP 
Sbjct  45   VFPVHGNVYPLGYYTVTLNIGYPPKLYDLDIDSGSDLTWVQCDAPCKGCTKPHDQLYKPK  104

Query  494  NDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVND  631
            N+LV C D LCA +H+  D+ C+SP  QCDY+VEYAD GSSLGVLV D
Sbjct  105  NNLVQCVDQLCAGVHLTSDHHCDSPDDQCDYEVEYADHGSSLGVLVRD  152



>gb|KEH40514.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=415

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  ++GNVYP G+Y   ++IG PP+ Y +D D+GSDLTW+QCDAPC  CTK    LYKP+
Sbjct  45   VFRVHGNVYPLGYYTVSLNIGYPPKLYDLDIDSGSDLTWVQCDAPCKGCTKPRDQLYKPS  104

Query  494  NDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVND  631
            N+LV C D LCA++H+  D+ C SP  QCDY+VEYAD GSSLGVLV D
Sbjct  105  NNLVQCVDQLCAAVHLTSDHHCSSPDEQCDYEVEYADQGSSLGVLVRD  152



>ref|XP_010663584.1| PREDICTED: aspartic proteinase Asp1 [Vitis vinifera]
Length=573

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + P+ G+VYPNG YF  + +G+PPR YF+D DTGSDLTW+QCDAPC  C K P+PLYKP 
Sbjct  188  IFPVRGDVYPNGLYFTHIFVGSPPRRYFLDMDTGSDLTWIQCDAPCTSCAKGPNPLYKPK  247

Query  494  N-DLVICKDPLCASLHVGDYT--CESPTQCDYDVEYADGGSSLGVLVND  631
              +LV  KD LC  +     T  CE+  QCDY++EYAD  SS+GVL +D
Sbjct  248  KGNLVPLKDSLCVEVQRNLKTGYCETCEQCDYEIEYADHSSSMGVLASD  296



>gb|KEH40515.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=441

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 2/108 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  ++GNVYP G+Y   ++IG PP+ Y +D D+GSDLTW+QCDAPC  CTK    LYKP+
Sbjct  45   VFRVHGNVYPLGYYTVSLNIGYPPKLYDLDIDSGSDLTWVQCDAPCKGCTKPRDQLYKPS  104

Query  494  NDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVND  631
            N+LV C D LCA++H+  D+ C SP  QCDY+VEYAD GSSLGVLV D
Sbjct  105  NNLVQCVDQLCAAVHLTSDHHCSSPDEQCDYEVEYADQGSSLGVLVRD  152



>ref|XP_004171754.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
Length=437

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 78/109 (72%), Gaps = 2/109 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   ++IG     +  D D+GSDLTW+QCDAPC HCTK    LYKP
Sbjct  41   VVFPLKGNVYPLGYYSVSINIGKGDEAFEFDIDSGSDLTWVQCDAPCTHCTKPREQLYKP  100

Query  491  NNDLVICKDPLCASLH-VGDYTCESP-TQCDYDVEYADGGSSLGVLVND  631
            NN+ + C +PLC SLH + ++ C+S   QC Y++EYAD GSSLGVLVND
Sbjct  101  NNNALNCFEPLCTSLHPITNHHCKSADDQCQYEIEYADHGSSLGVLVND  149



>ref|XP_004149806.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN47712.1| hypothetical protein Csa_6G383000 [Cucumis sativus]
Length=437

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 78/109 (72%), Gaps = 2/109 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   ++IG     +  D D+GSDLTW+QCDAPC HCTK    LYKP
Sbjct  41   VVFPLKGNVYPLGYYSVSINIGKGDEAFEFDIDSGSDLTWVQCDAPCTHCTKPREQLYKP  100

Query  491  NNDLVICKDPLCASLH-VGDYTCESP-TQCDYDVEYADGGSSLGVLVND  631
            NN+ + C +PLC SLH + ++ C+S   QC Y++EYAD GSSLGVLVND
Sbjct  101  NNNALNCFEPLCTSLHPITNHHCKSADDQCQYEIEYADHGSSLGVLVND  149



>ref|XP_004502512.1| PREDICTED: aspartic proteinase Asp1-like [Cicer arietinum]
Length=417

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +  + GNVYP GFY   ++IGNPP+PY +D DTGSD+TW+QCDAPC  CTK    LYKP+
Sbjct  50   IYSIQGNVYPLGFYTVTLNIGNPPKPYDLDIDTGSDITWIQCDAPCTGCTKPVEQLYKPH  109

Query  494  NDLVICKDPLCASLHVGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            N++V C DP+CA++   ++ C+ P  QCDY+V Y D GSSLGVLV D F
Sbjct  110  NNIVKCTDPVCAAIQ--NHHCDDPNHQCDYEVLYVDHGSSLGVLVRDNF  156



>ref|XP_011003438.1| PREDICTED: aspartic proteinase Asp1-like [Populus euphratica]
Length=425

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 81/111 (73%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G+Y   ++IGNPP+P+  D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  54   VFFRVTGNVYPTGYYSVILNIGNPPKPFDFDIDTGSDLTWVQCDAPCKGCTKPRDKLYKP  113

Query  491  NNDLVICKDPLCASLHVGD-YTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
             N+LV C + +C ++  G+ Y C++P  QCDY++EYAD GSS+GVL++D F
Sbjct  114  KNNLVPCSNSICQAVSTGENYHCDAPDDQCDYEIEYADLGSSIGVLLSDSF  164



>ref|XP_007223384.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
 gb|EMJ24583.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
Length=420

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PL+GNVYP G+Y   ++IG P + + +D DTGSDLTW+QCDAPC  CTK    LYKP 
Sbjct  51   VFPLHGNVYPLGYYSVSINIGYPAKRFDLDIDTGSDLTWVQCDAPCTGCTKPREYLYKPK  110

Query  494  NDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N+ + C DPLC + H      C++P  QCDY+VEYAD GSSLGV+VND F
Sbjct  111  NNHLQCGDPLCVAFHSPASDPCKTPDDQCDYEVEYADQGSSLGVMVNDYF  160



>ref|XP_007223385.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
 gb|EMJ24584.1| hypothetical protein PRUPE_ppa005622mg [Prunus persica]
Length=451

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PL+GNVYP G+Y   ++IG P + + +D DTGSDLTW+QCDAPC  CTK    LYKP 
Sbjct  51   VFPLHGNVYPLGYYSVSINIGYPAKRFDLDIDTGSDLTWVQCDAPCTGCTKPREYLYKPK  110

Query  494  NDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N+ + C DPLC + H      C++P  QCDY+VEYAD GSSLGV+VND F
Sbjct  111  NNHLQCGDPLCVAFHSPASDPCKTPDDQCDYEVEYADQGSSLGVMVNDYF  160



>ref|XP_007036501.1| Eukaryotic aspartyl protease family protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY21002.1| Eukaryotic aspartyl protease family protein, putative isoform 
2 [Theobroma cacao]
Length=520

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLVGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247

Query  494  N-DLVICKDPLCASLHVGD--YTCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V  KD +C  +        CE+  QCDY++EYAD  SSLGVL  D
Sbjct  248  RVNIVASKDLMCTEVQKNQKPQNCETCQQCDYEIEYADRSSSLGVLARD  296



