BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF042M01

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623669.1|  PREDICTED: rhodanese-like domain-containing ...    186   1e-52   Nicotiana tomentosiformis
ref|XP_009761641.1|  PREDICTED: rhodanese-like domain-containing ...    184   6e-52   Nicotiana sylvestris
ref|XP_006339688.1|  PREDICTED: rhodanese-like domain-containing ...    169   4e-46   Solanum tuberosum [potatoes]
gb|KDP28507.1|  hypothetical protein JCGZ_14278                         163   8e-44   Jatropha curcas
ref|XP_004248078.2|  PREDICTED: rhodanese-like domain-containing ...    164   1e-43   
ref|XP_002523373.1|  chitinase, putative                                167   1e-43   
ref|XP_010326928.1|  PREDICTED: rhodanese-like domain-containing ...    162   2e-43   Solanum lycopersicum
ref|XP_007051588.1|  Thylakoid rhodanese-like, putative isoform 3       158   6e-43   
ref|XP_009789972.1|  PREDICTED: rhodanese-like domain-containing ...    161   9e-43   Nicotiana sylvestris
ref|XP_010266472.1|  PREDICTED: rhodanese-like domain-containing ...    160   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_007051591.1|  Thylakoid rhodanese-like, putative isoform 6       158   1e-42   
ref|XP_007051587.1|  Thylakoid rhodanese-like, putative isoform 2       157   3e-42   
ref|XP_007051589.1|  Thylakoid rhodanese-like, putative isoform 4       157   4e-42   
gb|KHG13147.1|  hypothetical protein F383_04098                         158   1e-41   Gossypium arboreum [tree cotton]
gb|KHG13146.1|  hypothetical protein F383_04098                         158   1e-41   Gossypium arboreum [tree cotton]
ref|XP_007051586.1|  Thylakoid rhodanese-like, putative isoform 1       157   1e-41   
ref|XP_010261520.1|  PREDICTED: rhodanese-like domain-containing ...    157   2e-41   Nelumbo nucifera [Indian lotus]
gb|KDO86425.1|  hypothetical protein CISIN_1g013011mg                   152   9e-41   Citrus sinensis [apfelsine]
gb|KJB24584.1|  hypothetical protein B456_004G152500                    154   1e-40   Gossypium raimondii
gb|KJB24583.1|  hypothetical protein B456_004G152500                    154   2e-40   Gossypium raimondii
ref|XP_009601089.1|  PREDICTED: rhodanese-like domain-containing ...    154   2e-40   Nicotiana tomentosiformis
gb|KJB24582.1|  hypothetical protein B456_004G152500                    154   3e-40   Gossypium raimondii
ref|XP_006366560.1|  PREDICTED: rhodanese-like domain-containing ...    153   6e-40   Solanum tuberosum [potatoes]
gb|KDO86422.1|  hypothetical protein CISIN_1g013011mg                   152   1e-39   Citrus sinensis [apfelsine]
ref|XP_006491251.1|  PREDICTED: rhodanese-like domain-containing ...    152   1e-39   Citrus sinensis [apfelsine]
gb|KDO86421.1|  hypothetical protein CISIN_1g013011mg                   151   2e-39   Citrus sinensis [apfelsine]
ref|XP_006444874.1|  hypothetical protein CICLE_v10020161mg             151   2e-39   Citrus clementina [clementine]
ref|XP_010095787.1|  Uncharacterized protein L484_017594                152   2e-38   
ref|XP_008233203.1|  PREDICTED: rhodanese-like domain-containing ...    148   3e-38   Prunus mume [ume]
emb|CDP08699.1|  unnamed protein product                                148   4e-38   Coffea canephora [robusta coffee]
ref|XP_010055036.1|  PREDICTED: rhodanese-like domain-containing ...    145   2e-37   
ref|XP_011468943.1|  PREDICTED: rhodanese-like domain-containing ...    145   4e-37   Fragaria vesca subsp. vesca
ref|XP_002302622.2|  hydroxyproline-rich glycoprotein                   140   2e-35   Populus trichocarpa [western balsam poplar]
ref|XP_010661901.1|  PREDICTED: rhodanese-like domain-containing ...    140   2e-35   Vitis vinifera
ref|XP_002320855.1|  hydroxyproline-rich glycoprotein                   140   2e-35   Populus trichocarpa [western balsam poplar]
gb|AEQ94146.1|  hydroxyproline rich glycoprotein                        138   3e-35   Elaeis guineensis
gb|EYU38901.1|  hypothetical protein MIMGU_mgv1a006323mg                140   3e-35   Erythranthe guttata [common monkey flower]
gb|KGN56436.1|  hypothetical protein Csa_3G119690                       138   1e-34   Cucumis sativus [cucumbers]
ref|XP_011023203.1|  PREDICTED: rhodanese-like domain-containing ...    138   1e-34   Populus euphratica
ref|XP_010424692.1|  PREDICTED: rhodanese-like domain-containing ...    132   4e-34   
ref|XP_004155243.1|  PREDICTED: uncharacterized LOC101206972            140   5e-34   
ref|XP_010915675.1|  PREDICTED: rhodanese-like domain-containing ...    136   5e-34   Elaeis guineensis
ref|XP_011037916.1|  PREDICTED: rhodanese-like domain-containing ...    136   6e-34   Populus euphratica
ref|XP_004134307.1|  PREDICTED: uncharacterized protein LOC101206972    139   6e-34   
ref|NP_567209.1|  thylakoid rhodanese-like protein                      135   1e-33   Arabidopsis thaliana [mouse-ear cress]
emb|CAB80914.1|  hypothetical protein                                   134   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427922.1|  PREDICTED: rhodanese-like domain-containing ...    134   4e-33   Camelina sativa [gold-of-pleasure]
ref|XP_007135235.1|  hypothetical protein PHAVU_010G112100g             134   4e-33   Phaseolus vulgaris [French bean]
ref|XP_007135236.1|  hypothetical protein PHAVU_010G112100g             134   5e-33   Phaseolus vulgaris [French bean]
ref|XP_006286665.1|  hypothetical protein CARUB_v10002584mg             134   6e-33   Capsella rubella
ref|XP_009421248.1|  PREDICTED: rhodanese-like domain-containing ...    134   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783830.1|  PREDICTED: rhodanese-like domain-containing ...    132   1e-32   Phoenix dactylifera
ref|XP_003528797.1|  PREDICTED: rhodanese-like domain-containing ...    132   1e-32   Glycine max [soybeans]
gb|AAB61039.1|  A_IG002N01.31 gene product                              135   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456200.1|  PREDICTED: rhodanese-like domain-containing ...    132   3e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010422759.1|  PREDICTED: rhodanese-like domain-containing ...    132   6e-32   
ref|XP_003548475.1|  PREDICTED: rhodanese-like domain-containing ...    130   1e-31   Glycine max [soybeans]
ref|XP_006396307.1|  hypothetical protein EUTSA_v10028649mg             129   1e-31   Eutrema salsugineum [saltwater cress]
ref|XP_006396308.1|  hypothetical protein EUTSA_v10028649mg             129   2e-31   
ref|XP_004516405.1|  PREDICTED: rhodanese-like domain-containing ...    129   2e-31   Cicer arietinum [garbanzo]
gb|KHN06295.1|  Hypothetical protein glysoja_021133                     128   3e-31   Glycine soja [wild soybean]
ref|XP_010669158.1|  PREDICTED: rhodanese-like domain-containing ...    128   4e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|ACJ86240.1|  unknown                                                 128   5e-31   Medicago truncatula
gb|KEH18685.1|  thylakoid rhodanese-like protein                        128   6e-31   Medicago truncatula
ref|XP_002875001.1|  hypothetical protein ARALYDRAFT_352729             130   1e-30   
ref|XP_009111413.1|  PREDICTED: rhodanese-like domain-containing ...    125   3e-30   Brassica rapa
gb|KJB49531.1|  hypothetical protein B456_008G124200                    125   4e-30   Gossypium raimondii
gb|KHG21564.1|  hypothetical protein F383_26582                         125   4e-30   Gossypium arboreum [tree cotton]
ref|XP_009134504.1|  PREDICTED: LOW QUALITY PROTEIN: rhodanese-li...    126   4e-30   Brassica rapa
ref|XP_008437912.1|  PREDICTED: rhodanese-like domain-containing ...    125   7e-30   Cucumis melo [Oriental melon]
emb|CDX74366.1|  BnaA03g26810D                                          124   1e-29   
emb|CDY07169.1|  BnaCnng01840D                                          124   1e-29   
emb|CDY48498.1|  BnaA09g00250D                                          121   1e-28   Brassica napus [oilseed rape]
ref|XP_003637723.1|  hypothetical protein MTR_100s0011                  117   1e-28   
ref|XP_010534211.1|  PREDICTED: rhodanese-like domain-containing ...    121   1e-28   Tarenaya hassleriana [spider flower]
ref|XP_008350777.1|  PREDICTED: LOW QUALITY PROTEIN: rhodanese-li...    119   4e-28   
gb|KFK30681.1|  hypothetical protein AALP_AA6G014200                    117   4e-27   Arabis alpina [alpine rockcress]
ref|XP_009336808.1|  PREDICTED: rhodanese-like domain-containing ...    116   8e-27   Pyrus x bretschneideri [bai li]
ref|XP_009336810.1|  PREDICTED: rhodanese-like domain-containing ...    116   8e-27   Pyrus x bretschneideri [bai li]
emb|CDX91872.1|  BnaC03g31740D                                          116   6e-26   
emb|CBI40498.3|  unnamed protein product                                112   1e-25   Vitis vinifera
gb|EPS66030.1|  hypothetical protein M569_08743                         107   9e-24   Genlisea aurea
ref|XP_007219299.1|  hypothetical protein PRUPE_ppa018863mg             100   1e-21   
gb|ABR16588.1|  unknown                                               94.4    7e-19   Picea sitchensis
ref|XP_006847355.1|  hypothetical protein AMTR_s00015p00257490        92.8    2e-18   Amborella trichopoda
pdb|1VEE|A  Chain A, Nmr Structure Of The Hypothetical Rhodanese ...  73.9    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003572147.1|  PREDICTED: rhodanese-like domain-containing ...  74.3    4e-12   Brachypodium distachyon [annual false brome]
ref|XP_002451894.1|  hypothetical protein SORBIDRAFT_04g009380        66.6    1e-09   Sorghum bicolor [broomcorn]
gb|EMT20251.1|  hypothetical protein F775_01839                       65.9    1e-09   
gb|EMS45759.1|  hypothetical protein TRIUR3_22780                     65.9    2e-09   Triticum urartu
gb|EAY85255.1|  hypothetical protein OsI_06628                        65.1    5e-09   Oryza sativa Indica Group [Indian rice]
ref|NP_001046473.1|  Os02g0257300                                     65.1    5e-09   
ref|XP_004951282.1|  PREDICTED: rhodanese-like domain-containing ...  63.5    2e-08   Setaria italica
gb|AFW71054.1|  hypothetical protein ZEAMMB73_066102                  63.2    3e-08   
ref|XP_008681054.1|  PREDICTED: uncharacterized protein LOC100192...  62.4    4e-08   Zea mays [maize]
ref|NP_001131286.1|  uncharacterized protein LOC100192599             62.4    4e-08   Zea mays [maize]
ref|XP_002991602.1|  hypothetical protein SELMODRAFT_448468           60.1    2e-07   Selaginella moellendorffii
ref|XP_002971531.1|  hypothetical protein SELMODRAFT_441569           60.1    2e-07   Selaginella moellendorffii
ref|XP_007049538.1|  Rhodanese/Cell cycle control phosphatase sup...  54.3    2e-05   
ref|XP_004149327.1|  PREDICTED: rhodanese-like domain-containing ...  52.4    7e-05   
ref|XP_002527287.1|  chitinase, putative                              51.6    2e-04   
gb|EYU46074.1|  hypothetical protein MIMGU_mgv1a008760mg              51.6    2e-04   Erythranthe guttata [common monkey flower]
gb|KGN44672.1|  hypothetical protein Csa_7G368730                     51.6    2e-04   Cucumis sativus [cucumbers]
ref|XP_008458097.1|  PREDICTED: rhodanese-like domain-containing ...  51.2    2e-04   Cucumis melo [Oriental melon]
ref|XP_006469347.1|  PREDICTED: rhodanese-like domain-containing ...  50.4    4e-04   
ref|XP_006447940.1|  hypothetical protein CICLE_v10016082mg           50.4    4e-04   
gb|KDO43509.1|  hypothetical protein CISIN_1g039798mg                 49.7    5e-04   Citrus sinensis [apfelsine]
emb|CAN80760.1|  hypothetical protein VITISV_014603                   50.4    6e-04   Vitis vinifera
ref|XP_010678998.1|  PREDICTED: rhodanese-like domain-containing ...  49.7    6e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP45207.1|  hypothetical protein JCGZ_15072                       49.7    7e-04   Jatropha curcas
ref|XP_004493040.1|  PREDICTED: rhodanese-like domain-containing ...  49.7    8e-04   
ref|XP_002271020.2|  PREDICTED: rhodanese-like domain-containing ...  49.7    8e-04   



>ref|XP_009623669.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana tomentosiformis]
Length=437

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 158/186 (85%), Gaps = 5/186 (3%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  285
            MEA++A+RLTPLSVLS+RRNEP+KIP  P S PFK+L S   +E++SRNV+GGLVLLSS 
Sbjct  1    MEAIHAVRLTPLSVLSDRRNEPKKIPSHPISFPFKNLCS---VESLSRNVQGGLVLLSSA  57

Query  286  mssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
            +++GLAKALTYEEAL+Q  TS + DFD + V+ETVTTFA DNP+++ GGV  LA+PL++ 
Sbjct  58   LTTGLAKALTYEEALEQSTTSPAADFDATAVVETVTTFASDNPLVIVGGVVALALPLVLF  117

Query  460  QLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  639
            Q+L KPK WGVESAKTAYAKL DD +AQLLDIR   EL+EVGSPDIRGLKKKPVTV+Y G
Sbjct  118  QVLEKPKSWGVESAKTAYAKLGDDESAQLLDIRAPAELREVGSPDIRGLKKKPVTVAYKG  177

Query  640  EDKPGF  657
            EDKPGF
Sbjct  178  EDKPGF  183



>ref|XP_009761641.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana sylvestris]
Length=441

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 158/186 (85%), Gaps = 5/186 (3%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  285
            MEA+NA+R+TPLSVLS+RRNEP+KIP  P S PFK+L S   +E+ISRNV+GGLVLLSS 
Sbjct  1    MEAINAVRVTPLSVLSDRRNEPKKIPSHPISFPFKNLCS---VESISRNVQGGLVLLSSA  57

Query  286  mssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
            +++GLAKALTYEEAL+Q  TS + DFD + V+ETVTTFA DNP+++AGGV  LA+P+++ 
Sbjct  58   LTTGLAKALTYEEALEQSTTSPAADFDATAVVETVTTFASDNPLVIAGGVVALALPVVLF  117

Query  460  QLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  639
            Q+L KPK WGVESAKTAYAKL DD +AQLLDIR   EL+EVGSPDIRGLKKK VTV+Y G
Sbjct  118  QVLEKPKSWGVESAKTAYAKLGDDESAQLLDIRAPAELREVGSPDIRGLKKKAVTVAYKG  177

Query  640  EDKPGF  657
            EDKPGF
Sbjct  178  EDKPGF  183



>ref|XP_006339688.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=442

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 155/187 (83%), Gaps = 6/187 (3%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  285
            MEA+NA+RLTPLSVLS+RRNE +KIP  P S PFK+L S   +E +SRNV+GGLVL+SSV
Sbjct  1    MEAINAVRLTPLSVLSDRRNEAKKIPSHPISFPFKNLCS---VENLSRNVQGGLVLVSSV  57

Query  286  mssglAKALTYEEALQQTSVS--TDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
            +++GLAKALTYEE L+Q++ S   +FD + V+ETVTTFA +NP+I+AGG A LA+P+++ 
Sbjct  58   LNTGLAKALTYEETLEQSATSPGAEFDATAVVETVTTFASENPIIIAGGFAALALPIVLF  117

Query  460  QLLSKP-KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            Q+L KP K WGVESAKTAYAKLADDA AQLLDIR   EL+EVGSPDIRGLKKKPVTV Y 
Sbjct  118  QVLGKPPKSWGVESAKTAYAKLADDAGAQLLDIRAPAELREVGSPDIRGLKKKPVTVVYK  177

Query  637  GEDKPGF  657
             EDK GF
Sbjct  178  SEDKTGF  184



>gb|KDP28507.1| hypothetical protein JCGZ_14278 [Jatropha curcas]
Length=444

 Score =   163 bits (412),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 142/193 (74%), Gaps = 9/193 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpl-------lpsslpfkslsssnsMEAISRNvkgg  264
            MEA+NA  LTP+SVL E+R EPRK            SS    S +     E +SR   G 
Sbjct  1    MEALNAANLTPISVLCEKRAEPRKFLCLPTTSPLKFSSSASISTNPPTIQECLSRTFHGS  60

Query  265  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  438
            LVLLSSV+S+GLAKALTYEEAL+Q+  S ++DFD SGV+++V +FA +NP I+AG VA+L
Sbjct  61   LVLLSSVLSTGLAKALTYEEALEQSLSSPTSDFDSSGVLDSVISFATENPTIIAGSVAVL  120

Query  439  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  618
            AVPL+VSQ+L KPK WGVESAK AYA L DDANAQLLDIR   E ++VG+PDIRG KKKP
Sbjct  121  AVPLIVSQILKKPKSWGVESAKKAYAVLGDDANAQLLDIRAPVEFRKVGTPDIRGFKKKP  180

Query  619  VTVSYNGEDKPGF  657
            V++ Y GEDKPGF
Sbjct  181  VSIFYQGEDKPGF  193



>ref|XP_004248078.2| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Solanum lycopersicum]
Length=486

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 121/194 (62%), Positives = 148/194 (76%), Gaps = 5/194 (3%)
 Frame = +1

Query  91   IKI-YAMEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkggl  267
            IKI  AMEA+NA RLTP+SV S+RRNEP+KIP         + + S S+E ISRNV+GGL
Sbjct  7    IKIPLAMEALNAARLTPVSVFSDRRNEPKKIPSFQFKNFPNAANLSRSVEGISRNVQGGL  66

Query  268  vllssvmssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvaila  441
            VLLSSV ++GLAKALTYEEALQQ  TS S+DFD +  +ET+T F  DNP+++AGG A+L 
Sbjct  67   VLLSSVFNTGLAKALTYEEALQQSTTSTSSDFDANAFVETLTDFVSDNPLVIAGGFAVLG  126

Query  442  vpllvSQLLSK-PKP-WGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  615
            +P +VSQ+  K PKP WGVESAK AYAKLADD +++L+DIR   ELK+ GSPDI   KKK
Sbjct  127  LPFIVSQVFGKMPKPSWGVESAKKAYAKLADDVSSELVDIRATAELKQEGSPDIGAFKKK  186

Query  616  PVTVSYNGEDKPGF  657
            PVT+ Y GEDK GF
Sbjct  187  PVTIVYKGEDKTGF  200



>ref|XP_002523373.1| chitinase, putative [Ricinus communis]
 gb|EEF39089.1| chitinase, putative [Ricinus communis]
Length=938

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 148/196 (76%), Gaps = 8/196 (4%)
 Frame = +1

Query  94   KIYAMEAVNALRLTPLSVLSERRNEPRKIpl------lpsslpfkslsssnsMEAISRNv  255
            K YAMEA+NA  LTP+SVL E+RNEPRKI          S     S +S +  + +SR+ 
Sbjct  503  KNYAMEALNAAGLTPISVLCEKRNEPRKIWCPPTSPLKFSGSAPLSTTSLSLQDCLSRSY  562

Query  256  kgglvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggv  429
             G LV+LSSV+S+GLAKALTYEEALQQ+  + +++ D SGV++ V +FA +NPV++AGG 
Sbjct  563  SGSLVVLSSVLSTGLAKALTYEEALQQSAGTAASESDASGVLDNVISFATENPVVIAGGA  622

Query  430  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  609
             +LAVPL++SQ+L KPK WGVESAK AYA L DDANAQLLDIR   EL++VG+PDIRG K
Sbjct  623  VVLAVPLILSQILKKPKSWGVESAKKAYALLGDDANAQLLDIRAPVELRKVGTPDIRGFK  682

Query  610  KKPVTVSYNGEDKPGF  657
            KKPV +SYNGEDK GF
Sbjct  683  KKPVPISYNGEDKTGF  698



>ref|XP_010326928.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Solanum lycopersicum]
Length=442

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 152/187 (81%), Gaps = 6/187 (3%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  285
            MEA+NA+RLTPLSV S+R+NE +KIP  P S PFK+L S   +E +SRNV+GGLVL+SSV
Sbjct  1    MEAINAVRLTPLSVRSDRKNEAKKIPSHPISFPFKNLCS---VENLSRNVQGGLVLVSSV  57

Query  286  mssglAKALTYEEALQQTSV--STDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
            +++GLAKALTYEE ++Q+      +FD + V+ETVTTFA +NP+I+AGG A LA+P+++ 
Sbjct  58   LNTGLAKALTYEETIEQSETIPGAEFDATAVVETVTTFASENPIIIAGGFAALALPIVLF  117

Query  460  QLLSKP-KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            Q+L KP K WGVESAKTAYAKLADDA AQLLDIR   EL+EVG+PDIRGLKKKPVTV Y 
Sbjct  118  QVLGKPPKSWGVESAKTAYAKLADDAGAQLLDIRATAELREVGTPDIRGLKKKPVTVVYK  177

Query  637  GEDKPGF  657
             EDK GF
Sbjct  178  AEDKTGF  184



>ref|XP_007051588.1| Thylakoid rhodanese-like, putative isoform 3 [Theobroma cacao]
 ref|XP_007051590.1| Thylakoid rhodanese-like, putative isoform 3 [Theobroma cacao]
 gb|EOX95745.1| Thylakoid rhodanese-like, putative isoform 3 [Theobroma cacao]
 gb|EOX95747.1| Thylakoid rhodanese-like, putative isoform 3 [Theobroma cacao]
Length=331

 Score =   158 bits (400),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 142/194 (73%), Gaps = 10/194 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  264
            MEA+NA  LTPLSVL ERR + RK+  L  + P K  +S+  +       E +SR++  G
Sbjct  1    MEALNAASLTPLSVLCERRAKTRKVSSLSIASPPKVPTSAAFIKTPPSLQECLSRSLHRG  60

Query  265  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  435
            +VLLSSV++SG AKAL+YEEALQQT   S S   D +GV+++V +F  +NP +VAGG   
Sbjct  61   IVLLSSVLTSGAAKALSYEEALQQTKDFSSSFGLDSNGVVDSVVSFVTENPTVVAGGAVA  120

Query  436  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  615
            LAVPL++SQLL  PKPWGVESAK+AYAKL DDA AQLLDIR  +E +EVGSPD+RG  KK
Sbjct  121  LAVPLILSQLLKNPKPWGVESAKSAYAKLGDDATAQLLDIRAIKEFREVGSPDVRGFGKK  180

Query  616  PVTVSYNGEDKPGF  657
            PV++++  EDKPGF
Sbjct  181  PVSITFKNEDKPGF  194



>ref|XP_009789972.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana sylvestris]
Length=481

 Score =   161 bits (407),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 150/191 (79%), Gaps = 7/191 (4%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKI-pllpsslpfkslsssnsMEAISRNvkgglvllss  282
            MEA+NA RLTPLSV S+RRNEP+KI     S+    S +SSNS++ +SR V+GGLV+LSS
Sbjct  1    MEALNAARLTPLSVFSDRRNEPKKIPFKNLSNSANFSTNSSNSLDGLSRKVQGGLVVLSS  60

Query  283  vmssglAKALTYEEALQQ--TSVSTD-FDPSGVMETVTTFAGDNpvivaggvailavpll  453
            V ++ LA ALTYEEALQQ  TS STD FD +  +ETVT F  +NP+++AGG AILA+PL+
Sbjct  61   VFTTSLADALTYEEALQQSTTSTSTDEFDANAFVETVTNFVSENPLVIAGGFAILALPLV  120

Query  454  vSQLLS---KPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  624
            +SQ+LS   KPK WGVESAK AYAKL DD +++LLDIR   ELK+VGSPDIRGLKKK V+
Sbjct  121  LSQVLSNNNKPKAWGVESAKKAYAKLGDDESSELLDIRGPVELKQVGSPDIRGLKKKTVS  180

Query  625  VSYNGEDKPGF  657
            V Y GEDKPGF
Sbjct  181  VVYKGEDKPGF  191



>ref|XP_010266472.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nelumbo nucifera]
Length=461

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 151/202 (75%), Gaps = 13/202 (6%)
 Frame = +1

Query  91   IKIYAMEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISR  249
            I+ YAMEA+NA RLTP+SVLS+RR EPRKI  LPS+ P K    +NS        E + R
Sbjct  2    IENYAMEALNAARLTPVSVLSDRRTEPRKISSLPSTFPLKFSKFANSFVSTTNLPEVLLR  61

Query  250  NvkgglvllssvmssglAKALTYEEALQQTSVST------DFDPSGVMETVTTFAGDNpv  411
            +  G L++LSSV+S+GLA+ALTYEEAL+Q++ ++      DFD  G+++ V +F  +NP 
Sbjct  62   SFNGSLMVLSSVLSAGLARALTYEEALEQSTSTSTSGGGSDFDVGGLLDNVVSFGAENPA  121

Query  412  ivaggvailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSP  591
            I+ GGV I A+PL++SQ++ KPKPWG+ESAK A+AKLADD +AQLLDIR   E +EVGSP
Sbjct  122  IIVGGVTIFALPLVLSQVVKKPKPWGIESAKNAFAKLADDLDAQLLDIRAPVEFREVGSP  181

Query  592  DIRGLKKKPVTVSYNGEDKPGF  657
            DIRGLKKK V++ YNGEDK GF
Sbjct  182  DIRGLKKKAVSIVYNGEDKLGF  203



>ref|XP_007051591.1| Thylakoid rhodanese-like, putative isoform 6 [Theobroma cacao]
 gb|EOX95748.1| Thylakoid rhodanese-like, putative isoform 6 [Theobroma cacao]
Length=353

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 142/194 (73%), Gaps = 10/194 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  264
            MEA+NA  LTPLSVL ERR + RK+  L  + P K  +S+  +       E +SR++  G
Sbjct  1    MEALNAASLTPLSVLCERRAKTRKVSSLSIASPPKVPTSAAFIKTPPSLQECLSRSLHRG  60

Query  265  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  435
            +VLLSSV++SG AKAL+YEEALQQT   S S   D +GV+++V +F  +NP +VAGG   
Sbjct  61   IVLLSSVLTSGAAKALSYEEALQQTKDFSSSFGLDSNGVVDSVVSFVTENPTVVAGGAVA  120

Query  436  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  615
            LAVPL++SQLL  PKPWGVESAK+AYAKL DDA AQLLDIR  +E +EVGSPD+RG  KK
Sbjct  121  LAVPLILSQLLKNPKPWGVESAKSAYAKLGDDATAQLLDIRAIKEFREVGSPDVRGFGKK  180

Query  616  PVTVSYNGEDKPGF  657
            PV++++  EDKPGF
Sbjct  181  PVSITFKNEDKPGF  194



>ref|XP_007051587.1| Thylakoid rhodanese-like, putative isoform 2 [Theobroma cacao]
 gb|EOX95744.1| Thylakoid rhodanese-like, putative isoform 2 [Theobroma cacao]
Length=379

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 142/194 (73%), Gaps = 10/194 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  264
            MEA+NA  LTPLSVL ERR + RK+  L  + P K  +S+  +       E +SR++  G
Sbjct  1    MEALNAASLTPLSVLCERRAKTRKVSSLSIASPPKVPTSAAFIKTPPSLQECLSRSLHRG  60

Query  265  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  435
            +VLLSSV++SG AKAL+YEEALQQT   S S   D +GV+++V +F  +NP +VAGG   
Sbjct  61   IVLLSSVLTSGAAKALSYEEALQQTKDFSSSFGLDSNGVVDSVVSFVTENPTVVAGGAVA  120

Query  436  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  615
            LAVPL++SQLL  PKPWGVESAK+AYAKL DDA AQLLDIR  +E +EVGSPD+RG  KK
Sbjct  121  LAVPLILSQLLKNPKPWGVESAKSAYAKLGDDATAQLLDIRAIKEFREVGSPDVRGFGKK  180

Query  616  PVTVSYNGEDKPGF  657
            PV++++  EDKPGF
Sbjct  181  PVSITFKNEDKPGF  194



>ref|XP_007051589.1| Thylakoid rhodanese-like, putative isoform 4 [Theobroma cacao]
 gb|EOX95746.1| Thylakoid rhodanese-like, putative isoform 4 [Theobroma cacao]
Length=399

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 142/194 (73%), Gaps = 10/194 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  264
            MEA+NA  LTPLSVL ERR + RK+  L  + P K  +S+  +       E +SR++  G
Sbjct  1    MEALNAASLTPLSVLCERRAKTRKVSSLSIASPPKVPTSAAFIKTPPSLQECLSRSLHRG  60

Query  265  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  435
            +VLLSSV++SG AKAL+YEEALQQT   S S   D +GV+++V +F  +NP +VAGG   
Sbjct  61   IVLLSSVLTSGAAKALSYEEALQQTKDFSSSFGLDSNGVVDSVVSFVTENPTVVAGGAVA  120

Query  436  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  615
            LAVPL++SQLL  PKPWGVESAK+AYAKL DDA AQLLDIR  +E +EVGSPD+RG  KK
Sbjct  121  LAVPLILSQLLKNPKPWGVESAKSAYAKLGDDATAQLLDIRAIKEFREVGSPDVRGFGKK  180

Query  616  PVTVSYNGEDKPGF  657
            PV++++  EDKPGF
Sbjct  181  PVSITFKNEDKPGF  194



>gb|KHG13147.1| hypothetical protein F383_04098 [Gossypium arboreum]
Length=499

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 147/196 (75%), Gaps = 12/196 (6%)
 Frame = +1

Query  106  MEAVNAL--RLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvk  258
            M  +NA    LTPLSVLSE R E RK PLLP + P K  +S   +       + +SR + 
Sbjct  3    MRTLNAATPSLTPLSVLSETRTEARKAPLLPIASPLKLPNSPAFIKTQPALHQCLSRTLH  62

Query  259  gglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggv  429
            GGL+LLSS++ +G AKAL+YEEALQQT   S S DFDP+G+++TV +FA +NP +VAGG 
Sbjct  63   GGLLLLSSLLPNGFAKALSYEEALQQTTGSSSSVDFDPNGILDTVVSFATENPTVVAGGT  122

Query  430  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  609
              LAVPL++SQLL  PKPWGVESA++AYAKL DDA AQLLDIRP +E ++VGSPDI+G +
Sbjct  123  VALAVPLILSQLLKNPKPWGVESARSAYAKLGDDATAQLLDIRPLKESRDVGSPDIKGFR  182

Query  610  KKPVTVSYNGEDKPGF  657
            KKPV+++YNGEDKP F
Sbjct  183  KKPVSIAYNGEDKPVF  198



>gb|KHG13146.1| hypothetical protein F383_04098 [Gossypium arboreum]
Length=509

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 116/196 (59%), Positives = 147/196 (75%), Gaps = 12/196 (6%)
 Frame = +1