>ref|XP_006662788.1| PREDICTED: aspartic proteinase Asp1-like [Oryza brachyantha]
Length=412

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 79/114 (69%), Gaps = 5/114 (4%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +VL L GNVYP G +F  ++IG+P +PY++D DTGS LTWLQCDAPC HC K PHPLYKP
Sbjct  27   VVLELQGNVYPTGHFFITMNIGDPAKPYYLDIDTGSILTWLQCDAPCQHCNKVPHPLYKP  86

Query  491  -NNDLVICKDPLCASLH--VGD-YTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
              + LV CK+  CA L   VG    C   +QCDY + Y D GSS+GVL+ D FS
Sbjct  87   TKSKLVKCKEQRCADLQSDVGKPKRCGPQSQCDYAIHYVD-GSSVGVLIVDRFS  139



>ref|XP_009406648.1| PREDICTED: aspartic proteinase Asp1 [Musa acuminata subsp. malaccensis]
Length=545

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 79/109 (72%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            VLP+ GN++P+G Y+  + +G+ PRPY++D DTGSDLTW+QCDAPC  C K PHPLYKP 
Sbjct  161  VLPIGGNLFPDGQYYTTLFVGSSPRPYYLDVDTGSDLTWIQCDAPCASCAKGPHPLYKPR  220

Query  494  N-DLVICKDPLCASLHV--GDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              +LV+ KD LC  +     ++ C+S  QCDY++EYAD  SS+GVL  D
Sbjct  221  KGNLVLPKDSLCLEVQKNQNNHYCDSCHQCDYEIEYADHSSSMGVLATD  269



>ref|XP_010322933.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Solanum lycopersicum]
Length=424

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +2

Query  350  FYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCA  529
            +Y   +++G PP+PYF D DTGSDLTWLQCDAPC  C+ APH LYKP+ ++V CKDP+C 
Sbjct  32   YYQVTLEVGRPPKPYFFDIDTGSDLTWLQCDAPCAKCSPAPHNLYKPHRNVVTCKDPVCT  91

Query  530  SLHVGD-YTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            SLH  + + C  P  QCDY+V YAD GSSLGVLV D F
Sbjct  92   SLHWPESHPCHDPNEQCDYEVAYADSGSSLGVLVKDTF  129



>gb|KDO41979.1| hypothetical protein CISIN_1g008104mg [Citrus sinensis]
Length=455

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + PL GN+YP+G YF  + +GNPPRPY++D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  189  IFPLRGNIYPDGLYFTYMIVGNPPRPYYLDMDTGSDLTWIQCDAPCSSCAKGANPLYKPR  248

Query  494  -NDLVICKDPLCASL---HVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              +++  KD LC  +   H   Y CE+  QCDY++EYAD  SS+GVL  D
Sbjct  249  MGNILPYKDSLCMEIQRNHKPGY-CETCQQCDYEIEYADHSSSMGVLARD  297



>ref|XP_010094778.1| Aspartic proteinase Asp1 [Morus notabilis]
 gb|EXB56943.1| Aspartic proteinase Asp1 [Morus notabilis]
Length=569

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G Y+ Q+ +GNPPRPY +D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  175  ILPVRGNVYPDGLYYTQILVGNPPRPYHLDMDTGSDLTWIQCDAPCTSCAKGANPLYKPT  234

Query  494  N-DLVICKDPLCASLHVGDY--TCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V  KD  C  +        C++  QCDY+++YAD  SSLGVL  D
Sbjct  235  KGNIVPSKDSFCTEIRRNQKPGHCKTCQQCDYEIQYADRSSSLGVLAKD  283



>gb|EAZ00454.1| hypothetical protein OsI_22475 [Oryza sativa Indica Group]
Length=538

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  146  LLPIRGNVFPDGQYYTSMYIGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPE  205

Query  494  N-DLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V  +D  C  L       ++  QCDY++ YAD  SS+G+L  D
Sbjct  206  KPNVVPPRDSYCQELQGNQNYGDTSKQCDYEITYADRSSSMGILARD  252



>ref|XP_002306645.2| hypothetical protein POPTR_0005s20210g [Populus trichocarpa]
 gb|EEE93641.2| hypothetical protein POPTR_0005s20210g [Populus trichocarpa]
Length=424

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 80/111 (72%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G+Y   ++IGNPP+ +  D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  54   VFFRVTGNVYPTGYYSVILNIGNPPKAFDFDIDTGSDLTWVQCDAPCKGCTKPRDKLYKP  113

Query  491  NNDLVICKDPLCASLHVGD-YTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
             N+LV C + LC ++  G+ Y C++P  QCDY++EYAD GSS+GVL++D F
Sbjct  114  KNNLVPCSNSLCQAVSTGENYHCDAPDDQCDYEIEYADLGSSIGVLLSDSF  164



>ref|NP_001057353.1| Os06g0268700 [Oryza sativa Japonica Group]
 dbj|BAD53531.1| putative nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 dbj|BAD54393.1| putative nucellin-like aspartic protease [Oryza sativa Japonica 
Group]
 dbj|BAF19267.1| Os06g0268700 [Oryza sativa Japonica Group]
 gb|EAZ36578.1| hypothetical protein OsJ_20919 [Oryza sativa Japonica Group]
 dbj|BAH00170.1| unnamed protein product [Oryza sativa Japonica Group]
Length=538

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNV+P+G Y+  + IGNPPRPYF+D DTGSDLTW+QCDAPC +C K PHPLYKP 
Sbjct  146  LLPIRGNVFPDGQYYTSMYIGNPPRPYFLDVDTGSDLTWIQCDAPCTNCAKGPHPLYKPE  205

Query  494  N-DLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V  +D  C  L       ++  QCDY++ YAD  SS+G+L  D
Sbjct  206  KPNVVPPRDSYCQELQGNQNYGDTSKQCDYEITYADRSSSMGILARD  252



>gb|KDO41978.1| hypothetical protein CISIN_1g008104mg [Citrus sinensis]
Length=521

 Score =   125 bits (313),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + PL GN+YP+G YF  + +GNPPRPY++D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  189  IFPLRGNIYPDGLYFTYMIVGNPPRPYYLDMDTGSDLTWIQCDAPCSSCAKGANPLYKPR  248

Query  494  -NDLVICKDPLCASL---HVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              +++  KD LC  +   H   Y CE+  QCDY++EYAD  SS+GVL  D
Sbjct  249  MGNILPYKDSLCMEIQRNHKPGY-CETCQQCDYEIEYADHSSSMGVLARD  297



>ref|XP_007036500.1| Eukaryotic aspartyl protease family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY21001.1| Eukaryotic aspartyl protease family protein, putative isoform 
1 [Theobroma cacao]
Length=576

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLVGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247

Query  494  N-DLVICKDPLCASLHVGD--YTCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V  KD +C  +        CE+  QCDY++EYAD  SSLGVL  D
Sbjct  248  RVNIVASKDLMCTEVQKNQKPQNCETCQQCDYEIEYADRSSSLGVLARD  296