Query  106  MEAVNAL--RLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvk  258
            M  +NA    LTPLSVLSE R E RK PLLP + P K  +S   +       + +SR + 
Sbjct  3    MRTLNAATPSLTPLSVLSETRTEARKAPLLPIASPLKLPNSPAFIKTQPALHQCLSRTLH  62

Query  259  gglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggv  429
            GGL+LLSS++ +G AKAL+YEEALQQT   S S DFDP+G+++TV +FA +NP +VAGG 
Sbjct  63   GGLLLLSSLLPNGFAKALSYEEALQQTTGSSSSVDFDPNGILDTVVSFATENPTVVAGGT  122

Query  430  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  609
              LAVPL++SQLL  PKPWGVESA++AYAKL DDA AQLLDIRP +E ++VGSPDI+G +
Sbjct  123  VALAVPLILSQLLKNPKPWGVESARSAYAKLGDDATAQLLDIRPLKESRDVGSPDIKGFR  182

Query  610  KKPVTVSYNGEDKPGF  657
            KKPV+++YNGEDKP F
Sbjct  183  KKPVSIAYNGEDKPVF  198



>ref|XP_007051586.1| Thylakoid rhodanese-like, putative isoform 1 [Theobroma cacao]
 gb|EOX95743.1| Thylakoid rhodanese-like, putative isoform 1 [Theobroma cacao]
Length=430

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 142/194 (73%), Gaps = 10/194 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  264
            MEA+NA  LTPLSVL ERR + RK+  L  + P K  +S+  +       E +SR++  G
Sbjct  1    MEALNAASLTPLSVLCERRAKTRKVSSLSIASPPKVPTSAAFIKTPPSLQECLSRSLHRG  60

Query  265  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  435
            +VLLSSV++SG AKAL+YEEALQQT   S S   D +GV+++V +F  +NP +VAGG   
Sbjct  61   IVLLSSVLTSGAAKALSYEEALQQTKDFSSSFGLDSNGVVDSVVSFVTENPTVVAGGAVA  120

Query  436  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  615
            LAVPL++SQLL  PKPWGVESAK+AYAKL DDA AQLLDIR  +E +EVGSPD+RG  KK
Sbjct  121  LAVPLILSQLLKNPKPWGVESAKSAYAKLGDDATAQLLDIRAIKEFREVGSPDVRGFGKK  180

Query  616  PVTVSYNGEDKPGF  657
            PV++++  EDKPGF
Sbjct  181  PVSITFKNEDKPGF  194



>ref|XP_010261520.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nelumbo nucifera]
Length=450

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 151/197 (77%), Gaps = 13/197 (7%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvkgg  264
            MEA+NA+ L P+SVLS+RR EPR+I  LPS  PFK   S++S+       + +SR++ GG
Sbjct  1    MEALNAVGLPPVSVLSDRRTEPRRISSLPSISPFKFSKSASSVTSPPNLTDILSRSLNGG  60

Query  265  lvllssvmssglAKALTYEEALQQTSVST------DFDPSGVMETVTTFAGDNpvivagg  426
            LV+L+SV+S  LA+ALTYEEAL+Q+  ++      D D  G++++V +FA +NP I+ GG
Sbjct  61   LVVLTSVLSGELARALTYEEALEQSVSTSTSSSGPDVDAGGLVDSVVSFATENPAIIVGG  120

Query  427  vailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGL  606
              ILA+PL++SQ+L KPKPWGVESAK AYAKLADDA+AQLLDIR A E +EVGSPDIRGL
Sbjct  121  ATILALPLVLSQVLKKPKPWGVESAKNAYAKLADDADAQLLDIREAVEFREVGSPDIRGL  180

Query  607  KKKPVTVSYNGEDKPGF  657
            KKK V++ Y GEDKPGF
Sbjct  181  KKKAVSIVYKGEDKPGF  197



>gb|KDO86425.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=330

 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 144/193 (75%), Gaps = 9/193 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  264
            MEA+N   L PLSVL +RR+EPRKI  L ++             +  N +E  +++V GG
Sbjct  1    MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGG  60

Query  265  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  438
            LVLLSSV+ +GLA+ALTYEEALQQ+  S ++D D SG +++V +F  +NP+ +AGGV IL
Sbjct  61   LVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTIL  120

Query  439  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  618
            AVPL++SQ+L+KPK WGVESA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL K+P
Sbjct  121  AVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRP  180

Query  619  VTVSYNGEDKPGF  657
            V++ Y G+DKPGF
Sbjct  181  VSIVYKGDDKPGF  193



>gb|KJB24584.1| hypothetical protein B456_004G152500 [Gossypium raimondii]
Length=437

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 145/196 (74%), Gaps = 12/196 (6%)
 Frame = +1

Query  106  MEAVNAL--RLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvk  258
            M  +NA    LTPLSVLSE R E RK PLLP + P K  +S   +       +  SR + 
Sbjct  3    MRTLNAATPSLTPLSVLSETRTETRKAPLLPIASPLKLPNSPAFIKTQPALHQCFSRTLH  62

Query  259  gglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggv  429
            GGL+LLSS++ +G AKAL+YEEALQQT   S S DFDP+G+++TV +F  ++P +VAGG 
Sbjct  63   GGLLLLSSLLPNGFAKALSYEEALQQTTGFSSSVDFDPNGILDTVVSFVTEHPTVVAGGT  122

Query  430  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  609
              LAVPL++S+LL  PKPWGVESA++AYAKL DDA AQLLDIRP +E ++VGSPDI+G  
Sbjct  123  VALAVPLILSRLLKNPKPWGVESARSAYAKLGDDATAQLLDIRPLKESRDVGSPDIKGFG  182

Query  610  KKPVTVSYNGEDKPGF  657
            KKPV+++YNGEDKPGF
Sbjct  183  KKPVSIAYNGEDKPGF  198



>gb|KJB24583.1| hypothetical protein B456_004G152500 [Gossypium raimondii]
Length=434

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 145/196 (74%), Gaps = 12/196 (6%)
 Frame = +1

Query  106  MEAVNAL--RLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvk  258
            M  +NA    LTPLSVLSE R E RK PLLP + P K  +S   +       +  SR + 
Sbjct  3    MRTLNAATPSLTPLSVLSETRTETRKAPLLPIASPLKLPNSPAFIKTQPALHQCFSRTLH  62

Query  259  gglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggv  429
            GGL+LLSS++ +G AKAL+YEEALQQT   S S DFDP+G+++TV +F  ++P +VAGG 
Sbjct  63   GGLLLLSSLLPNGFAKALSYEEALQQTTGFSSSVDFDPNGILDTVVSFVTEHPTVVAGGT  122

Query  430  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  609
              LAVPL++S+LL  PKPWGVESA++AYAKL DDA AQLLDIRP +E ++VGSPDI+G  
Sbjct  123  VALAVPLILSRLLKNPKPWGVESARSAYAKLGDDATAQLLDIRPLKESRDVGSPDIKGFG  182

Query  610  KKPVTVSYNGEDKPGF  657
            KKPV+++YNGEDKPGF
Sbjct  183  KKPVSIAYNGEDKPGF  198



>ref|XP_009601089.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Nicotiana tomentosiformis]
Length=481

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 147/191 (77%), Gaps = 7/191 (4%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKI-pllpsslpfkslsssnsMEAISRNvkgglvllss  282
            MEA+NA  LTPLSV S+RRNEP+KI     S+    S +SSNS+E +SR V+GGLV+LSS
Sbjct  1    MEALNAASLTPLSVFSDRRNEPKKIPFKNLSNSANFSTNSSNSLEILSRKVQGGLVVLSS  60

Query  283  vmssglAKALTYEEALQQTSVST---DFDPSGVMETVTTFAGDNpvivaggvailavpll  453
            V ++ LA ALTYEEALQQ++ ST   DFD +  +ETVT F  +NP+++AGG AILA+PL+
Sbjct  61   VFTTSLANALTYEEALQQSTTSTSTADFDANAFVETVTNFVSENPLVIAGGFAILALPLV  120

Query  454  vSQLLSKPKP---WGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  624
            +SQ+L   KP   WGVESAK AYA+L DD +++LLDIR   EL++VGSPDIRGLKKK V+
Sbjct  121  LSQVLGNNKPNKKWGVESAKKAYAELGDDESSELLDIRGPVELRQVGSPDIRGLKKKAVS  180

Query  625  VSYNGEDKPGF  657
            V Y GEDKPGF
Sbjct  181  VVYKGEDKPGF  191



>gb|KJB24582.1| hypothetical protein B456_004G152500 [Gossypium raimondii]
Length=498

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 114/196 (58%), Positives = 145/196 (74%), Gaps = 12/196 (6%)
 Frame = +1

Query  106  MEAVNAL--RLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM-------EAISRNvk  258
            M  +NA    LTPLSVLSE R E RK PLLP + P K  +S   +       +  SR + 
Sbjct  3    MRTLNAATPSLTPLSVLSETRTETRKAPLLPIASPLKLPNSPAFIKTQPALHQCFSRTLH  62

Query  259  gglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggv  429
            GGL+LLSS++ +G AKAL+YEEALQQT   S S DFDP+G+++TV +F  ++P +VAGG 
Sbjct  63   GGLLLLSSLLPNGFAKALSYEEALQQTTGFSSSVDFDPNGILDTVVSFVTEHPTVVAGGT  122

Query  430  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  609
              LAVPL++S+LL  PKPWGVESA++AYAKL DDA AQLLDIRP +E ++VGSPDI+G  
Sbjct  123  VALAVPLILSRLLKNPKPWGVESARSAYAKLGDDATAQLLDIRPLKESRDVGSPDIKGFG  182

Query  610  KKPVTVSYNGEDKPGF  657
            KKPV+++YNGEDKPGF
Sbjct  183  KKPVSIAYNGEDKPGF  198



>ref|XP_006366560.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Solanum tuberosum]
Length=479

 Score =   153 bits (387),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 144/193 (75%), Gaps = 9/193 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsM----EAISRNvkgglvl  273
            MEA+NA RL P+SV S+RRNE +KIP         S + S ++    E ISRNV+GGLVL
Sbjct  1    MEALNAARLNPVSVFSDRRNESKKIPSFQFKNLQNSSNFSTNLSRSVEGISRNVQGGLVL  60

Query  274  lssvmssglAKALTYEEALQQTSVST---DFDPSGVMETVTTFAGDNpvivaggvailav  444
            LSSV ++GLAKALTYEEALQQ++ ST   DFD +  +ET+T F  DNP+++AGG A+L +
Sbjct  61   LSSVFTTGLAKALTYEEALQQSTTSTSTNDFDANAFVETLTDFVSDNPLVIAGGFAVLGL  120

Query  445  pllvSQLLSK-PKP-WGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  618
            P +VSQ+  K PKP WGVESAK AYAKLADDA+++L+DIR   ELK+ G+PDI G KKKP
Sbjct  121  PFIVSQVFGKMPKPSWGVESAKKAYAKLADDASSELVDIRTTVELKQEGNPDISGFKKKP  180

Query  619  VTVSYNGEDKPGF  657
            VT+ Y GEDK GF
Sbjct  181  VTIVYKGEDKTGF  193



>gb|KDO86422.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=417

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 144/193 (75%), Gaps = 9/193 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  264
            MEA+N   L PLSVL +RR+EPRKI  L ++             +  N +E  +++V GG
Sbjct  1    MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGG  60

Query  265  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  438
            LVLLSSV+ +GLA+ALTYEEALQQ+  S ++D D SG +++V +F  +NP+ +AGGV IL
Sbjct  61   LVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTIL  120

Query  439  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  618
            AVPL++SQ+L+KPK WGVESA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL K+P
Sbjct  121  AVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRP  180

Query  619  VTVSYNGEDKPGF  657
            V++ Y G+DKPGF
Sbjct  181  VSIVYKGDDKPGF  193



>ref|XP_006491251.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|KDO86424.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=451

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 144/193 (75%), Gaps = 9/193 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  264
            MEA+N   L PLSVL +RR+EPRKI  L ++             +  N +E  +++V GG
Sbjct  1    MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGG  60

Query  265  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  438
            LVLLSSV+ +GLA+ALTYEEALQQ+  S ++D D SG +++V +F  +NP+ +AGGV IL
Sbjct  61   LVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTIL  120

Query  439  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  618
            AVPL++SQ+L+KPK WGVESA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL K+P
Sbjct  121  AVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRP  180

Query  619  VTVSYNGEDKPGF  657
            V++ Y G+DKPGF
Sbjct  181  VSIVYKGDDKPGF  193



>gb|KDO86421.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=442

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 144/193 (75%), Gaps = 9/193 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  264
            MEA+N   L PLSVL +RR+EPRKI  L ++             +  N +E  +++V GG
Sbjct  1    MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGG  60

Query  265  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  438
            LVLLSSV+ +GLA+ALTYEEALQQ+  S ++D D SG +++V +F  +NP+ +AGGV IL
Sbjct  61   LVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTIL  120

Query  439  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  618
            AVPL++SQ+L+KPK WGVESA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL K+P
Sbjct  121  AVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRP  180

Query  619  VTVSYNGEDKPGF  657
            V++ Y G+DKPGF
Sbjct  181  VSIVYKGDDKPGF  193



>ref|XP_006444874.1| hypothetical protein CICLE_v10020161mg [Citrus clementina]
 ref|XP_006491252.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR58114.1| hypothetical protein CICLE_v10020161mg [Citrus clementina]
 gb|KDO86423.1| hypothetical protein CISIN_1g013011mg [Citrus sinensis]
Length=443

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/193 (56%), Positives = 144/193 (75%), Gaps = 9/193 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  264
            MEA+N   L PLSVL +RR+EPRKI  L ++             +  N +E  +++V GG
Sbjct  1    MEALNPAGLIPLSVLCDRRSEPRKIQSLSTASLPKLATSASNKTTQQNFLECFAKSVHGG  60

Query  265  lvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvail  438
            LVLLSSV+ +GLA+ALTYEEALQQ+  S ++D D SG +++V +F  +NP+ +AGGV IL
Sbjct  61   LVLLSSVLGTGLAQALTYEEALQQSAGSSASDVDASGFIDSVISFGTENPLAIAGGVTIL  120

Query  439  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  618
            AVPL++SQ+L+KPK WGVESA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL K+P
Sbjct  121  AVPLVLSQVLNKPKSWGVESARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGLGKRP  180

Query  619  VTVSYNGEDKPGF  657
            V++ Y G+DKPGF
Sbjct  181  VSIVYKGDDKPGF  193



>ref|XP_010095787.1| Uncharacterized protein L484_017594 [Morus notabilis]
 gb|EXB62207.1| Uncharacterized protein L484_017594 [Morus notabilis]
Length=881

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 149/209 (71%), Gaps = 15/209 (7%)
 Frame = +1

Query  43   FHQSSQNI*RTLVHKGIKIYAMEAVNALRLTPLS-VLSERRNEPRKIpllpsslpfksls  219
            FH   +   +  +  G + YAMEA+NA  LTP+S VLS+R+ EPRK           S +
Sbjct  429  FHHLFERPQKNSLVVGDQNYAMEALNAAGLTPISAVLSDRKQEPRK-----------SSA  477

Query  220  ssnsMEAISRNvkgglvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTT  390
                +   SR ++GGLVLLSSV+++GLAKALTYEEALQQ+   S+    D +GV+ +   
Sbjct  478  VYPKLSNSSRKIQGGLVLLSSVLNTGLAKALTYEEALQQSVGSSLDGGLDVNGVLNSAIG  537

Query  391  FAGDNpvivaggvailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARE  570
            FA +NPV++AGG A+LAVPL+VSQLL  PKPWGVESA+ AYA+L +D++ QLLDIRP+ E
Sbjct  538  FASENPVVLAGGAAVLAVPLIVSQLLKNPKPWGVESARNAYARLGEDSSIQLLDIRPSVE  597