>gb|KHN20145.1| Aspartic proteinase Asp1 [Glycine soja]
Length=452

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  + GNVYP G Y   ++IG PP+ Y +D D+GSDLTW+QCDAPC  CTK    LYKPN
Sbjct  51   VFKVQGNVYPLGHYTVSLNIGYPPKLYDLDIDSGSDLTWVQCDAPCKGCTKPRDQLYKPN  110

Query  494  NDLVICKDPLCASLHVG-DYTCESP-TQCDYDVEYADGGSSLGVLVND  631
            ++LV C D LC+ + +  +YTC SP  QCDY+VEYAD GSSLGVLV D
Sbjct  111  HNLVQCVDQLCSEVQLSMEYTCASPDDQCDYEVEYADHGSSLGVLVRD  158



>ref|XP_008219614.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Prunus mume]
Length=420

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PL+GNVYP G+Y   +++G P + + +D DTGSDLTW+QCDAPC  CT+    LYKP 
Sbjct  51   VFPLHGNVYPLGYYSVSINVGYPAKRFDLDIDTGSDLTWVQCDAPCTGCTRPREYLYKPK  110

Query  494  NDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N+ + C DPLC + H      C++P  QCDY+VEYAD GSSLGV+VND F
Sbjct  111  NNHLQCGDPLCVAFHSPASDPCKTPDDQCDYEVEYADQGSSLGVMVNDYF  160



>ref|XP_006596210.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Glycine 
max]
Length=452

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  + GNVYP G Y   ++IG PP+ Y +D D+GSDLTW+QCDAPC  CTK    LYKPN
Sbjct  51   VFKVQGNVYPLGHYTVSLNIGYPPKLYDLDIDSGSDLTWVQCDAPCKGCTKPRDQLYKPN  110

Query  494  NDLVICKDPLCASLHVG-DYTCESP-TQCDYDVEYADGGSSLGVLVND  631
            ++LV C D LC+ + +  +YTC SP  QCDY+VEYAD GSSLGVLV D
Sbjct  111  HNLVQCVDQLCSEVQLSMEYTCASPDDQCDYEVEYADHGSSLGVLVRD  158



>ref|XP_008813298.1| PREDICTED: aspartic proteinase Asp1 [Phoenix dactylifera]
Length=555

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 3/108 (3%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
             P+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC  C K PHPLYKP  
Sbjct  171  FPVRGNVFPDGQYYTSILVGNPPRPYFLDVDTGSDLTWIQCDAPCSSCAKGPHPLYKPTK  230

Query  497  DLVI-CKDPLCASLHVGDYT--CESPTQCDYDVEYADGGSSLGVLVND  631
              ++   D +C  +        CES  QCDY++EYAD  SS+GVL  D
Sbjct  231  GKIVPPGDSMCLEMQSNQNLGYCESCPQCDYEIEYADHSSSMGVLARD  278



>ref|XP_006393742.1| hypothetical protein EUTSA_v10011529mg [Eutrema salsugineum]
 gb|ESQ31028.1| hypothetical protein EUTSA_v10011529mg [Eutrema salsugineum]
Length=411

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNV+P G+Y   + IG+PP+ +  D DTGSDLTW+QCDAPC  CT  P  LYKP
Sbjct  41   LVFPLSGNVFPLGYYSVSLQIGSPPKKFTFDIDTGSDLTWIQCDAPCTGCTLHPSLLYKP  100

Query  491  NNDLVICKDPLCASLHVGDY-TCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
              + V C DP+C++LH  +   C +P  QCDYDVEYAD GSS+G LV D F
Sbjct  101  KANTVPCSDPICSALHWPNKPHCPNPKEQCDYDVEYADQGSSMGALVTDQF  151



>ref|XP_008466731.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=437

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNVYP G+Y   ++IG     +  D D+GSDLTW+QCDAPC  CTK    LYKP
Sbjct  41   VVFPLKGNVYPLGYYSVSINIGKGDEAFEFDIDSGSDLTWVQCDAPCTDCTKPREQLYKP  100

Query  491  NNDLVICKDPLCASLH-VGDYTCESP-TQCDYDVEYADGGSSLGVLVND  631
            NN+ + C +PLC SLH + ++ C+S   QC Y++EYAD GSSLGVLVND
Sbjct  101  NNNALNCFEPLCISLHPITNHHCKSADDQCQYEIEYADHGSSLGVLVND  149



>ref|XP_008219613.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Prunus mume]
Length=451

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 78/110 (71%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V PL+GNVYP G+Y   +++G P + + +D DTGSDLTW+QCDAPC  CT+    LYKP 
Sbjct  51   VFPLHGNVYPLGYYSVSINVGYPAKRFDLDIDTGSDLTWVQCDAPCTGCTRPREYLYKPK  110

Query  494  NDLVICKDPLCASLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            N+ + C DPLC + H      C++P  QCDY+VEYAD GSSLGV+VND F
Sbjct  111  NNHLQCGDPLCVAFHSPASDPCKTPDDQCDYEVEYADQGSSLGVMVNDYF  160



>ref|XP_006440945.1| hypothetical protein CICLE_v10019473mg [Citrus clementina]
 gb|ESR54185.1| hypothetical protein CICLE_v10019473mg [Citrus clementina]
Length=577

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + PL GN+YP+G YF  + +GNPPRPY++D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  189  IFPLRGNIYPDGLYFTYMIVGNPPRPYYLDMDTGSDLTWIQCDAPCSSCAKGANPLYKPR  248

Query  494  -NDLVICKDPLCASL---HVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              +++  KD LC  +   H   Y CE+  QCDY++EYAD  SS+GVL  D
Sbjct  249  MGNILPYKDSLCMEIQRNHKPGY-CETCQQCDYEIEYADHSSSMGVLARD  297



>ref|XP_006355850.1| PREDICTED: aspartic proteinase Asp1-like [Solanum tuberosum]
Length=400

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 76/110 (69%), Gaps = 1/110 (1%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V  L GNVYP G+Y   +++G PPRPYF+D DTGSDLTWLQCD P      APH  YKP
Sbjct  1    MVFLLDGNVYPKGYYQVVLNVGQPPRPYFLDVDTGSDLTWLQCDIPGAKNLPAPHHPYKP  60

Query  491  NNDLVICKDPLCASLHVGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            N +LV   DP+C S+H  +    +PT QCDY++EYAD  SSLGVLV D F
Sbjct  61   NKNLVKHNDPICVSIHGANPPGHTPTDQCDYEIEYADHCSSLGVLVRDAF  110



>gb|KDO41977.1| hypothetical protein CISIN_1g008104mg [Citrus sinensis]
Length=577

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 77/110 (70%), Gaps = 5/110 (5%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + PL GN+YP+G YF  + +GNPPRPY++D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  189  IFPLRGNIYPDGLYFTYMIVGNPPRPYYLDMDTGSDLTWIQCDAPCSSCAKGANPLYKPR  248

Query  494  -NDLVICKDPLCASL---HVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              +++  KD LC  +   H   Y CE+  QCDY++EYAD  SS+GVL  D
Sbjct  249  MGNILPYKDSLCMEIQRNHKPGY-CETCQQCDYEIEYADHSSSMGVLARD  297



>dbj|BAJ99780.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=430

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 73/110 (66%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V  L G VYP G Y+  ++IG+P +PYF+D DTGSDLTWLQCDAPC  C K PHP YKP 
Sbjct  60   VFQLQGAVYPIGHYYVTMNIGDPAKPYFLDVDTGSDLTWLQCDAPCQSCNKVPHPWYKPT  119

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N +V C   LC SL   +  C  P QCDY ++Y D  SSLGVL+ D F+
Sbjct  120  KNKIVPCAASLCTSL-TPNKKCAVPQQCDYQIKYTDKASSLGVLIADNFT  168



>gb|KJB39311.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
Length=393

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLLGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247

Query  494  N-DLVICKDPLCASLHVGD--YTCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V   D +C  +        CE+  QCDY++EYAD  SSLGVL  D
Sbjct  248  KVNIVASGDSMCMEVQKNQKPQICETCQQCDYEIEYADRSSSLGVLAKD  296



>ref|XP_007161478.1| hypothetical protein PHAVU_001G072500g [Phaseolus vulgaris]
 gb|ESW33472.1| hypothetical protein PHAVU_001G072500g [Phaseolus vulgaris]
Length=433

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  + GNVYP G Y    +IG+PP+ Y +D D+GSD+TW+QCDAPC  CTK    LYKPN
Sbjct  51   VFKVQGNVYPLGHYTVFFNIGHPPKFYDLDIDSGSDITWVQCDAPCKGCTKPRVQLYKPN  110

Query  494  NDLVICKDPLCASLHVG-DYTCESP-TQCDYDVEYADGGSSLGVLVND  631
            ++LV C D LC+ +H+  D+ C SP  QCDY+VEYAD GSSLGVLV D
Sbjct  111  HNLVQCVDQLCSEVHLSTDHNCASPDDQCDYEVEYADNGSSLGVLVRD  158



>ref|XP_008444185.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis melo]
Length=411

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+ P+ GNVYP G +   V IGNPP+ + +D DTGSDLTW+QCDAPC  CT     LYKP
Sbjct  41   ILFPVKGNVYPLGHFTVSVTIGNPPKVFELDIDTGSDLTWVQCDAPCTGCTLPRDRLYKP  100

Query  491  NNDLVICKDPLCASLHVGDYT-CESPT-QCDYDVEYADGGSSLGVLVND  631
            +N++V C +PLCA+L     + C++P  QCDY+VEYAD GSS+GVLV D
Sbjct  101  HNNVVRCGEPLCAALFSASKSPCKNPNDQCDYEVEYADHGSSIGVLVKD  149



>ref|XP_004142705.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 ref|XP_004161182.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN54551.1| hypothetical protein Csa_4G361850 [Cucumis sativus]
Length=410

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 2/109 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I+LP+ GNVYP G +   V IGNPP+ + +D DTGSDLTW+QCDAPC  CT     LYKP
Sbjct  41   ILLPVKGNVYPLGHFTVSVTIGNPPKVFELDIDTGSDLTWVQCDAPCTGCTLPHDRLYKP  100

Query  491  NNDLVICKDPLCASLHVGDYT-CESPT-QCDYDVEYADGGSSLGVLVND  631
            +N++V C +PLC++L     + C++P  QCDY+VEYAD GSS+GVLV D
Sbjct  101  HNNVVRCGEPLCSALFSASKSPCKNPNDQCDYEVEYADHGSSIGVLVKD  149



>ref|XP_003523437.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN47011.1| Aspartic proteinase Asp1 [Glycine soja]
Length=421

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 77/109 (71%), Gaps = 2/109 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QCDAPC  CT   + LYKP
Sbjct  50   VAFQIKGNVYPLGYYTVSLAIGNPPKVYDLDIDTGSDLTWVQCDAPCKGCTLPRNRLYKP  109

Query  491  NNDLVICKDPLCASLHVG-DYTCESPT-QCDYDVEYADGGSSLGVLVND  631
            + DLV C DPLCA++    ++ C  P  QCDY+VEYAD GSSLGVL+ D
Sbjct  110  HGDLVKCVDPLCAAIQSAPNHHCAGPNEQCDYEVEYADQGSSLGVLLRD  158



>ref|XP_001766321.1| predicted protein [Physcomitrella patens]
 gb|EDQ68953.1| predicted protein, partial [Physcomitrella patens]
Length=381

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = +2

Query  323  LYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN-D  499
            L GN+YP+G Y+  + IG P + Y++D DTGSDLTWLQCDAPC  C   PH LY P    
Sbjct  13   LRGNIYPDGLYYMAMLIGAPAKLYYLDMDTGSDLTWLQCDAPCRSCASGPHGLYDPKKAR  72

Query  500  LVICKDPLCASLHV-GDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
            LV C+ PLCA +   G Y C  P  QCDYDVEYADG S++GVL+ D  +
Sbjct  73   LVDCRVPLCALVQQGGSYACGGPVRQCDYDVEYADGSSTMGVLMEDTIT  121



>ref|XP_011027498.1| PREDICTED: aspartic proteinase Asp1-like isoform X4 [Populus 
euphratica]
 ref|XP_011014194.1| PREDICTED: aspartic proteinase Asp1-like isoform X4 [Populus 
euphratica]
Length=400

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G Y   ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  54   VFFRVTGNVYPTGHYSVILNIGNPPKAFDLDIDTGSDLTWVQCDAPCKGCTKPLDKLYKP  113

Query  491  NNDLVICKDPLCASLHVG-DYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             N+ V C   LC ++  G +Y C+ PT QCDY+V+YAD GSSLGVL++D F
Sbjct  114  KNNRVPCASSLCQAISTGQNYNCDIPTEQCDYEVQYADLGSSLGVLLSDYF  164



>ref|XP_011027497.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Populus 
euphratica]
 ref|XP_011014193.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Populus 
euphratica]
Length=414

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G Y   ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  54   VFFRVTGNVYPTGHYSVILNIGNPPKAFDLDIDTGSDLTWVQCDAPCKGCTKPLDKLYKP  113

Query  491  NNDLVICKDPLCASLHVG-DYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             N+ V C   LC ++  G +Y C+ PT QCDY+V+YAD GSSLGVL++D F
Sbjct  114  KNNRVPCASSLCQAISTGQNYNCDIPTEQCDYEVQYADLGSSLGVLLSDYF  164



>ref|XP_003526637.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
 gb|KHN21715.1| Aspartic proteinase Asp1 [Glycine soja]
Length=421

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 76/109 (70%), Gaps = 2/109 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QCDAPC  CT   + LYKP
Sbjct  50   VAFQIKGNVYPLGYYTVSLAIGNPPKVYDLDIDTGSDLTWVQCDAPCQGCTIPRNRLYKP  109

Query  491  NNDLVICKDPLCASLHVG-DYTCESPT-QCDYDVEYADGGSSLGVLVND  631
            N +LV C DPLC ++    ++ C  P  QCDY+VEYAD GSSLGVL+ D
Sbjct  110  NGNLVKCGDPLCKAIQSAPNHHCAGPNEQCDYEVEYADQGSSLGVLLRD  158



>gb|AAM76716.1| nucellin-like aspartic protease [Zea mays]
Length=357

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 67/94 (71%), Gaps = 4/94 (4%)
 Frame = +2