Query  571  LKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
             ++VGSPDIRGL KKPV++ Y GEDKPGF
Sbjct  598  FRQVGSPDIRGLGKKPVSIVYKGEDKPGF  626



>ref|XP_008233203.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Prunus mume]
Length=449

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 141/195 (72%), Gaps = 12/195 (6%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpl-------lpsslpfkslsssnsMEAISRNvkgg  264
            MEA+NA  LTPLSVL +R+ EPRK P          S+    S +   S E+ SR+  GG
Sbjct  1    MEALNAASLTPLSVLGDRKKEPRKFPSLPTISLPKFSNSTSLSTTPQASQESSSRSFHGG  60

Query  265  lvllssvmssglAKALTYEEALQQTSVST----DFDPSGVMETVTTFAGDNpvivaggva  432
            L+LLSSV ++G AKALTYEEAL Q SVST    D + SG+++ VT F  +NP ++AGG A
Sbjct  61   LLLLSSVFNTGFAKALTYEEALGQ-SVSTFTGGDLEASGILDNVTAFVTENPAVIAGGFA  119

Query  433  ilavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKK  612
            ILAVPL++SQ+L  PKPWGV++A++AYAKL DDANAQLLDIR   E+++VG+PD+RGL K
Sbjct  120  ILAVPLVLSQVLKPPKPWGVDTARSAYAKLGDDANAQLLDIRSPAEVRQVGTPDVRGLGK  179

Query  613  KPVTVSYNGEDKPGF  657
            K V + Y GEDKPGF
Sbjct  180  KAVPIVYKGEDKPGF  194



>emb|CDP08699.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 142/198 (72%), Gaps = 14/198 (7%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsME--------AISRNvkg  261
            MEA+NA+  TPLSVLSERR EPRK     +    K+  +  +          A+ + +  
Sbjct  1    MEALNAVGWTPLSVLSERRTEPRKYLPFHAVPQIKTRPTLANFRSDPAKVAGALPKTIGA  60

Query  262  glvllssvmssglAKALTYEEALQQT-----SVSTD-FDPSGVMETVTTFAGDNpvivag  423
            G+VLLSSV+ SG A+AL+YEEALQQ+     S+  D FD SGV+++VT F  +NP++V G
Sbjct  61   GIVLLSSVLGSGSAEALSYEEALQQSLGEFPSLDLDAFDVSGVIDSVTNFVAENPLVVGG  120

Query  424  gvailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRG  603
            GVAILAVPLL+S +  K KPWGVESAK AYA+L DDA+AQLLDIRP  EL++VGSPD+RG
Sbjct  121  GVAILAVPLLLSLVFGKSKPWGVESAKAAYARLNDDASAQLLDIRPPVELRQVGSPDVRG  180

Query  604  LKKKPVTVSYNGEDKPGF  657
            LKKKPV V+Y G+DK GF
Sbjct  181  LKKKPVAVAYKGDDKLGF  198



>ref|XP_010055036.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Eucalyptus grandis]
 gb|KCW71521.1| hypothetical protein EUGRSUZ_E00068 [Eucalyptus grandis]
Length=456

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 143/197 (73%), Gaps = 13/197 (7%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  264
            MEA+NA  LTP+SVL +R+ EPRK+  LPS+           S +S +  E +SR   GG
Sbjct  1    MEALNAAGLTPISVLRDRKREPRKVSSLPSNSPLKLWNSSSSSNASPSFQEPVSRGFHGG  60

Query  265  lvllssvmssglAKALTYEEALQQTSVST------DFDPSGVMETVTTFAGDNpvivagg  426
            LVL SS++S+G+AKALTYEEALQQ+  ++      DFD  GV++ V +FA +NPV++ GG
Sbjct  61   LVLASSLISTGVAKALTYEEALQQSVSASAPEGGLDFDGRGVLDNVISFATENPVVIVGG  120

Query  427  vailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGL  606
              ILA+PL++SQ+L   KP+GV+SA+ AYAKL DDA+AQLLDIR   E ++VGSPD+RGL
Sbjct  121  AVILALPLVLSQILKPSKPFGVDSARNAYAKLGDDASAQLLDIRAPVEFRQVGSPDVRGL  180

Query  607  KKKPVTVSYNGEDKPGF  657
             KKPV++ Y G+DKPGF
Sbjct  181  GKKPVSIVYKGDDKPGF  197



>ref|XP_011468943.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=444

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 140/192 (73%), Gaps = 9/192 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-----pfkslsssnsMEAISRNvkgglv  270
            MEA+NA  LTP+SVL +R+ EPRK P LPS          S S+  S E  S++  GGL+
Sbjct  1    MEALNAASLTPISVLGDRKKEPRKFPSLPSISLPKFSSSTSYSTKASQEGSSKSFHGGLL  60

Query  271  llssvmssglAKALTYEEALQQTSVST---DFDPSGVMETVTTFAGDNpvivaggvaila  441
            LLSSV ++G AKALTYEEAL Q SVST   DFD   V++ V +F  DNP ++AGG  +LA
Sbjct  61   LLSSVFNAGFAKALTYEEALGQ-SVSTATGDFDTDKVLDNVISFVNDNPAVIAGGFVVLA  119

Query  442  vpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPV  621
            VPL++SQ+L KPKP+GVESAK+AYAKL +DANA L+DIR   E+++VGSPDIRGL KK V
Sbjct  120  VPLVLSQVLKKPKPFGVESAKSAYAKLGEDANALLVDIRAPGEIRQVGSPDIRGLGKKAV  179

Query  622  TVSYNGEDKPGF  657
             + Y GEDKPGF
Sbjct  180  PIVYKGEDKPGF  191



>ref|XP_002302622.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE81895.2| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=436

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 134/193 (69%), Gaps = 9/193 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpl-------lpsslpfkslsssnsMEAISRNvkgg  264
            M+A+NA  LTPLSVL ERR E RK            S     S S S + E +SR + GG
Sbjct  1    MKALNAASLTPLSVLCERRAETRKSLSLPTVSPLKLSHSDSLSASRSAAQECLSRTLHGG  60

Query  265  lvllssvmssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvail  438
            +VLLSSV+S+GLA+ALTYEEAL++  +  S+DFD +G+++    F  +NP I+AG V +L
Sbjct  61   VVLLSSVLSTGLARALTYEEALEKPASPFSSDFDVNGILDGFIKFGSENPTIIAGSVTVL  120

Query  439  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  618
            AVPL++S +L+KPK WGVESAK AYA L DDA AQLLDIR   E ++VGSPDI GL KKP
Sbjct  121  AVPLILSLVLNKPKSWGVESAKNAYAALGDDAKAQLLDIRATVEFRQVGSPDISGLSKKP  180

Query  619  VTVSYNGEDKPGF  657
             ++ Y  EDKPGF
Sbjct  181  ASIVYKSEDKPGF  193



>ref|XP_010661901.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Vitis vinifera]
Length=440

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 132/197 (67%), Gaps = 13/197 (7%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsss-------nsMEAISRNvkgg  264
            MEA+N   LTPLSVL +RR EPRKI  LP+    K  SS+          E  +R+  GG
Sbjct  1    MEALNLAGLTPLSVLRDRRTEPRKISSLPAVSALKISSSATFNTTPPALQECFTRSFHGG  60

Query  265  lvllssvmssglAKALTYEEALQQTSVST------DFDPSGVMETVTTFAGDNpvivagg  426
            LVLLSSV+  G A ALTYEEAL Q+  ++      +FD +G ++ V +F  +NP +VAGG
Sbjct  61   LVLLSSVLGPGAAAALTYEEALDQSVTTSTSGGIIEFDANGFLDRVISFGVENPAVVAGG  120

Query  427  vailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGL  606
              IL VPL++SQLL KPKPWGVESA+ AYAKL DDA AQLLDIR   E ++VGSPDIRGL
Sbjct  121  ALILVVPLVLSQLLKKPKPWGVESARNAYAKLGDDATAQLLDIREPVEFRQVGSPDIRGL  180

Query  607  KKKPVTVSYNGEDKPGF  657
            +KKPV +   G DK  F
Sbjct  181  RKKPVAIPCKGGDKQAF  197



>ref|XP_002320855.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
 gb|EEE99170.1| hydroxyproline-rich glycoprotein [Populus trichocarpa]
Length=434

 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 134/191 (70%), Gaps = 7/191 (4%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpl-------lpsslpfkslsssnsMEAISRNvkgg  264
            MEA NA   TPLSVL ERR+E RK            S     S S S + E +SR + GG
Sbjct  1    MEAFNAASSTPLSVLCERRSESRKSLSLPTVSPLKISHSFSTSTSRSTTQECLSRTLHGG  60

Query  265  lvllssvmssglAKALTYEEALQQTSVSTDFDPSGVMETVTTFAGDNpvivaggvailav  444
            +VLLSSV+ +GLA+ALTY+EAL+Q++ S   D +GV+++V  F  +NP IVAG V +LAV
Sbjct  61   IVLLSSVLGNGLARALTYQEALEQSARSFSSDANGVLDSVIKFGTENPTIVAGSVTVLAV  120

Query  445  pllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  624
            PL++S +L+K K WGVESAK AYA L  DANAQLLDIR   E ++VGSPDIRGL+KKPV 
Sbjct  121  PLVLSLVLNKSKSWGVESAKKAYAALGVDANAQLLDIRAPVEFRQVGSPDIRGLRKKPVP  180

Query  625  VSYNGEDKPGF  657
            + Y GEDKPGF
Sbjct  181  IVYEGEDKPGF  191



>gb|AEQ94146.1| hydroxyproline rich glycoprotein [Elaeis guineensis]
Length=326

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 136/197 (69%), Gaps = 12/197 (6%)
 Frame = +1

Query  103  AMEAVNALRLTPLSV-----LSERRNEPRKIpllpsslpfkslss--snsMEAISRNvkg  261
            AME +NA  LTP+S+      SER+ E +K+     + P  S +    +  E +SR   G
Sbjct  1    AMEVLNAAGLTPVSLHRTVGFSERKAESKKLFRFRLTKPSTSDAHPPFSLSELLSRGFAG  60

Query  262  glvllssv-mssglAKALTYEEALQQTS----VSTDFDPSGVMETVTTFAGDNpvivagg  426
            GL  LS+   + GLAKALTYEEAL Q+     VS DFD    ++ +  F  +NP++V GG
Sbjct  61   GLAALSAAPGAGGLAKALTYEEALGQSGSSFGVSADFDIGQFLDGIVKFGTENPLVVGGG  120

Query  427  vailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGL  606
            VA+LAVPL++S++L KPKPWGVESA+TAYAKL+DD +AQLLDIR  R+LKEVG PD+RGL
Sbjct  121  VAVLAVPLVLSRILQKPKPWGVESARTAYAKLSDDVDAQLLDIREGRDLKEVGKPDVRGL  180

Query  607  KKKPVTVSYNGEDKPGF  657
            KKK V+++Y G DKPGF
Sbjct  181  KKKAVSITYRGNDKPGF  197



>gb|EYU38901.1| hypothetical protein MIMGU_mgv1a006323mg [Erythranthe guttata]
Length=448

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 141/192 (73%), Gaps = 9/192 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRK-IpllpsslpfkslsssnsMEAISRNvkgglvllss  282
            MEA+NA+ LTPLSVLS +R EPRK + L   S       S+    ++SR ++G +VLL S
Sbjct  1    MEAINAVGLTPLSVLS-KRTEPRKTLSLPTISQFKNQTLSNFGNSSVSRTIQGSIVLLPS  59

Query  283  vmssglAKALTYEEALQQT-----SVSTDFDPSGVMETVTTFAGDNpvivaggvailavp  447
            V+SS LAKALTYEEALQQ+     S ++DFD +GV++ V  FA +NP+I+ GG+A+LAVP
Sbjct  60   VLSSELAKALTYEEALQQSVTTSTSSTSDFDVAGVLDDVINFATENPIIIGGGLAVLAVP  119

Query  448  llvSQLLS--KPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPV  621
            LLVSQLL   KPK WGVE+AK AYAKLA+DA+AQL+DIR   E+K+ GSPDIR  KKK  
Sbjct  120  LLVSQLLGGGKPKAWGVETAKNAYAKLAEDADAQLVDIRAISEIKQEGSPDIRASKKKAA  179

Query  622  TVSYNGEDKPGF  657
             + Y GEDKPGF
Sbjct  180  AIVYQGEDKPGF  191



>gb|KGN56436.1| hypothetical protein Csa_3G119690 [Cucumis sativus]
Length=442

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 104/195 (53%), Positives = 144/195 (74%), Gaps = 11/195 (6%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAIS--------RNvkg  261
            MEA+NA  L+PL+VLS+R+ EP+KI  +PSS  FK  +  +    +S        ++++G
Sbjct  1    MEALNAASLSPLAVLSDRKREPKKIFPIPSSSSFKLPNFGSLNTNLSVPQGFCLSKSLQG  60

Query  262  glvllssvmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggva  432
             L+LLSSV ++G++ ALTYEEALQQ   TS S D D +G+++ +  F  +NP IV GGV+
Sbjct  61   SLLLLSSVFNAGVSGALTYEEALQQSMTTSSSGDLDLNGILDGIVNFGTENPGIVVGGVS  120

Query  433  ilavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKK  612
            ILA+PL+ S    KPKPWGVESAK+AYAKL +D+NAQLLDIR   E+++VG+PD++GL K
Sbjct  121  ILALPLIFSLFQGKPKPWGVESAKSAYAKLGEDSNAQLLDIRSPIEIRKVGAPDLKGLGK  180

Query  613  KPVTVSYNGEDKPGF  657
            KPV+++Y GEDKPGF
Sbjct  181  KPVSITYKGEDKPGF  195



>ref|XP_011023203.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Populus euphratica]
Length=436

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 135/193 (70%), Gaps = 9/193 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpl-------lpsslpfkslsssnsMEAISRNvkgg  264
            M+A+NA  LTPL VL ERR E RK            S     S S S + E +SR + GG
Sbjct  1    MKALNASSLTPLPVLCERRAETRKSLSLPTVSPLKFSHYDSLSASRSAAQECLSRTLHGG  60

Query  265  lvllssvmssglAKALTYEEALQQ--TSVSTDFDPSGVMETVTTFAGDNpvivaggvail  438
            +VLLSSV+S+GLA+ALTYEEAL++  +   +DFD +G++++V  F  +NP I+AGGV +L
Sbjct  61   VVLLSSVLSTGLARALTYEEALEKPASPFLSDFDVNGILDSVIKFGSENPTIIAGGVTVL  120

Query  439  avpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  618
            AVPL++S LL+KPK WGVESAK AYA L DDA AQLLDIR   E ++VGSPDI GL KKP
Sbjct  121  AVPLILSLLLNKPKSWGVESAKKAYAALGDDAKAQLLDIRATVEFRQVGSPDISGLSKKP  180

Query  619  VTVSYNGEDKPGF  657
             ++ Y  EDKPGF
Sbjct  181  ASIVYKSEDKPGF  193



>ref|XP_010424692.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=208

 Score =   132 bits (332),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  282
            MEA+     TP+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  1    MEALKTATFTPMSVLSEKRSEPRKPFTLPNLFPQKSPRPISQENFLRRFNGGLALLTSVL  60

Query  283  vmssglAKALTYEEALQQTSVSTD-FDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
              ++  AK+LTYEEALQQ++ ++  FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  61   TSATAPAKSLTYEEALQQSTTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  120

Query  460  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   +L++VGSP+I+GL KK V+  YN
Sbjct  121  QVLNKKPKAWGVESAKNAYTKLGTDDNAQLLDIRATADLRQVGSPNIKGLGKKAVSTVYN  180

Query  637  GEDKPGF  657
            G+DKPGF
Sbjct  181  GDDKPGF  187



>ref|XP_004155243.1| PREDICTED: uncharacterized LOC101206972 [Cucumis sativus]
Length=933

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 145/196 (74%), Gaps = 11/196 (6%)
 Frame = +1