Query  371  IGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN-NDLVICKDPLCASLHVG-  544
            IGNP +PYF+D DTGSDLTWLQCDAPC  C K PHPLY+P  N LV C + LC +LH G 
Sbjct  1    IGNPAKPYFLDVDTGSDLTWLQCDAPCRSCNKVPHPLYRPTANRLVPCANALCTALHSGQ  60

Query  545  --DYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
              +  C SP QCDY ++Y D  SS GVL+ND FS
Sbjct  61   GSNNKCPSPKQCDYQIKYTDSASSQGVLINDSFS  94



>ref|XP_006485774.1| PREDICTED: aspartic proteinase Asp1-like [Citrus sinensis]
Length=577

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 76/110 (69%), Gaps = 5/110 (5%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
              PL GNVYP+G YF  + +GNPPRPY++D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  189  TFPLRGNVYPDGLYFTYMIVGNPPRPYYLDMDTGSDLTWIQCDAPCSSCAKGANPLYKPR  248

Query  494  -NDLVICKDPLCASL---HVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
              +++  KD LC  +   H   Y CE+  QCDY++EYAD  SS+GVL  D
Sbjct  249  MGNILPYKDSLCMEIQRNHKPGY-CETCQQCDYEIEYADHSSSMGVLARD  297



>ref|XP_011027496.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Populus 
euphratica]
 ref|XP_011014192.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Populus 
euphratica]
Length=425

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G Y   ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  54   VFFRVTGNVYPTGHYSVILNIGNPPKAFDLDIDTGSDLTWVQCDAPCKGCTKPLDKLYKP  113

Query  491  NNDLVICKDPLCASLHVG-DYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             N+ V C   LC ++  G +Y C+ PT QCDY+V+YAD GSSLGVL++D F
Sbjct  114  KNNRVPCASSLCQAISTGQNYNCDIPTEQCDYEVQYADLGSSLGVLLSDYF  164



>gb|KJB39308.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
Length=492

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLLGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247

Query  494  N-DLVICKDPLCASLHVGD--YTCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V   D +C  +        CE+  QCDY++EYAD  SSLGVL  D
Sbjct  248  KVNIVASGDSMCMEVQKNQKPQICETCQQCDYEIEYADRSSSLGVLAKD  296



>gb|KHG03472.1| Asparticase Asp1 [Gossypium arboreum]
Length=575

 Score =   123 bits (309),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 74/109 (68%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP RPYF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTCMLLGNPQRPYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247

Query  494  N-DLVICKDPLCASLHVGD--YTCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V   D +C  +        CE+  QCDY++EYAD  SSLGVL  D
Sbjct  248  KVNIVPSGDSMCMEVQKNQKPQICETCEQCDYEIEYADRSSSLGVLAKD  296



>ref|XP_011027495.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Populus 
euphratica]
 ref|XP_011014191.1| PREDICTED: aspartic proteinase Asp1-like isoform X1 [Populus 
euphratica]
Length=463

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G Y   ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  54   VFFRVTGNVYPTGHYSVILNIGNPPKAFDLDIDTGSDLTWVQCDAPCKGCTKPLDKLYKP  113

Query  491  NNDLVICKDPLCASLHVG-DYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             N+ V C   LC ++  G +Y C+ PT QCDY+V+YAD GSSLGVL++D F
Sbjct  114  KNNRVPCASSLCQAISTGQNYNCDIPTEQCDYEVQYADLGSSLGVLLSDYF  164



>gb|KJB39310.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
 gb|KJB39312.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
Length=538

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLLGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247

Query  494  N-DLVICKDPLCASLHVGD--YTCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V   D +C  +        CE+  QCDY++EYAD  SSLGVL  D
Sbjct  248  KVNIVASGDSMCMEVQKNQKPQICETCQQCDYEIEYADRSSSLGVLAKD  296



>gb|EMT29613.1| Aspartic proteinase Asp1 [Aegilops tauschii]
Length=412

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 73/110 (66%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V  L G VYP G Y+  ++IG+P +PYF+D DTGSDL+WLQCDAPC  C K PHP YKP 
Sbjct  42   VFQLQGAVYPIGHYYVTMNIGDPAKPYFLDVDTGSDLSWLQCDAPCQSCNKVPHPWYKPT  101

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N +V C   LC SL   +  C  P QCDY ++Y D  +SLGVLV D F+
Sbjct  102  KNKIVPCAASLCTSLSP-NKKCAVPQQCDYQIKYTDKATSLGVLVADNFT  150



>ref|XP_010908260.1| PREDICTED: aspartic proteinase Asp1 [Elaeis guineensis]
Length=557

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 74/108 (69%), Gaps = 3/108 (3%)
 Frame = +2

Query  317  LPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNN  496
             P+ GNV+P+G Y+  + +GNPPRPYF+D DTGSDLTW+QCDAPC  C + PHPLYKP+ 
Sbjct  173  FPVGGNVFPDGQYYTSILVGNPPRPYFLDVDTGSDLTWIQCDAPCSSCAQGPHPLYKPSK  232

Query  497  DLVI-CKDPLCASLHVGDY--TCESPTQCDYDVEYADGGSSLGVLVND  631
              ++   D LC  +        CES  QCDY++EYAD  SS+GVL  D
Sbjct  233  GKIVPPGDSLCLEVQSNQNHGHCESCHQCDYEIEYADHSSSMGVLARD  280



>gb|KJB39307.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
Length=576

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLLGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247

Query  494  N-DLVICKDPLCASLHVGD--YTCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V   D +C  +        CE+  QCDY++EYAD  SSLGVL  D
Sbjct  248  KVNIVASGDSMCMEVQKNQKPQICETCQQCDYEIEYADRSSSLGVLAKD  296



>gb|KJB39309.1| hypothetical protein B456_007G006200 [Gossypium raimondii]
Length=575

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +GNP R YF+D DTGSDLTW+QCDAPC  C K  +PLYKP 
Sbjct  188  ILPVRGNVYPDGLYFTYMLLGNPQRRYFLDIDTGSDLTWIQCDAPCSSCAKGANPLYKPT  247

Query  494  N-DLVICKDPLCASLHVGD--YTCESPTQCDYDVEYADGGSSLGVLVND  631
              ++V   D +C  +        CE+  QCDY++EYAD  SSLGVL  D
Sbjct  248  KVNIVASGDSMCMEVQKNQKPQICETCQQCDYEIEYADRSSSLGVLAKD  296



>gb|KCW48539.1| hypothetical protein EUGRSUZ_K02213 [Eucalyptus grandis]
Length=526

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +G PP+ YF+D DTGSDLTW+QCDAPC  C K  + LYKP 
Sbjct  183  ILPVTGNVYPDGLYFTSILVGTPPKRYFLDMDTGSDLTWIQCDAPCKSCGKGANALYKPK  242

Query  494  N-DLVICKDPLCASLHV--GDYTCESPTQCDYDVEYADGGSSLGVLVND  631
            +  +V+ KD LC  +    G   CE+  QCDY++EYAD  SS+GVL  D
Sbjct  243  SGKIVLPKDSLCKEVQRSEGFEYCETCQQCDYEIEYADHSSSMGVLARD  291