Query  103  AMEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAIS--------RNvk  258
            AMEA+NA  L+PL+VLS+R+ EP+KI  +PSS  FK  +  +    +S        ++++
Sbjct  491  AMEALNAASLSPLAVLSDRKREPKKIFPIPSSSSFKLPNFGSLNTNLSVPQGFCLSKSLQ  550

Query  259  gglvllssvmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggv  429
            G L+LLSSV ++G++ ALTYEEALQQ   TS S D D +G+++ +  F  +NP IV GGV
Sbjct  551  GSLLLLSSVFNAGVSGALTYEEALQQSMTTSSSGDLDLNGILDGIVNFGTENPGIVVGGV  610

Query  430  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  609
            +ILA+PL+ S    KPKPWGVESAK+AYAKL +D+NAQLLDIR   E+++VG+PD++GL 
Sbjct  611  SILALPLIFSLFQGKPKPWGVESAKSAYAKLGEDSNAQLLDIRSPIEIRKVGAPDLKGLG  670

Query  610  KKPVTVSYNGEDKPGF  657
            KKPV+++Y GEDKPGF
Sbjct  671  KKPVSITYKGEDKPGF  686



>ref|XP_010915675.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Elaeis guineensis]
Length=456

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 132/196 (67%), Gaps = 12/196 (6%)
 Frame = +1

Query  106  MEAVNALRLTPLSV-----LSERRNEPRKIpllpsslpfkslss--snsMEAISRN-vkg  261
            ME +NA  LTP+S+      SERR E +K      + P  S +    +  E +SR    G
Sbjct  1    MEVLNAAGLTPVSLHGTVGFSERRAESKKFFRFRLTKPSTSNAHPPFSLSELLSRGFAGG  60

Query  262  glvllssvmssglAKALTYEEALQQTS----VSTDFDPSGVMETVTTFAGDNpvivaggv  429
               L ++  + GLAKALTYEEAL Q+     VS DFD    ++ +  F  +NP++V GGV
Sbjct  61   LAALSAAPSAGGLAKALTYEEALGQSGSSFGVSADFDIGQFLDGIVKFGTENPLVVGGGV  120

Query  430  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  609
            A+LAVPL++S++L KPKPWGVESA+TAYAKL+DD +AQLLDIR  R+LKEVG PD+RGLK
Sbjct  121  AVLAVPLVLSRILQKPKPWGVESARTAYAKLSDDVDAQLLDIREGRDLKEVGKPDVRGLK  180

Query  610  KKPVTVSYNGEDKPGF  657
            KK V+++Y G DKPGF
Sbjct  181  KKAVSITYRGNDKPGF  196



>ref|XP_011037916.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Populus euphratica]
Length=425

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 133/191 (70%), Gaps = 7/191 (4%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpssl-------pfkslsssnsMEAISRNvkgg  264
            MEA NA    PLSVL ERR+E RK   LP+            S S S + E +SR + GG
Sbjct  1    MEAFNAASWAPLSVLCERRSESRKSLSLPTVSPLQISHSFSTSTSRSTTQECLSRTLHGG  60

Query  265  lvllssvmssglAKALTYEEALQQTSVSTDFDPSGVMETVTTFAGDNpvivaggvailav  444
            +VLLSSV+ +GLA+ALTY+EAL+Q++ S   D +GV+++   F  +NP IVAG V +LAV
Sbjct  61   IVLLSSVLGNGLARALTYQEALEQSTRSFSSDANGVLDSFIKFGTENPTIVAGSVTVLAV  120

Query  445  pllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  624
            PL++S +L+K K WGVESAK AYA L  DANAQLLDIR   E ++VGSPDIRGL KKPV 
Sbjct  121  PLVLSLVLNKSKSWGVESAKKAYAALGVDANAQLLDIRAPVEFRQVGSPDIRGLSKKPVP  180

Query  625  VSYNGEDKPGF  657
            + Y GEDKPGF
Sbjct  181  IVYKGEDKPGF  191



>ref|XP_004134307.1| PREDICTED: uncharacterized protein LOC101206972 [Cucumis sativus]
Length=933

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 145/196 (74%), Gaps = 11/196 (6%)
 Frame = +1

Query  103  AMEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAIS--------RNvk  258
            AMEA+NA  L+PL+VLS+R+ EP+KI  +PSS  FK  +  +    +S        ++++
Sbjct  491  AMEALNAASLSPLAVLSDRKREPKKIFPIPSSSSFKLPNFGSLNTNLSVPQGFCLSKSLQ  550

Query  259  gglvllssvmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggv  429
            G L+LLSSV ++G++ ALTYEEALQQ   TS S D D +G+++ +  F  +NP IV GGV
Sbjct  551  GSLLLLSSVFNAGVSGALTYEEALQQSMTTSSSGDLDLNGILDGIVNFGTENPGIVVGGV  610

Query  430  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  609
            +ILA+PL+ S    KPKPWGVESAK+AYAKL +D+NAQLLDIR   E+++VG+PD++GL 
Sbjct  611  SILALPLIFSLFQGKPKPWGVESAKSAYAKLGEDSNAQLLDIRSPIEIRKVGAPDLKGLG  670

Query  610  KKPVTVSYNGEDKPGF  657
            KKPV+++Y GEDKPGF
Sbjct  671  KKPVSITYKGEDKPGF  686



>ref|NP_567209.1| thylakoid rhodanese-like protein [Arabidopsis thaliana]
 sp|Q9M158.2|STR4_ARATH RecName: Full=Rhodanese-like domain-containing protein 4, chloroplastic; 
AltName: Full=Protein THYLAKOID RHODANESE-LIKE; 
AltName: Full=Sulfurtransferase 4; Short=AtStr4; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL09804.1| AT4g01050/F2N1_31 [Arabidopsis thaliana]
 gb|AAL15331.1| AT4g01050/F2N1_31 [Arabidopsis thaliana]
 gb|AAM70579.1| AT4g01050/F2N1_31 [Arabidopsis thaliana]
 dbj|BAE98457.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81973.1| thylakoid rhodanese-like protein [Arabidopsis thaliana]
Length=466

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 128/187 (68%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  282
            MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  1    MEALKTATFSPMSVLSEKRSEPRKPFSLPNLFPPKSQRPISQESFLKRFNGGLALLTSVL  60

Query  283  vmssglAKALTYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
              ++  AK+LTYEEALQQ+ + S+ FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  61   SSATAPAKSLTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  120

Query  460  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   + ++VGSP+I+GL KK V+  YN
Sbjct  121  QVLNKKPKSWGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYN  180

Query  637  GEDKPGF  657
            GEDKPGF
Sbjct  181  GEDKPGF  187



>emb|CAB80914.1| hypothetical protein [Arabidopsis thaliana]
Length=457

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 128/187 (68%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  282
            MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  42   MEALKTATFSPMSVLSEKRSEPRKPFSLPNLFPPKSQRPISQESFLKRFNGGLALLTSVL  101

Query  283  vmssglAKALTYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
              ++  AK+LTYEEALQQ+ + S+ FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  102  SSATAPAKSLTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  161

Query  460  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   + ++VGSP+I+GL KK V+  YN
Sbjct  162  QVLNKKPKSWGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYN  221

Query  637  GEDKPGF  657
            GEDKPGF
Sbjct  222  GEDKPGF  228



>ref|XP_010427922.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=476

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 130/187 (70%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  282
            MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  1    MEALKTATFSPMSVLSEKRSEPRKPFTLPNLFPQKSSKPISQENFLRRFNGGLALLTSVL  60

Query  283  vmssglAKALTYEEALQQTSVSTD-FDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
              ++  AK+LTYEEALQQ++ ++  FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  61   SSATAPAKSLTYEEALQQSTTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  120

Query  460  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            Q+L+K PK WGVESAK AYAKL  D NAQLLDIR   +L++VGSP+I+GL KK V+  YN
Sbjct  121  QVLNKKPKAWGVESAKNAYAKLGTDDNAQLLDIRATADLRQVGSPNIKGLGKKAVSTVYN  180

Query  637  GEDKPGF  657
            GEDKPGF
Sbjct  181  GEDKPGF  187



>ref|XP_007135235.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
 gb|ESW07229.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
Length=439

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 130/191 (68%), Gaps = 7/191 (4%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNE----PRKIpllpsslpfkslsssnsMEAISRNvkgglvl  273
            MEA+NA  LTPLSVLS+R+      P       S   F +   +     +S+++  GL L
Sbjct  1    MEALNAAALTPLSVLSDRKTTRKQPPVSACKGSSFSTFTNKKPTLLQSCLSKSLHSGLFL  60

Query  274  lssvmssglAKALTYEEALQQTSV---STDFDPSGVMETVTTFAGDNpvivaggvailav  444
             +S++S   A ALTYEEAL Q+     + DFD +G +E+VT FA +NP IVAGGVAILA+
Sbjct  61   AASLVSVDGASALTYEEALGQSLSLPDTGDFDVNGFVESVTGFATENPAIVAGGVAILAL  120

Query  445  pllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  624
            PL++SQ+  KPK WGVESAK AYAKL  D NAQLLDIR   E+++VGSPD+ GL+KK V+
Sbjct  121  PLVLSQVFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEVRQVGSPDVGGLRKKAVS  180

Query  625  VSYNGEDKPGF  657
            ++Y G+DK GF
Sbjct  181  IAYKGDDKSGF  191



>ref|XP_007135236.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
 gb|ESW07230.1| hypothetical protein PHAVU_010G112100g [Phaseolus vulgaris]
Length=451

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 130/191 (68%), Gaps = 7/191 (4%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNE----PRKIpllpsslpfkslsssnsMEAISRNvkgglvl  273
            MEA+NA  LTPLSVLS+R+      P       S   F +   +     +S+++  GL L
Sbjct  1    MEALNAAALTPLSVLSDRKTTRKQPPVSACKGSSFSTFTNKKPTLLQSCLSKSLHSGLFL  60

Query  274  lssvmssglAKALTYEEALQQTSV---STDFDPSGVMETVTTFAGDNpvivaggvailav  444
             +S++S   A ALTYEEAL Q+     + DFD +G +E+VT FA +NP IVAGGVAILA+
Sbjct  61   AASLVSVDGASALTYEEALGQSLSLPDTGDFDVNGFVESVTGFATENPAIVAGGVAILAL  120

Query  445  pllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  624
            PL++SQ+  KPK WGVESAK AYAKL  D NAQLLDIR   E+++VGSPD+ GL+KK V+
Sbjct  121  PLVLSQVFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEVRQVGSPDVGGLRKKAVS  180

Query  625  VSYNGEDKPGF  657
            ++Y G+DK GF
Sbjct  181  IAYKGDDKSGF  191



>ref|XP_006286665.1| hypothetical protein CARUB_v10002584mg [Capsella rubella]
 gb|EOA19563.1| hypothetical protein CARUB_v10002584mg [Capsella rubella]
Length=472

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  282
            MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  1    MEALKTATFSPMSVLSEKRSEPRKPFSLPNLFPQKSPKPISQESFLKRFNGGLALLTSVL  60

Query  283  vmssglAKALTYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
              ++  AK+LTYEEALQQ+ + S+ FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  61   SSATAPAKSLTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  120

Query  460  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   ++++VGSP+I+GL KK V+  YN
Sbjct  121  QVLNKKPKAWGVESAKNAYTKLGTDDNAQLLDIRTTADVRQVGSPNIKGLGKKTVSTVYN  180

Query  637  GEDKPGF  657
            G+DKPGF
Sbjct  181  GDDKPGF  187



>ref|XP_009421248.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=486

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 123/194 (63%), Gaps = 28/194 (14%)
 Frame = +1

Query  100  YAMEAVNALRLTPLSVLS------ERRNEPRKIpllpsslpfkslsssnsMEAISRNvkg  261
            YAM+ +NA  L P++ L       ERR EPR++                 + A+S     
Sbjct  67   YAMQVLNAAGLAPVASLHKATPSLERRPEPRRLLQFRLPK----------LAALS-----  111

Query  262  glvllssvmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvai  435
                 S   + GLAKALTYE+AL QT  S S DFD  G+++ +  F  +NP+++ GG  +
Sbjct  112  -----SIFGAGGLAKALTYEQALDQTVGSSSLDFDVGGLLDGIVNFGTENPLLLGGGALV  166

Query  436  lavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKK  615
            LAVPL++SQ+L KPK WG+ SAK+AYAKL++D NAQLLDIR  ++ KEVG PD+RGLKKK
Sbjct  167  LAVPLILSQILKKPKNWGLASAKSAYAKLSEDGNAQLLDIREGKDFKEVGRPDLRGLKKK  226

Query  616  PVTVSYNGEDKPGF  657
             V ++Y GEDKPGF
Sbjct  227  AVAIAYKGEDKPGF  240



>ref|XP_008783830.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Phoenix dactylifera]
Length=456

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 133/196 (68%), Gaps = 12/196 (6%)
 Frame = +1

Query  106  MEAVNALRLTPLS-----VLSERRNEPRKIpllpsslpfkslss--snsMEAISRNvkgg  264
            ME +NA  LTP+S     + SER+ EP+K+     + P  S +     S E +SR   GG
Sbjct  1    MEVLNAAGLTPVSLHKTVISSERKAEPKKLFPFRLARPSTSDAHPPFPSSELLSRGFAGG  60

Query  265  lvllssv-mssglAKALTYEEALQQTSVS----TDFDPSGVMETVTTFAGDNpvivaggv  429
            L  LS+   + GLAKALTYEEAL QT  S      FD    ++ +  F   NP++V GGV
Sbjct  61   LAALSAAPCAGGLAKALTYEEALGQTDFSFGGSASFDIGQFLDGIVKFGAANPLVVGGGV  120

Query  430  ailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLK  609
            A+LAVPL++S++L KPKPWGVESA+TA+AKL+DD +AQLLDIR  R+ KEVGSPD+RGLK
Sbjct  121  AVLAVPLVLSRILQKPKPWGVESARTAFAKLSDDVDAQLLDIREGRDFKEVGSPDVRGLK  180

Query  610  KKPVTVSYNGEDKPGF  657
            KK V+++Y G DKPGF
Sbjct  181  KKAVSITYRGNDKPGF  196



>ref|XP_003528797.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Glycine max]
Length=444

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 132/192 (69%), Gaps = 8/192 (4%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEA-----ISRNvkgglv  270
            MEA+NA  LTPLSVLS+R     K P + +       +S+N  +A     IS+ + GGL+
Sbjct  1    MEALNAAGLTPLSVLSDRTKTRTKHPSVSACKVSNFSTSTNKKQALLQSCISKTLHGGLI  60

Query  271  llssvmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggvaila  441
            L +S ++ G A ALTY+EAL Q      + DFD +G +E+V  FA +NP IVAGGV +LA
Sbjct  61   LAASAVNGGAATALTYDEALGQPLSLPGTGDFDVNGFVESVAGFAAENPAIVAGGVVVLA  120

Query  442  vpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPV  621
            VPL++SQ+  KPK WGVESAK AYAKL  D NAQLLDIR   E+++VGSPD+ GLKKK V
Sbjct  121  VPLVLSQVFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEIRQVGSPDVGGLKKKAV  180

Query  622  TVSYNGEDKPGF  657
            ++ Y G+DKPGF
Sbjct  181  SIPYKGDDKPGF  192



>gb|AAB61039.1| A_IG002N01.31 gene product [Arabidopsis thaliana]
Length=968

 Score =   135 bits (339),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 128/188 (68%), Gaps = 3/188 (2%)
 Frame = +1

Query  103  AMEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvlls  279
             MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+   
Sbjct  510  VMEALKTATFSPMSVLSEKRSEPRKPFSLPNLFPPKSQRPISQESFLKRFNGGLALLTSV  569

Query  280  svmssglAKALTYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllv  456
               ++  AK+LTYEEALQQ+ + S+ FD  G++E ++ F  DNP+++AGGVA LAVP ++
Sbjct  570  LSSATAPAKSLTYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVL  629