>ref|XP_010036874.1| PREDICTED: aspartic proteinase Asp1 [Eucalyptus grandis]
 gb|KCW48538.1| hypothetical protein EUGRSUZ_K02213 [Eucalyptus grandis]
Length=569

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 75/109 (69%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            +LP+ GNVYP+G YF  + +G PP+ YF+D DTGSDLTW+QCDAPC  C K  + LYKP 
Sbjct  183  ILPVTGNVYPDGLYFTSILVGTPPKRYFLDMDTGSDLTWIQCDAPCKSCGKGANALYKPK  242

Query  494  N-DLVICKDPLCASLHV--GDYTCESPTQCDYDVEYADGGSSLGVLVND  631
            +  +V+ KD LC  +    G   CE+  QCDY++EYAD  SS+GVL  D
Sbjct  243  SGKIVLPKDSLCKEVQRSEGFEYCETCQQCDYEIEYADHSSSMGVLARD  291



>ref|XP_008457584.1| PREDICTED: aspartic proteinase Asp1 isoform X2 [Cucumis melo]
Length=570

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ G++YP+G Y+  + +G PPRPYF+D DTGSDLTW+QCDAPC  C K   PLYKP 
Sbjct  186  VFPVRGDIYPDGLYYTYIMVGEPPRPYFLDIDTGSDLTWVQCDAPCSSCGKGRSPLYKPR  245

Query  494  NDLVIC-KDPLCASLHV---GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             + V+  KD LC  +     GD  C +  QC+Y+V+YAD  SSLGVLV D F+
Sbjct  246  REKVVSFKDSLCMEVQRNYDGD-QCAACHQCNYEVQYADQSSSLGVLVKDEFT  297



>ref|XP_004137470.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 ref|XP_004157418.1| PREDICTED: aspartic proteinase Asp1-like [Cucumis sativus]
 gb|KGN64113.1| hypothetical protein Csa_1G042250 [Cucumis sativus]
Length=570

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ G++YP+G Y+  + +G PPRPYF+D DTGSDLTW+QCDAPC  C K   PLYKP 
Sbjct  186  VFPVRGDIYPDGLYYTYIMVGEPPRPYFLDIDTGSDLTWVQCDAPCSSCGKGRSPLYKPR  245

Query  494  NDLVIC-KDPLCASLHV---GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             + V+  KD LC  +     GD  C +  QC+Y+V+YAD  SSLGVLV D F+
Sbjct  246  RENVVSFKDSLCMEVQRNYDGD-QCAACQQCNYEVQYADQSSSLGVLVKDEFT  297



>ref|XP_001783556.1| predicted protein [Physcomitrella patens]
 gb|EDQ51645.1| predicted protein [Physcomitrella patens]
Length=414

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +2

Query  320  PLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNND  499
            P+ GN+YP+G Y+  + IGNP + Y++D DTGSDLTWLQCDAPC  C   PH LY P   
Sbjct  20   PIGGNIYPDGLYYMAMRIGNPAKLYYLDMDTGSDLTWLQCDAPCRSCAVGPHGLYDPKRA  79

Query  500  LVI-CKDPLCASLHV-GDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
             V+ C+ P CA +   G +TC     QCDY+V+Y DG S++G+LV D  +
Sbjct  80   RVVDCRRPTCAQVQRGGQFTCSGDVRQCDYEVDYVDGSSTMGILVEDTIT  129



>gb|KDP20103.1| hypothetical protein JCGZ_05872 [Jatropha curcas]
Length=574

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 73/109 (67%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            + P+ GNVYP+G YF  + +G+PPRPY++D DT SDLTW+QCDAPC  C K  + LYKP 
Sbjct  186  IFPVRGNVYPDGLYFTYILVGSPPRPYYLDVDTASDLTWIQCDAPCASCAKGANALYKPR  245

Query  494  NDLVI-CKDPLCASLHVGDY--TCESPTQCDYDVEYADGGSSLGVLVND  631
             D ++  KD LC  L        CE+  QCDY++EYAD  SS+GVL  D
Sbjct  246  RDNIVPPKDLLCVELQRNQKPGYCEACQQCDYEIEYADHSSSMGVLARD  294



>gb|KHN47012.1| Aspartic proteinase Asp1 [Glycine soja]
Length=395

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I   + GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QCDAPC  CT      YKP
Sbjct  22   IAFQIKGNVYPLGYYTVNLAIGNPPKAYELDIDTGSDLTWVQCDAPCKGCTLPRDRQYKP  81

Query  491  NNDLVICKDPLCASLHVG-DYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            + +LV C DPLCA++    +  C +P  QCDY+VEYAD GSSLGVLV D+ 
Sbjct  82   HGNLVKCVDPLCAAIQSAPNPPCVNPNEQCDYEVEYADQGSSLGVLVRDII  132



>gb|KHN20610.1| Aspartic proteinase Asp1 [Glycine soja]
Length=454

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V  L GNVYP G Y   ++IG PP+ Y +D D+GSDLTW+QCDAPC  CTK    LYKPN
Sbjct  51   VFKLQGNVYPLGHYTVSLNIGYPPKLYDLDIDSGSDLTWVQCDAPCKGCTKPRDQLYKPN  110

Query  494  NDLVICKDPLCASLHVG-DYTCESPTQ-CDYDVEYADGGSSLGVLVND  631
            ++LV C D LC+ +H+   Y C SP   CDY+VEYAD GSSLGVLV D
Sbjct  111  HNLVQCVDQLCSEVHLSMAYNCPSPDDPCDYEVEYADHGSSLGVLVRD  158



>ref|XP_007019120.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOY16345.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=440

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            + LP+ GNVYP G+Y  ++ IGNPP+P+ +D DTGSDLTW+QCDAPC  CT+    LYKP
Sbjct  58   VFLPVSGNVYPLGYYSVELKIGNPPKPFQLDIDTGSDLTWVQCDAPCTGCTQPRDRLYKP  117

Query  491  -NNDLVICKDPLCASLHVGDYT-CESPTQ-CDYDVEYADGGSSLGVLVNDVF  637
              N+ + CKDP+CA+L+      C++P + C + VEYAD GS LGV+V+D F
Sbjct  118  VRNNFLPCKDPICAALNSPKSNPCKNPNEKCGFQVEYADRGSVLGVMVSDNF  169



>ref|XP_008457519.1| PREDICTED: aspartic proteinase Asp1 isoform X1 [Cucumis melo]
Length=609

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 77/113 (68%), Gaps = 5/113 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ G++YP+G Y+  + +G PPRPYF+D DTGSDLTW+QCDAPC  C K   PLYKP 
Sbjct  186  VFPVRGDIYPDGLYYTYIMVGEPPRPYFLDIDTGSDLTWVQCDAPCSSCGKGRSPLYKPR  245

Query  494  NDLVIC-KDPLCASLHV---GDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             + V+  KD LC  +     GD  C +  QC+Y+V+YAD  SSLGVLV D F+
Sbjct  246  REKVVSFKDSLCMEVQRNYDGD-QCAACHQCNYEVQYADQSSSLGVLVKDEFT  297



>ref|XP_007019119.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY16344.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=408

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 81/112 (72%), Gaps = 3/112 (3%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            + LP+ GNVYP G+Y  ++ IGNPP+P+ +D DTGSDLTW+QCDAPC  CT+    LYKP
Sbjct  38   VFLPVSGNVYPLGYYSVELKIGNPPKPFQLDIDTGSDLTWVQCDAPCTGCTQPRDRLYKP  97

Query  491  -NNDLVICKDPLCASLHVGDYT-CESPTQ-CDYDVEYADGGSSLGVLVNDVF  637
              N+ + CKDP+CA+L+      C++P + C + VEYAD GS LGV+V+D F
Sbjct  98   VRNNFLPCKDPICAALNSPKSNPCKNPNEKCGFQVEYADRGSVLGVMVSDNF  149



>ref|XP_011097005.1| PREDICTED: aspartic proteinase Asp1 [Sesamum indicum]
Length=568

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 72/109 (66%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V+P+ GN+YP+G Y+  +  GNPPRPYF+D DTGS LTW+QCDAPC  C K  HP YKP 
Sbjct  191  VIPVGGNIYPDGLYYTYLHFGNPPRPYFLDMDTGSALTWIQCDAPCTSCAKGAHPFYKPV  250

Query  491  NNDLVICKDPLCASLHVGDYT--CESPTQCDYDVEYADGGSSLGVLVND  631
              +++  KD  C  +        C+S  QCDY++EYAD  SS+GVL  D
Sbjct  251  KANIIPPKDSFCVEIQKNQIAKDCDSCNQCDYEIEYADHSSSVGVLARD  299



>ref|XP_003523438.1| PREDICTED: aspartic proteinase Asp1-like [Glycine max]
Length=407

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            I   + GNVYP G+Y   + IGNPP+ Y +D DTGSDLTW+QCDAPC  CT      YKP
Sbjct  34   IAFQIKGNVYPLGYYSVNLAIGNPPKAYELDIDTGSDLTWVQCDAPCKGCTLPRDRQYKP  93

Query  491  NNDLVICKDPLCASLHVG-DYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
            + +LV C DPLCA++    +  C +P  QCDY+VEYAD GSSLGVLV D+ 
Sbjct  94   HGNLVKCVDPLCAAIQSAPNPPCVNPNEQCDYEVEYADQGSSLGVLVRDII  144



>gb|KHN32026.1| Aspartic proteinase Asp1 [Glycine soja]
Length=572

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP+G YF  + +GNPP+ YF+D DTGSDLTW+QCDAPC+ C K  H LYKP 
Sbjct  179  VFPVSGNVYPDGLYFTILRVGNPPKSYFLDVDTGSDLTWMQCDAPCISCGKGAHVLYKPT  238

Query  494  NDLVICK-DPLCASLHVGDYTC---ESPTQCDYDVEYADGGSSLGVLVND  631
               V+   D LC  +          ES  QCDY+++YAD  SSLGVLV D
Sbjct  239  RSNVVSSVDALCLDVQKNQKNGHHDESLLQCDYEIQYADHSSSLGVLVRD  288



>ref|XP_006303534.1| hypothetical protein CARUB_v10010968mg [Capsella rubella]
 gb|EOA36432.1| hypothetical protein CARUB_v10010968mg [Capsella rubella]
Length=406

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 77/111 (69%), Gaps = 2/111 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            IV P+ GNV+P G+Y   + IGNPP+ +  D DTGSDLTW+QC+APC  CT  P   YKP
Sbjct  36   IVFPISGNVFPLGYYSVLLRIGNPPKAFQFDIDTGSDLTWVQCNAPCSGCTVLPPLQYKP  95

Query  491  NNDLVICKDPLCASLHVGDYT-CESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             ++ V C +P+C+SLH  +   C +P  QCDYDVEYAD GSS+G LV D F
Sbjct  96   KSNTVPCSNPICSSLHWPNKPHCPNPKEQCDYDVEYADQGSSMGALVTDTF  146



>ref|XP_007152781.1| hypothetical protein PHAVU_004G159200g [Phaseolus vulgaris]
 gb|ESW24775.1| hypothetical protein PHAVU_004G159200g [Phaseolus vulgaris]
Length=572

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 71/109 (65%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNV+P+G YF  + +GNPPR YF+D DTGSDLTW+QCDAPC+ C K  H  YKP 
Sbjct  180  VFPVSGNVFPDGLYFTILRVGNPPRSYFLDVDTGSDLTWMQCDAPCISCGKGAHAQYKPT  239

Query  494  NDLVI-CKDPLCASLHVG--DYTCESPTQCDYDVEYADGGSSLGVLVND  631
               V+   D LC  +     D   ES  QCDY +EYAD  SSLGVL+ D
Sbjct  240  RSNVVPSMDSLCLDVQKNQKDGHHESLQQCDYQIEYADQSSSLGVLIRD  288



>emb|CDY10133.1| BnaC05g03760D [Brassica napus]
Length=427

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 76/112 (68%), Gaps = 2/112 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
             V PL GNV+P G+Y   + IGNPP+ +  D DTGSDLTW+QCDAPC  CT      YKP
Sbjct  40   FVFPLSGNVFPLGYYSVSLQIGNPPKDFTFDVDTGSDLTWVQCDAPCSGCTVRTELQYKP  99

Query  491  NNDLVICKDPLCASLH-VGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
             ++ V C DP+C++LH      C++P  QCDY++EYAD GSS+G LV D FS
Sbjct  100  KSNTVPCSDPICSALHWPKKPECQNPKDQCDYEIEYADQGSSIGALVVDQFS  151



>ref|XP_001782061.1| predicted protein [Physcomitrella patens]
 gb|EDQ53125.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 3/107 (3%)
 Frame = +2

Query  329  GNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVI  508
            GN+YP+G Y+  + +G+PP+ YF+D DTGSDLTW QCDAPC +C   PH LY P    V+
Sbjct  32   GNIYPDGLYYMALLLGSPPKLYFLDMDTGSDLTWAQCDAPCRNCAIGPHGLYNPKKAKVV  91

Query  509  -CKDPLCASLHV-GDYTCESPT-QCDYDVEYADGGSSLGVLVNDVFS  640
             C  P+CA +   G Y C S   QCDY+VEYADG S++GVLV D  +
Sbjct  92   DCHLPVCAQIQQGGSYECNSDVKQCDYEVEYADGSSTMGVLVEDTLT  138



>ref|XP_006355805.1| PREDICTED: aspartic proteinase Asp1-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006355806.1| PREDICTED: aspartic proteinase Asp1-like isoform X3 [Solanum 
tuberosum]
Length=363

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +2

Query  350  FYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVICKDPLCA  529
            +Y   +++G PP+PYF+D DTGSDLTWLQCDAPCV C  APH  YKPN ++V  KDP+CA
Sbjct  4    YYQVTLNVGQPPKPYFLDIDTGSDLTWLQCDAPCVKCIPAPHSPYKPNKNVVKHKDPICA  63

Query  530  SLHV-GDYTCESP-TQCDYDVEYADGGSSLGVLVNDVF  637
            SLH   ++   +P  QCDY+VEYAD  SSLGVLV D F
Sbjct  64   SLHSPANHPRHTPDDQCDYEVEYADHCSSLGVLVRDAF  101