Query  457  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  633
            SQ+L+K PK WGVESAK AY KL  D NAQLLDIR   + ++VGSP+I+GL KK V+  Y
Sbjct  630  SQVLNKKPKSWGVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVY  689

Query  634  NGEDKPGF  657
            NGEDKPGF
Sbjct  690  NGEDKPGF  697



>ref|XP_010456200.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=530

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  282
            MEA+     +P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  55   MEALKTATFSPMSVLSEKRSEPRKPFTLPNLFPQKSPQPISQESFLRRFNGGLALLTSVL  114

Query  283  vmssglAKALTYEEALQQTSVSTD-FDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
              ++  AK+LTYEEALQQ++ ++  FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  115  SSATAPAKSLTYEEALQQSTTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  174

Query  460  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   +L++VGSP+I+GL KK V+  YN
Sbjct  175  QVLNKKPKAWGVESAKNAYTKLGTDDNAQLLDIRATADLRQVGSPNIKGLGKKTVSTVYN  234

Query  637  GEDKPGF  657
            GEDKPGF
Sbjct  235  GEDKPGF  241



>ref|XP_010422759.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Camelina sativa]
Length=603

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 129/187 (69%), Gaps = 3/187 (2%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-Nvkgglvllss  282
            MEA+     TP+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+    
Sbjct  128  MEALKTATFTPMSVLSEKRSEPRKPFTLPNLFPQKSPRPISQENFLRRFNGGLALLTSVL  187

Query  283  vmssglAKALTYEEALQQTSVSTD-FDPSGVMETVTTFAGDNpvivaggvailavpllvS  459
              ++  AK+LTYEEALQQ++ ++  FD  G++E ++ F  DNP+++AGGVA LAVP ++S
Sbjct  188  TSATAPAKSLTYEEALQQSTTTSSSFDSDGLIEGISNFVTDNPLVIAGGVAALAVPFVLS  247

Query  460  QLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            Q+L+K PK WGVESAK AY KL  D NAQLLDIR   +L++VGSP+I+GL KK V+  YN
Sbjct  248  QVLNKKPKAWGVESAKNAYTKLGTDDNAQLLDIRATADLRQVGSPNIKGLGKKAVSTVYN  307

Query  637  GEDKPGF  657
            G+DKPGF
Sbjct  308  GDDKPGF  314



>ref|XP_003548475.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Glycine max]
 gb|KHN15949.1| Hypothetical protein glysoja_013165 [Glycine soja]
Length=455

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 132/193 (68%), Gaps = 9/193 (5%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSE----RRNEPR-KIpllpsslpfkslsssnsMEAISRNvkgglv  270
            MEA+NA  LTPLSVLS+    R   P   +  + +     +   +     IS+ + GGL+
Sbjct  1    MEALNAAGLTPLSVLSDAKTTRTKHPSVSVCKVSNFSTSTNKKQTLLQSCISKTLHGGLI  60

Query  271  llssvmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggvaila  441
            L +SV++ G A ALTY+EAL Q      + DFD +G +E+VT FA +NP I+AGGVA+LA
Sbjct  61   LAASVVNGGAATALTYDEALGQPLSLPGAGDFDVNGFVESVTGFAAENPAILAGGVAVLA  120

Query  442  vpllvSQLL-SKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKP  618
            VPL++SQ+L  KPK WGVESAK AYAKL  D NAQLLDIR   E+++VGSPD+ GLKKK 
Sbjct  121  VPLVLSQVLFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEIRQVGSPDVGGLKKKA  180

Query  619  VTVSYNGEDKPGF  657
            V++ Y G+DKPGF
Sbjct  181  VSIPYKGDDKPGF  193



>ref|XP_006396307.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
 gb|ESQ37760.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
Length=447

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 123/188 (65%), Gaps = 5/188 (3%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  279
            MEA+      P+SVLSE+R+EPRK P     L         S E+  R  N    L+   
Sbjct  1    MEALKTASFCPMSVLSEKRSEPRK-PFSLPKLFTPKSPKPISHESFFRSFNGGLALLTSV  59

Query  280  svmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllv  456
               ++  AK+LTYEEALQQ+  S + FD  G ++ +++F  DNP+++AGG A  AVP ++
Sbjct  60   LSSATAPAKSLTYEEALQQSMTSPSSFDSDGFIDGISSFVTDNPLVIAGGFAAFAVPFVL  119

Query  457  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  633
            SQ+L+K PK +GVESAK AYAKL  D NAQLLDIR + + ++VG+P+I+GL KK V+  Y
Sbjct  120  SQVLNKKPKSFGVESAKNAYAKLGTDENAQLLDIRASADFRQVGTPNIKGLGKKTVSTVY  179

Query  634  NGEDKPGF  657
            NGEDKPGF
Sbjct  180  NGEDKPGF  187



>ref|XP_006396308.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
 gb|ESQ37761.1| hypothetical protein EUTSA_v10028649mg [Eutrema salsugineum]
Length=454

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 123/188 (65%), Gaps = 5/188 (3%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  279
            MEA+      P+SVLSE+R+EPRK P     L         S E+  R  N    L+   
Sbjct  1    MEALKTASFCPMSVLSEKRSEPRK-PFSLPKLFTPKSPKPISHESFFRSFNGGLALLTSV  59

Query  280  svmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllv  456
               ++  AK+LTYEEALQQ+  S + FD  G ++ +++F  DNP+++AGG A  AVP ++
Sbjct  60   LSSATAPAKSLTYEEALQQSMTSPSSFDSDGFIDGISSFVTDNPLVIAGGFAAFAVPFVL  119

Query  457  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  633
            SQ+L+K PK +GVESAK AYAKL  D NAQLLDIR + + ++VG+P+I+GL KK V+  Y
Sbjct  120  SQVLNKKPKSFGVESAKNAYAKLGTDENAQLLDIRASADFRQVGTPNIKGLGKKTVSTVY  179

Query  634  NGEDKPGF  657
            NGEDKPGF
Sbjct  180  NGEDKPGF  187



>ref|XP_004516405.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Cicer arietinum]
Length=480

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 136/197 (69%), Gaps = 13/197 (7%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssns-------MEAISRNvkgg  264
            MEA+N+   TPL VLS+R  +P+KI   P+    K  + S S        E +SRN + G
Sbjct  1    MEALNSTIYTPLCVLSDRTKQPKKISSHPAISTSKVSNFSTSNNRKHNLRECLSRNFQKG  60

Query  265  lvllssvmssgl-----AKALTYEEALQQTSVST-DFDPSGVMETVTTFAGDNpvivagg  426
            L+L +SV++  +     A ALTYEEALQQ+ +S  D D +G ++++ +FA +NP I+AGG
Sbjct  61   LILAASVVNVNVNVNGFANALTYEEALQQSPISGGDIDVNGFVDSLISFATENPAILAGG  120

Query  427  vailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGL  606
            VAILAVPL++SQ+L +PK WGVESAK AYAKL  D NA+LLDIR   E++ VG P++ GL
Sbjct  121  VAILAVPLVLSQILKEPKKWGVESAKNAYAKLGADGNAELLDIRGLSEIRTVGGPNVGGL  180

Query  607  KKKPVTVSYNGEDKPGF  657
            KKK V+++Y  +DKPGF
Sbjct  181  KKKSVSIAYKSDDKPGF  197



>gb|KHN06295.1| Hypothetical protein glysoja_021133 [Glycine soja]
Length=441

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 123/189 (65%), Gaps = 5/189 (3%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvl--ls  279
            MEA+NA  LTPLSVLS+R     K P + +       +S+N  +A+ ++     +   L 
Sbjct  1    MEALNAAGLTPLSVLSDRTKTRTKHPSVSACKVSNFSTSTNKKQALLQSCISKTLHGGLI  60

Query  280  svmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpl  450
               S     ALTY+EAL Q      + DFD +G +E+V  FA +NP IVAGGV +LAVPL
Sbjct  61   LAASVVNGAALTYDEALGQPLSLPGTGDFDVNGFVESVAGFAAENPAIVAGGVVVLAVPL  120

Query  451  lvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVS  630
            ++SQ+  KPK WGVESAK AYAKL  D NAQLLDIR   E+++VGSPD+ GLKKK V++ 
Sbjct  121  VLSQVFKKPKAWGVESAKNAYAKLGADGNAQLLDIRALVEIRQVGSPDVGGLKKKAVSIP  180

Query  631  YNGEDKPGF  657
            Y G+DKPGF
Sbjct  181  YKGDDKPGF  189



>ref|XP_010669158.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=469

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 137/195 (70%), Gaps = 15/195 (8%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssns-------MEAISRNvkgg  264
            ME++NAL+L P+ VL ++R +PRK P +P+    K    S +        E ++R   G 
Sbjct  1    MESLNALQLKPICVLPDQRGKPRKFPQIPTLPSLKFPQFSTNKVNPPNFTEDLARKFHGS  60

Query  265  lvllssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvai  435
            LVLL+S  S+ +A ALTYEEA+ Q+   + + DFD   V+ET+      NP+I+AGGVA+
Sbjct  61   LVLLASAFSAQVAGALTYEEAISQSVNENPAADFDAGSVVETIV----QNPLIIAGGVAV  116

Query  436  lavpllvSQLL-SKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKK  612
            +AVPL++SQ+  SKPKP+GV+ AK AYAKLA+D NAQLLDIR  +E KEVGSPDIRGLKK
Sbjct  117  IAVPLVLSQVFGSKPKPFGVQPAKAAYAKLAEDPNAQLLDIRSLKESKEVGSPDIRGLKK  176

Query  613  KPVTVSYNGEDKPGF  657
            K ++V Y GEDKPGF
Sbjct  177  KAISVVYRGEDKPGF  191



>gb|ACJ86240.1| unknown [Medicago truncatula]
Length=480

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 125/192 (65%), Gaps = 8/192 (4%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSER--RNEPRKIpllpsslpfkslsssnsMEAISRNvkgg---lv  270
            MEA+N+  LTPLSVLS+R     P K     S+         N  E +S+N + G     
Sbjct  1    MEALNSTILTPLSVLSDRTKHKHPTKFSCKASNFSTSINKKQNLREFLSKNFQKGLFLAA  60

Query  271  llssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvaila  441
             + +V +   A ALTYEEAL Q+   S   D D +G +++V  FA +NPVI+AGGVAILA
Sbjct  61   SVVNVNNGEFANALTYEEALGQSPSASGGGDIDVNGFVDSVIGFATENPVILAGGVAILA  120

Query  442  vpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPV  621
            VPL++SQ+L KPK WGVESAK AYAKL  D NAQLLDIR   E+++VG P++ GLKKK V
Sbjct  121  VPLVLSQILKKPKAWGVESAKNAYAKLGADGNAQLLDIRGLAEIRQVGGPNVGGLKKKAV  180

Query  622  TVSYNGEDKPGF  657
             V+Y G+DKP F
Sbjct  181  AVTYKGDDKPVF  192



>gb|KEH18685.1| thylakoid rhodanese-like protein [Medicago truncatula]
Length=482

 Score =   128 bits (321),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 125/192 (65%), Gaps = 8/192 (4%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSER--RNEPRKIpllpsslpfkslsssnsMEAISRNvkgg---lv  270
            MEA+N+  LTPLSVLS+R     P K     S+         N  E +S+N + G     
Sbjct  1    MEALNSTILTPLSVLSDRTKHKHPTKFSCKASNFSTSINKKQNLREFLSKNFQKGLFLAA  60

Query  271  llssvmssglAKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvaila  441
             + +V +   A ALTYEEAL Q+   S   D D +G +++V  FA +NPVI+AGGVAILA
Sbjct  61   SVVNVNNGEFANALTYEEALGQSPSASGGGDIDVNGFVDSVIGFATENPVILAGGVAILA  120

Query  442  vpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPV  621
            VPL++SQ+L KPK WGVESAK AYAKL  D NAQLLDIR   E+++VG P++ GLKKK V
Sbjct  121  VPLVLSQILKKPKAWGVESAKNAYAKLGADGNAQLLDIRGLAEIRQVGGPNVGGLKKKAV  180

Query  622  TVSYNGEDKPGF  657
             V+Y G+DKP F
Sbjct  181  AVTYKGDDKPVF  192



>ref|XP_002875001.1| hypothetical protein ARALYDRAFT_352729 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51260.1| hypothetical protein ARALYDRAFT_352729 [Arabidopsis lyrata subsp. 
lyrata]
Length=869

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 124/177 (70%), Gaps = 3/177 (2%)
 Frame = +1

Query  136  PLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR-NvkgglvllssvmssglAKAL  312
            P+SVLSE+R+EPRK   LP+  P KS    +    + R N    L+      ++  AK+L
Sbjct  459  PMSVLSEKRSEPRKPFSLPNLFPPKSPRPISQESFLKRFNGGLALLTSVLSSATAPAKSL  518

Query  313  TYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQLLSK-PKPW  486
            TYEEALQQ+ + S+ FD  G++E ++ F  DNP++++GGVA LAVP ++SQ+L+K PK W
Sbjct  519  TYEEALQQSMTTSSSFDSDGLIEGISNFVTDNPLVISGGVAALAVPFVLSQVLNKKPKSW  578

Query  487  GVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            GVESAK AY KL  D NAQLLDIR   + ++VGSP+I+GL KK V++ YNGEDKPGF
Sbjct  579  GVESAKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSIVYNGEDKPGF  635



>ref|XP_009111413.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Brassica rapa]
Length=458

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 127/186 (68%), Gaps = 4/186 (2%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  285
            MEA+     +P+SVLSE+R+EPR+   LP+  P K +S  + +   S N    L+     
Sbjct  1    MEALKTASFSPMSVLSEKRSEPRRPFSLPTLFPPKPISQESFLR--SFNGGLALLTSVLS  58

Query  286  mssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQ  462
             ++  AK+LTYEEALQQ+  S + FD  G ++ ++TF  DNP+++AGGVA  AVP ++SQ
Sbjct  59   SATAPAKSLTYEEALQQSVTSPSSFDSDGFIDGISTFVTDNPLVIAGGVAAFAVPFVLSQ  118

Query  463  LLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  639
            +L+K PK +GVESAK AY KL  D  AQLLDIR A + ++VGSP+I+GL KK V+V YNG
Sbjct  119  VLNKKPKSFGVESAKNAYTKLGTDETAQLLDIRAAADSRQVGSPNIKGLGKKTVSVVYNG  178

Query  640  EDKPGF  657
            EDK GF
Sbjct  179  EDKDGF  184



>gb|KJB49531.1| hypothetical protein B456_008G124200 [Gossypium raimondii]
Length=415

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 93/119 (78%), Gaps = 2/119 (2%)
 Frame = +1

Query  301  AKALTYEEALQQTSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQLLSKPK  480
            AKAL+Y+EALQQT+  T F   GV+++V  F  DNP +VAGG   LAVPL++SQ+L   K
Sbjct  62   AKALSYDEALQQTT--TSFSSDGVLDSVVNFISDNPTVVAGGAVALAVPLILSQVLKGSK  119

Query  481  PWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            PWG+E+A++AY KL +D NAQLLDIR  +E K+VGSPDI+G  KKPV++++NGEDK GF
Sbjct  120  PWGIETARSAYGKLGEDPNAQLLDIRGPKEFKDVGSPDIKGFGKKPVSIAFNGEDKLGF  178



>gb|KHG21564.1| hypothetical protein F383_26582 [Gossypium arboreum]
Length=420

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = +1

Query  301  AKALTYEEALQQTSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQLLSKPK  480
            AKAL+Y+EALQQT+  T F   GV+ +V  F  DNP +VAGG   LAVPL++SQ+L   K
Sbjct  67   AKALSYDEALQQTT--TSFSSDGVLHSVVNFISDNPTVVAGGAVALAVPLILSQVLKGSK  124