>gb|EMS62785.1| Aspartic proteinase Asp1 [Triticum urartu]
Length=412

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 72/110 (65%), Gaps = 2/110 (2%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP-  490
            V  L G VYP G Y   ++IG+P +PYF+D DTGSDL+WLQCDAPC  C K PHP YKP 
Sbjct  42   VFQLQGAVYPIGHYHVTMNIGDPAKPYFLDVDTGSDLSWLQCDAPCPSCNKVPHPWYKPT  101

Query  491  NNDLVICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVNDVFS  640
             N +V C   LC SL   +  C  P QCDY ++Y D  +SLGVL+ D F+
Sbjct  102  KNKIVPCAASLCTSLSP-NKKCAVPQQCDYQIKYTDKATSLGVLIADNFT  150



>ref|XP_006588295.1| PREDICTED: lysine-specific histone demethylase 1 homolog 1-like 
[Glycine max]
Length=1430

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 72/110 (65%), Gaps = 4/110 (4%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNVYP+G YF  + +GNPP+ YF+D DTGSDLTW+QCDAPC+ C K  H LYKP 
Sbjct  179  VFPVSGNVYPDGLYFTILRVGNPPKSYFLDVDTGSDLTWMQCDAPCISCGKGAHVLYKPT  238

Query  494  NDLVICK-DPLCASLHVGDYTC---ESPTQCDYDVEYADGGSSLGVLVND  631
               V+   D LC  +          ES  QCDY+++YAD  SSLGVLV D
Sbjct  239  RSNVVSSVDALCLDVQKNQKNGHHDESLLQCDYEIQYADHSSSLGVLVRD  288



>ref|XP_007152782.1| hypothetical protein PHAVU_004G159200g [Phaseolus vulgaris]
 gb|ESW24776.1| hypothetical protein PHAVU_004G159200g [Phaseolus vulgaris]
Length=579

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/109 (54%), Positives = 71/109 (65%), Gaps = 3/109 (3%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPN  493
            V P+ GNV+P+G YF  + +GNPPR YF+D DTGSDLTW+QCDAPC+ C K  H  YKP 
Sbjct  180  VFPVSGNVFPDGLYFTILRVGNPPRSYFLDVDTGSDLTWMQCDAPCISCGKGAHAQYKPT  239

Query  494  NDLVI-CKDPLCASLHVG--DYTCESPTQCDYDVEYADGGSSLGVLVND  631
               V+   D LC  +     D   ES  QCDY +EYAD  SSLGVL+ D
Sbjct  240  RSNVVPSMDSLCLDVQKNQKDGHHESLQQCDYQIEYADQSSSLGVLIRD  288



>gb|ABR18371.1| unknown [Picea sitchensis]
Length=446

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 72/111 (65%), Gaps = 5/111 (5%)
 Frame = +2

Query  314  VLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYK-P  490
            +  L GNV P G Y+  + +GNP +PYF+D D+GS+LTW+QCDAPC+ C K PHPLYK  
Sbjct  66   IFSLKGNVVPYGLYYVTMLVGNPSKPYFLDVDSGSELTWIQCDAPCISCAKGPHPLYKLK  125

Query  491  NNDLVICKDPLCASLHVGD----YTCESPTQCDYDVEYADGGSSLGVLVND  631
               LV  KDPLCA++  G        E+  +CDYDV YAD G S G LV D
Sbjct  126  KGSLVPSKDPLCAAVQAGSGHYHNHKEASQRCDYDVAYADHGYSEGFLVRD  176



>ref|XP_007137426.1| hypothetical protein PHAVU_009G126200g [Phaseolus vulgaris]
 gb|ESW09420.1| hypothetical protein PHAVU_009G126200g [Phaseolus vulgaris]
Length=416

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +2

Query  323  LYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDL  502
            + GNVYP G+Y   + IGNPP+ Y +D DTGSDLTWLQCDAPC  CT   + LYKP  +L
Sbjct  51   IKGNVYPIGYYTVNLAIGNPPKLYDLDIDTGSDLTWLQCDAPCKGCTIPHNRLYKPRGNL  110

Query  503  VICKDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
            V C DPLC  +        +  QCDY+VEYAD GSSLGVLV D
Sbjct  111  VKCVDPLCTGVQSAPPCAVTNEQCDYEVEYADQGSSLGVLVRD  153



>ref|XP_010532199.1| PREDICTED: aspartic proteinase Asp1 [Tarenaya hassleriana]
Length=414

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 73/109 (67%), Gaps = 2/109 (2%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +V PL GNV+P G+Y   + IGNPP+ +  D DTGSDL W+QCDAPC  CT      YKP
Sbjct  45   VVFPLSGNVFPLGYYSVSLRIGNPPKAFDFDVDTGSDLAWVQCDAPCSGCTLPRERQYKP  104

Query  491  NNDLVICKDPLCASLHVGDY-TCESPT-QCDYDVEYADGGSSLGVLVND  631
              ++V C DPLC +LH  +   C  PT QCDY+V YAD GSS+GVLV D
Sbjct  105  MRNMVQCSDPLCLALHFPNKPKCLKPTDQCDYEVSYADQGSSMGVLVID  153



>ref|XP_002302227.1| nucellin family protein [Populus trichocarpa]
 gb|EEE81500.1| nucellin family protein [Populus trichocarpa]
Length=422

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 76/110 (69%), Gaps = 3/110 (3%)
 Frame = +2

Query  311  IVLPLYGNVYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKP  490
            +   + GNVYP G Y   ++IGNPP+ + +D DTGSDLTW+QCDAPC  CTK    LYKP
Sbjct  54   VFFRVTGNVYPTGHYSVILNIGNPPKAFDLDIDTGSDLTWVQCDAPCKGCTKPLDKLYKP  113

Query  491  NNDLVICKDPLCASLHVGDYTCESPT-QCDYDVEYADGGSSLGVLVNDVF  637
             N+ V C   LC ++   +  C+ PT QCDY+VEYAD GSSLGVL++D F
Sbjct  114  KNNRVPCASSLCQAIQ--NNNCDIPTEQCDYEVEYADLGSSLGVLLSDYF  161



>ref|XP_003563970.2| PREDICTED: aspartic proteinase Asp1-like [Brachypodium distachyon]
Length=496

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 67/100 (67%), Gaps = 1/100 (1%)
 Frame = +2

Query  335  VYPNGFYFAQVDIGNPPRPYFVDPDTGSDLTWLQCDAPCVHCTKAPHPLYKPNNDLVIC-  511
            V P   Y+  ++IGNPPRPYF+D DTGSD TW+ CDAPC +CTK PHP+YKP    ++  
Sbjct  111  VVPERQYYTSINIGNPPRPYFLDIDTGSDFTWIHCDAPCTNCTKGPHPVYKPTEGKIVHP  170

Query  512  KDPLCASLHVGDYTCESPTQCDYDVEYADGGSSLGVLVND  631
            +DPLC  L      CE+  QCDY++ YAD  SS GVL  D
Sbjct  171  RDPLCEELQGNQNYCETCKQCDYEITYADRSSSKGVLARD  210



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750