Query  481  PWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            PWG+E+A++AY KL +D NAQLLDIR  +E K+VGSPDI+G  KKPV++++NGEDK GF
Sbjct  125  PWGIETARSAYGKLGEDPNAQLLDIRGPKEFKDVGSPDIKGFGKKPVSIAFNGEDKLGF  183



>ref|XP_009134504.1| PREDICTED: LOW QUALITY PROTEIN: rhodanese-like domain-containing 
protein 4, chloroplastic [Brassica rapa]
Length=527

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 127/188 (68%), Gaps = 5/188 (3%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  279
            MEA+     +P SVLS++R+E RK P    SL         S E++ R  N    L+   
Sbjct  1    MEALKTASFSPTSVLSDKRSETRK-PFSLPSLFPPKPPKPISQESLFRSFNGGLALLTSV  59

Query  280  svmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllv  456
               ++  AK+LTYEEALQQ++ S + FD  G+++ +++F  DNP+++AGGVA  AVP ++
Sbjct  60   LSSATAPAKSLTYEEALQQSTTSPSSFDSDGLIDGISSFVTDNPLVIAGGVAAFAVPFVL  119

Query  457  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  633
            SQ+L+K PK +GVESAK AY KL  D NAQLLDIR A +L++VGSP+I+GL KK V+  Y
Sbjct  120  SQVLNKKPKTFGVESAKNAYTKLGTDENAQLLDIRAAADLRQVGSPNIKGLGKKTVSAVY  179

Query  634  NGEDKPGF  657
            NGEDKPGF
Sbjct  180  NGEDKPGF  187



>ref|XP_008437912.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Cucumis melo]
Length=442

 Score =   125 bits (313),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 143/195 (73%), Gaps = 11/195 (6%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAIS--------RNvkg  261
            MEA+NA  L+PL+VLS+R+ EP+KI  +PSS  FK  +  +    +S        R+++G
Sbjct  1    MEALNAASLSPLAVLSDRKREPKKISPIPSSSSFKLPNFGSLNTNLSVPQGFCLSRSLQG  60

Query  262  glvllssvmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggva  432
             L+LLSS  ++G++ ALTY+EALQQ   TS S D D +G+++ +  F  +NP IV GGV+
Sbjct  61   SLLLLSSAFNAGVSGALTYDEALQQSMTTSSSGDLDLNGILDGIVNFGTENPGIVVGGVS  120

Query  433  ilavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKK  612
            ILA+PL+ S    K KPWGVESAK+AYAKL++D+NAQLLDIR   E+++VG+PD++GL K
Sbjct  121  ILALPLIFSLFQGKSKPWGVESAKSAYAKLSEDSNAQLLDIRSPVEIRKVGAPDLKGLGK  180

Query  613  KPVTVSYNGEDKPGF  657
            KPV+++Y GEDKPGF
Sbjct  181  KPVSIAYKGEDKPGF  195



>emb|CDX74366.1| BnaA03g26810D [Brassica napus]
Length=466

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/188 (49%), Positives = 126/188 (67%), Gaps = 5/188 (3%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  279
            MEA+     +P SVLS++R+E RK P    SL         S E++ R  N    L+   
Sbjct  1    MEALKTASFSPTSVLSDKRSETRK-PFSLPSLFPPKPPKPISQESLFRSFNGGLALLTSV  59

Query  280  svmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllv  456
               ++  AK+LTYEEALQQ++ S + FD  G+++ +++F  DNP+++AGGVA  AVP ++
Sbjct  60   LSSATAPAKSLTYEEALQQSTTSPSSFDSDGLIDGISSFVTDNPLVIAGGVAAFAVPFVL  119

Query  457  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  633
            SQ+L+K PK +GVESAK AY  L  D NAQLLDIR A +L++VGSP+I+GL KK V+  Y
Sbjct  120  SQVLNKKPKSFGVESAKNAYTNLGTDENAQLLDIRAAADLRQVGSPNIKGLGKKTVSAVY  179

Query  634  NGEDKPGF  657
            NGEDKPGF
Sbjct  180  NGEDKPGF  187



>emb|CDY07169.1| BnaCnng01840D [Brassica napus]
Length=498

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 127/186 (68%), Gaps = 4/186 (2%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  285
            MEA+     +P++VLSE+R+EPR+   LP+  P K +S  + +   S N    L+     
Sbjct  43   MEALRTASFSPIAVLSEKRSEPRRPFSLPTLFPPKPISQESFLR--SFNGGLALLTSVLS  100

Query  286  mssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQ  462
             ++  AK+LTYEEALQQ+  S + FD  G ++ ++TF  DNP+++AGGVA  AVP ++SQ
Sbjct  101  GATAPAKSLTYEEALQQSVTSPSSFDSDGFIDGISTFVTDNPLVIAGGVAAFAVPFVLSQ  160

Query  463  LLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  639
            +L+K PK +GVESAK AY KL  D  AQLLDIR A + ++VGSP+I+GL KK V+V YNG
Sbjct  161  VLNKKPKSFGVESAKNAYTKLGTDETAQLLDIRAAADSRQVGSPNIKGLGKKTVSVVYNG  220

Query  640  EDKPGF  657
            EDK GF
Sbjct  221  EDKDGF  226



>emb|CDY48498.1| BnaA09g00250D [Brassica napus]
Length=461

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 124/188 (66%), Gaps = 5/188 (3%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  279
            MEA+     +P+SVLS++R+EPR+ P    SL         S E+  R  N    L+   
Sbjct  1    MEALKTASFSPMSVLSDKRSEPRR-PFSLPSLFPPKTPKPISQESFFRSFNGGLALLTSV  59

Query  280  svmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpllv  456
               ++  AK+LTYEEALQQ+  S + FD  G ++ +++F  DNP+++AGGVA  AVP ++
Sbjct  60   LSSATAPAKSLTYEEALQQSVTSPSSFDSDGFIDGISSFVTDNPLVIAGGVAAFAVPFVL  119

Query  457  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  633
            SQ+L+K PK +GVESAK AY KL  D  AQLLDIR A + ++VGSP+I+GL KK V+V Y
Sbjct  120  SQVLNKKPKSFGVESAKNAYTKLGTDETAQLLDIRAAADSRQVGSPNIKGLGKKTVSVVY  179

Query  634  NGEDKPGF  657
            NGEDK GF
Sbjct  180  NGEDKDGF  187



>ref|XP_003637723.1| hypothetical protein MTR_100s0011, partial [Medicago truncatula]
Length=192

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = +1

Query  301  AKALTYEEALQQT---SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQLLS  471
            A ALTYEEAL Q+   S   D D +G +++V  FA +NPVI+AGGVAILAVPL++SQ+L 
Sbjct  55   ANALTYEEALGQSPSASGGGDIDVNGFVDSVIGFATENPVILAGGVAILAVPLVLSQILK  114

Query  472  KPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKP  651
            KPK WGVESAK AYAKL  D NAQLLDIR   E+++VG P++ GLKKK V V+Y G+DKP
Sbjct  115  KPKAWGVESAKNAYAKLGADGNAQLLDIRGLAEIRQVGGPNVGGLKKKAVAVTYKGDDKP  174

Query  652  GF  657
             F
Sbjct  175  VF  176



>ref|XP_010534211.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Tarenaya hassleriana]
Length=430

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 128/191 (67%), Gaps = 8/191 (4%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvk---gglvll  276
            MEA+     +P+SVLSE+R+EPR++  LPS    KS    +  E+  R+       L   
Sbjct  1    MEALKTASFSPISVLSEKRSEPRRLAWLPSLSSPKSPRPIS-QESFLRSFNGGLALLTSA  59

Query  277  ssvmssglAKALTYEEALQQTSVSTD---FDPSGVMETVTTFAGDNpvivaggvailavp  447
             S  ++  AKALTYEEALQQ+  S+    F+  G+++ +  F  +NP+++AGGVA+LAVP
Sbjct  60   LSSAATPAAKALTYEEALQQSVTSSSSSPFESDGLVDGIVGFVTENPLVIAGGVAVLAVP  119

Query  448  llvSQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVT  624
             ++ Q+LSK PK WGVESAK+AY KL  D NAQL+DIR   E ++VG+PDI+GL K+PVT
Sbjct  120  WVLFQVLSKKPKSWGVESAKSAYTKLGTDENAQLVDIRSPGEARQVGTPDIKGLGKRPVT  179

Query  625  VSYNGEDKPGF  657
            V Y GEDK GF
Sbjct  180  VVYKGEDKTGF  190



>ref|XP_008350777.1| PREDICTED: LOW QUALITY PROTEIN: rhodanese-like domain-containing 
protein 4, chloroplastic [Malus domestica]
Length=420

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 132/187 (71%), Gaps = 4/187 (2%)
 Frame = +1

Query  106  MEAVNALRLTPL-SVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllss  282
            MEA++A  LTP+ S+L +R+  P  +P +         S   S E+ SR+  GGL LLSS
Sbjct  1    MEALHAASLTPIRSLLGDRKKIP-SLPSISVPKFSNPTSLRASQESSSRSFHGGLPLLSS  59

Query  283  vmssglAKALTYEEALQQT--SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllv  456
            V ++G AKALTYEEAL Q+      D +  GV++ V +F  DNP ++AGG A+LAVPL++
Sbjct  60   VFNAGFAKALTYEEALGQSVSGGGGDLEVGGVLDNVISFVTDNPAVIAGGFAVLAVPLVL  119

Query  457  SQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            SQ+L  PKP+GV+SA++AYAKL +DANAQLLDIRP  E ++VG+PD++GL KK V++ Y 
Sbjct  120  SQVLKPPKPFGVDSARSAYAKLGEDANAQLLDIRPPAEFRQVGTPDVKGLGKKAVSIVYK  179

Query  637  GEDKPGF  657
             EDKPGF
Sbjct  180  SEDKPGF  186



>gb|KFK30681.1| hypothetical protein AALP_AA6G014200 [Arabis alpina]
Length=465

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 126/188 (67%), Gaps = 4/188 (2%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvlls  279
            MEA+     TP+SVLSE+R+EPRK   LP+  P KS    +      +  N    L+   
Sbjct  1    MEALKTASFTPMSVLSEKRSEPRKPFSLPNLFPQKSPKPISQESFFLKRFNGGLALLTSV  60

Query  280  svmssglAKALTYEEALQQT-SVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllv  456
               ++  AK+LTYEEALQQ+ + S+ FD    ++ +++F  DNP+++AGG A  AVP ++
Sbjct  61   LSNTTAPAKSLTYEEALQQSMTTSSSFDSDSFIDGISSFVTDNPLVIAGGFAAFAVPFVL  120

Query  457  SQLLSK-PKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  633
            SQ+L+K PK +GVESAK AY KL  D NAQLLDIR + + ++VGSP+I+GL KK V++ Y
Sbjct  121  SQVLNKKPKSFGVESAKNAYTKLGTDDNAQLLDIRTSADFRQVGSPNIKGLGKKTVSIVY  180

Query  634  NGEDKPGF  657
            NGEDKPGF
Sbjct  181  NGEDKPGF  188



>ref|XP_009336808.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009336809.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=441

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 129/188 (69%), Gaps = 5/188 (3%)
 Frame = +1

Query  106  MEAVNALRLTPL-SVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllss  282
            MEA++A  LTP+ S+L +R+  P  +P +         S   S E+ SR+  GGL+LLSS
Sbjct  1    MEALHAASLTPIRSLLGDRKKIP-SLPSISVPKFSNPTSLRASQESSSRSFHGGLLLLSS  59

Query  283  vmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpll  453
            V ++G AKALTYEEAL Q             G ++ V +F  DNP ++AGG A+LAVPL+
Sbjct  60   VFNAGFAKALTYEEALGQFVSGGGGDLEVGGGALDNVISFVTDNPAVIAGGFAVLAVPLV  119

Query  454  vSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  633
            +SQ+L  PKP+GV+SA++AYAKL +DANAQLLDIRP  E ++VG+PD++GL KK V++ Y
Sbjct  120  LSQVLKPPKPFGVDSARSAYAKLGEDANAQLLDIRPPAEFRQVGTPDVKGLGKKAVSIVY  179

Query  634  NGEDKPGF  657
              EDKPGF
Sbjct  180  KREDKPGF  187



>ref|XP_009336810.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
isoform X3 [Pyrus x bretschneideri]
Length=421

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 129/188 (69%), Gaps = 5/188 (3%)
 Frame = +1

Query  106  MEAVNALRLTPL-SVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllss  282
            MEA++A  LTP+ S+L +R+  P  +P +         S   S E+ SR+  GGL+LLSS
Sbjct  1    MEALHAASLTPIRSLLGDRKKIP-SLPSISVPKFSNPTSLRASQESSSRSFHGGLLLLSS  59

Query  283  vmssglAKALTYEEALQQ---TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpll  453
            V ++G AKALTYEEAL Q             G ++ V +F  DNP ++AGG A+LAVPL+
Sbjct  60   VFNAGFAKALTYEEALGQFVSGGGGDLEVGGGALDNVISFVTDNPAVIAGGFAVLAVPLV  119

Query  454  vSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  633
            +SQ+L  PKP+GV+SA++AYAKL +DANAQLLDIRP  E ++VG+PD++GL KK V++ Y
Sbjct  120  LSQVLKPPKPFGVDSARSAYAKLGEDANAQLLDIRPPAEFRQVGTPDVKGLGKKAVSIVY  179

Query  634  NGEDKPGF  657
              EDKPGF
Sbjct  180  KREDKPGF  187



>emb|CDX91872.1| BnaC03g31740D [Brassica napus]
Length=1004

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 123/189 (65%), Gaps = 5/189 (3%)
 Frame = +1

Query  103  AMEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISR--Nvkgglvll  276
            AMEA+     +P SVLS++R+E RK P    SL         S E++ R  N    L+  
Sbjct  469  AMEALKTASFSPTSVLSDKRSETRK-PFSLPSLFPPKPPKPISQESLFRSFNGGLALLTS  527

Query  277  ssvmssglAKALTYEEALQQTSVS-TDFDPSGVMETVTTFAGDNpvivaggvailavpll  453
                ++  A +LTYEEALQQ++ S + FD  G+++ +++F  DNP+++AGGVA  AVP +
Sbjct  528  VLSSATAPAISLTYEEALQQSTTSPSSFDSDGLIDGISSFVTDNPLVIAGGVAAFAVPFV  587

Query  454  vSQLLS-KPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVS  630
            +SQ+L+ KPK +GVESAK AY K   D N QLLDIR A +L++VGSP+I+GL K  V+  
Sbjct  588  LSQVLNKKPKSFGVESAKNAYTKFGTDENVQLLDIRAAADLRQVGSPNIKGLGKNTVSAV  647

Query  631  YNGEDKPGF  657
            YNGEDK GF
Sbjct  648  YNGEDKTGF  656



>emb|CBI40498.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 105/184 (57%), Gaps = 34/184 (18%)
 Frame = +1

Query  106  MEAVNALRLTPLSVLSERRNEPRKIpllpsslpfkslsssnsMEAISRNvkgglvllssv  285
            MEA+N   LTPLSVL +RR EPRKI                 + A+S           ++
Sbjct  1    MEALNLAGLTPLSVLRDRRTEPRKISS---------------LPAVS-----------AL  34

Query  286  mssglAKALTYEEALQQTSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQL  465
              S  A   T   ALQ+   +  F        V +F  +NP +VAGG  IL VPL++SQL
Sbjct  35   KISSSATFNTTPPALQEC-FTRSFH-------VISFGVENPAVVAGGALILVVPLVLSQL  86

Query  466  LSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGED  645
            L KPKPWGVESA+ AYAKL DDA AQLLDIR   E ++VGSPDIRGL+KKPV +   G D
Sbjct  87   LKKPKPWGVESARNAYAKLGDDATAQLLDIREPVEFRQVGSPDIRGLRKKPVAIPCKGGD  146

Query  646  KPGF  657
            K  F
Sbjct  147  KQAF  150



>gb|EPS66030.1| hypothetical protein M569_08743, partial [Genlisea aurea]
Length=390

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 91/129 (71%), Gaps = 16/129 (12%)
 Frame = +1

Query  301  AKALTYEEALQQTSVSTDFDPSGV----------METVTTFAGDNpvivaggvailavpl  450
            AK+LTYE+AL+Q+S      P+GV          +E+ TTFA +NP IVAGGVA+ AVPL
Sbjct  19   AKSLTYEQALEQSS------PAGVDFDFDFDFTGVESFTTFAAENPAIVAGGVAVFAVPL  72

Query  451  lvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVS  630
            LVS LL KP+ WGV+SA+ AY KL +D  AQLLDIR   ++ + GSPDI GLKKKP  V 
Sbjct  73   LVSLLLGKPRAWGVDSARNAYLKLGEDPAAQLLDIRSPGDIGQSGSPDISGLKKKPAAVL  132

Query  631  YNGEDKPGF  657
            Y GEDKPGF
Sbjct  133  YRGEDKPGF  141



>ref|XP_007219299.1| hypothetical protein PRUPE_ppa018863mg, partial [Prunus persica]
 gb|EMJ20498.1| hypothetical protein PRUPE_ppa018863mg, partial [Prunus persica]
Length=336

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  457  SQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYN  636
            SQ+L  PKPWGV++A+ AYAKL DDANAQLLDIR   E ++VG+PD+RGL KK V + Y 
Sbjct  15   SQVLKPPKPWGVDTARNAYAKLGDDANAQLLDIRSPAEFRQVGTPDVRGLGKKAVPIVYK  74

Query  637  GEDKPGF  657
            GEDKPGF
Sbjct  75   GEDKPGF  81



>gb|ABR16588.1| unknown [Picea sitchensis]
Length=463

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 81/125 (65%), Gaps = 8/125 (6%)
 Frame = +1

Query  301  AKALTYEEALQQ------TSVSTDFDPSGVMETVTTFAGDNpvivaggvailavpllvSQ  462
            A ALTYEEALQQ      T    D D +G+ + V +F  +N V +  GV ++ +PL++++
Sbjct  83   ASALTYEEALQQGVSSSPTEAPADLDVNGITDAVLSFTAENSVAIIAGVVLVGLPLVLTR  142

Query  463  LLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGE  642
            +LS PK WG  SA+ AY+KL D+  AQL+DIR  +++KEVGSPDIR LKK+   + Y  E
Sbjct  143  ILSNPKTWGTVSAEDAYSKLGDEPEAQLVDIRTLQDIKEVGSPDIRSLKKRVAQIFY--E  200

Query  643  DKPGF  657
            D   F
Sbjct  201  DDESF  205



>ref|XP_006847355.1| hypothetical protein AMTR_s00015p00257490 [Amborella trichopoda]
 gb|ERN08936.1| hypothetical protein AMTR_s00015p00257490 [Amborella trichopoda]
Length=455

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 82/196 (42%), Positives = 122/196 (62%), Gaps = 20/196 (10%)
 Frame = +1

Query  106  MEAVNALRLT--PLS-----VLSERRNEPRKIpllpssl------pfkslsssnsMEAIS  246
            ME +NA RLT  P+S     + S+R+ EPRK+     +          S  SSN  E +S
Sbjct  1    MEVLNAARLTLTPVSLYKPTITSDRKTEPRKLIYHQFATNPKLSTSSNSNPSSNLSEFLS  60

Query  247  RNvkgglvllssvmss-glAKALTYEEALQQ-----TSVSTD-FDPSGVMETVTTFAGDN  405
            +++ G   +L S +     A ALTYEEA++Q     TS   D FD  G+++++  F  +N
Sbjct  61   KSLLGTATVLYSSIFGGNSADALTYEEAIEQSLQTFTSGGADSFDLGGLVDSIVQFGMEN  120

Query  406  pvivaggvailavpllvSQLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVG  585
            P I+AGG  +LAVPL+++  L KPK WGV+SA TAY+KLA+D ++QLLDIR   +++ VG
Sbjct  121  PAILAGGATVLAVPLILASFLQKPKGWGVKSAITAYSKLAEDGDSQLLDIRGVEDIRMVG  180

Query  586  SPDIRGLKKKPVTVSY  633
            SPD++ LKK+ V++ +
Sbjct  181  SPDLKSLKKRSVSIPF  196



>pdb|1VEE|A Chain A, Nmr Structure Of The Hypothetical Rhodanese Domain At4g01050 
From Arabidopsis Thaliana
 pdb|2DCQ|A Chain A, Fully Automated Nmr Structure Determination Of The Rhodanese 
Homology Domain At4g01050(175-295) From Arabidopsis 
Thaliana
Length=134

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +1

Query  499  AKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            AK AY KL  D NAQLLDIR   + ++VGSP+I+GL KK V+  YNGEDKPGF
Sbjct  9    AKNAYTKLGTDDNAQLLDIRATADFRQVGSPNIKGLGKKAVSTVYNGEDKPGF  61



>ref|XP_003572147.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic 
[Brachypodium distachyon]
Length=471

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +1

Query  478  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            KP+G  S K AY +L ++ +AQL+DIRP ++ +EVGSPDIR  KKK V V Y+GEDK GF
Sbjct  123  KPYGTVSGKAAYQRLLEEPDAQLVDIRPLKDAREVGSPDIREAKKKAVAVPYDGEDKNGF  182



>ref|XP_002451894.1| hypothetical protein SORBIDRAFT_04g009380 [Sorghum bicolor]
 gb|EES04870.1| hypothetical protein SORBIDRAFT_04g009380 [Sorghum bicolor]
Length=443

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  478  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            KP+ V SA+ AY +L ++ +AQL+DIRP ++ +E G+PD++  KKK   V YNGEDK GF
Sbjct  120  KPYAVVSARAAYQRLLEEPDAQLVDIRPLKDAREDGTPDLKEAKKKVAAVPYNGEDKNGF  179



>gb|EMT20251.1| hypothetical protein F775_01839 [Aegilops tauschii]
Length=291

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +1

Query  457  SQLLS-KPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSY  633
            SQ+L    KP+   S K AY +L ++ +AQL+DIRP ++ +EVGSPDI   KKK   V Y
Sbjct  47   SQVLGGASKPYETVSVKAAYRRLLEEPDAQLVDIRPLKDAREVGSPDISEAKKKAAAVPY  106

Query  634  NGEDKPGF  657
            +GEDK GF
Sbjct  107  DGEDKNGF  114



>gb|EMS45759.1| hypothetical protein TRIUR3_22780 [Triticum urartu]
Length=302

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = +1

Query  478  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            KP+   S K AY +L ++ +AQL+DIRP ++ +EVG PDI   KKK V V Y+GEDK GF
Sbjct  61   KPYETVSVKAAYRRLLEEPDAQLVDIRPLKDAREVGLPDISEAKKKAVAVPYDGEDKNGF  120



>gb|EAY85255.1| hypothetical protein OsI_06628 [Oryza sativa Indica Group]
Length=476

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  478  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            KP+GV SA  AY  L ++  AQL+DIRP  + ++ G+PD+R  KKK   V Y+GEDK GF
Sbjct  124  KPYGVVSAAAAYRALVEEPGAQLVDIRPPGDARQSGAPDLREAKKKAAAVPYDGEDKNGF  183



>ref|NP_001046473.1| Os02g0257300 [Oryza sativa Japonica Group]
 dbj|BAD27963.1| hydroxyproline-rich glycoprotein-like [Oryza sativa Japonica 
Group]
 dbj|BAF08387.1| Os02g0257300 [Oryza sativa Japonica Group]
 gb|EAZ22465.1| hypothetical protein OsJ_06134 [Oryza sativa Japonica Group]
Length=478

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  478  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            KP+GV SA  AY  L ++  AQL+DIRP  + ++ G+PD+R  KKK   V Y+GEDK GF
Sbjct  126  KPYGVVSAAAAYRALVEEPGAQLVDIRPPGDARQSGAPDLREAKKKAAAVPYDGEDKNGF  185



>ref|XP_004951282.1| PREDICTED: rhodanese-like domain-containing protein 4, chloroplastic-like 
[Setaria italica]
Length=450

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +1

Query  478  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            K + V SA+TAY +L ++   QL+DIR  ++ +E G+PD+R  KKK   V YNGEDK GF
Sbjct  123  KSYAVVSARTAYQRLLEEPGVQLVDIRALKDAREAGAPDLREAKKKAAAVPYNGEDKNGF  182



>gb|AFW71054.1| hypothetical protein ZEAMMB73_066102 [Zea mays]
Length=437

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  478  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            KP+ V SAK AY +L ++ +AQL+DIRP ++ +E G+PD++  KKK   V YNGEDK GF
Sbjct  119  KPYSVLSAKAAYQRLLEEPDAQLVDIRPLKDAREAGTPDLKEAKKKAAAVPYNGEDKNGF  178



>ref|XP_008681054.1| PREDICTED: uncharacterized protein LOC100192599 isoform X1 [Zea 
mays]
 gb|AFW71053.1| hypothetical protein ZEAMMB73_066102 [Zea mays]
Length=466

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  478  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            KP+ V SAK AY +L ++ +AQL+DIRP ++ +E G+PD++  KKK   V YNGEDK GF
Sbjct  119  KPYSVLSAKAAYQRLLEEPDAQLVDIRPLKDAREAGTPDLKEAKKKAAAVPYNGEDKNGF  178



>ref|NP_001131286.1| uncharacterized protein LOC100192599 [Zea mays]
 gb|ACF79627.1| unknown [Zea mays]
Length=476

 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  478  KPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            KP+ V SAK AY +L ++ +AQL+DIRP ++ +E G+PD++  KKK   V YNGEDK GF
Sbjct  119  KPYSVLSAKAAYQRLLEEPDAQLVDIRPLKDAREAGTPDLKEAKKKAAAVPYNGEDKNGF  178



>ref|XP_002991602.1| hypothetical protein SELMODRAFT_448468 [Selaginella moellendorffii]
 gb|EFJ07356.1| hypothetical protein SELMODRAFT_448468 [Selaginella moellendorffii]
Length=438

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +1

Query  370  VMETVTTFAGDNpvivaggvailavpllvSQLLSKPKPWGVESAKTAYAKLA-DDANAQL  546
            V E+V  F  DNP  VAGG+  +A+P+L+S+L    +PWGV SAK AY KLA  D   Q+
Sbjct  95   VAESVLGFVSDNPAAVAGGLLAIALPVLISRLAGGKQPWGVVSAKEAYEKLAVKDPAFQI  154

Query  547  LDIRPARELKEVGSPDIRGLKKKPVTVSYNGE  642
            LDIR   ++K  G+PD+R  KK+ + VS++ E
Sbjct  155  LDIREPSDIKAEGTPDLRQFKKRVLQVSFSQE  186



>ref|XP_002971531.1| hypothetical protein SELMODRAFT_441569 [Selaginella moellendorffii]
 gb|EFJ27280.1| hypothetical protein SELMODRAFT_441569 [Selaginella moellendorffii]
Length=438

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +1

Query  370  VMETVTTFAGDNpvivaggvailavpllvSQLLSKPKPWGVESAKTAYAKLA-DDANAQL  546
            V E+V  F  DNP  VAGG+  +A+P+L+S+L    +PWGV SAK AY KLA  D   Q+
Sbjct  95   VAESVLGFVSDNPAAVAGGLLAIALPVLISRLAGGKQPWGVVSAKEAYEKLAVKDPAFQI  154

Query  547  LDIRPARELKEVGSPDIRGLKKKPVTVSYNGE  642
            LDIR   ++K  G+PD+R  KK+ + VS++ E
Sbjct  155  LDIREPSDIKAEGTPDLRQFKKRVLQVSFSQE  186



>ref|XP_007049538.1| Rhodanese/Cell cycle control phosphatase superfamily protein, 
putative [Theobroma cacao]
 gb|EOX93695.1| Rhodanese/Cell cycle control phosphatase superfamily protein, 
putative [Theobroma cacao]
Length=369

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ KL DD+NAQLLDIR  + L  + SP+++ L K  V V +  ED+ GF
Sbjct  165  SAIDAFGKLRDDSNAQLLDIRDDKTLASLASPNLKFLNKDSVQVQFTAEDENGF  218



>ref|XP_004149327.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
[Cucumis sativus]
Length=240

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ K+ D+ NAQLLD+R  + L  +GSP++R L K  V V Y+ ED+ GF
Sbjct  162  SAINAFRKIRDEPNAQLLDVREEKSLAVLGSPNLRILNKDVVRVVYSEEDEDGF  215



>ref|XP_002527287.1| chitinase, putative [Ricinus communis]
 gb|EEF35131.1| chitinase, putative [Ricinus communis]
Length=315

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ KL +D +AQLLDIR  + +K +GSP+++ L K  V V ++ ED+ GF
Sbjct  138  SAINAFRKLKEDKDAQLLDIRDKKSVKALGSPNLKILDKSVVQVMFSEEDEDGF  191



>gb|EYU46074.1| hypothetical protein MIMGU_mgv1a008760mg [Erythranthe guttata]
Length=363

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +1

Query  484  WGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            + V SA  A+ KL DD  +QLLDIR ++ L  +GSP+++ L KK V V +   D+ GF
Sbjct  151  YKVISAINAFNKLRDDPTSQLLDIRDSKILASLGSPNLKFLNKKTVQVEFREGDEEGF  208



>gb|KGN44672.1| hypothetical protein Csa_7G368730 [Cucumis sativus]
Length=366

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ K+ D+ NAQLLD+R  + L  +GSP++R L K  V V Y+ ED+ GF
Sbjct  162  SAINAFRKIRDEPNAQLLDVREEKSLAVLGSPNLRILNKDVVRVVYSEEDEDGF  215



>ref|XP_008458097.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Cucumis melo]
Length=366

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (67%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ K+ D+ NAQLLD+R  + L  +GSP++R L K  V V Y+ ED+ GF
Sbjct  162  SAIDAFRKIRDEPNAQLLDVREEKSLAVLGSPNLRILNKDVVRVVYSEEDEDGF  215



>ref|XP_006469347.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
[Citrus sinensis]
Length=305

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ KL +D NAQLLDIR  + +  +GSP+++ LKK  V V +   D+ GF
Sbjct  138  SAIDAFQKLRNDPNAQLLDIRNKKTMVSLGSPNLKSLKKSVVQVEFVEGDENGF  191



>ref|XP_006447940.1| hypothetical protein CICLE_v10016082mg [Citrus clementina]
 ref|XP_006447941.1| hypothetical protein CICLE_v10016082mg [Citrus clementina]
 gb|ESR61180.1| hypothetical protein CICLE_v10016082mg [Citrus clementina]
 gb|ESR61181.1| hypothetical protein CICLE_v10016082mg [Citrus clementina]
Length=302

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ KL +D NAQLLDIR  + +  +GSP+++ LKK  V V +   D+ GF
Sbjct  135  SAIDAFQKLRNDPNAQLLDIRNKKTMVSLGSPNLKSLKKSVVQVEFVEGDENGF  188



>gb|KDO43509.1| hypothetical protein CISIN_1g039798mg, partial [Citrus sinensis]
Length=229

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ KL +D NAQLLDIR  + +  +GSP+++ LKK  V V +   D+ GF
Sbjct  62   SAIDAFQKLRNDPNAQLLDIRNKKTMVSLGSPNLKSLKKSVVQVEFVEGDENGF  115



>emb|CAN80760.1| hypothetical protein VITISV_014603 [Vitis vinifera]
Length=636

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ KL DD NAQLLDIR  + L  +GSP+++ L K  V V ++ +D+  F
Sbjct  146  SAINAFRKLRDDPNAQLLDIRDGKSLAYLGSPNLKILNKGVVQVQFSQDDEDAF  199



>ref|XP_010678998.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010678999.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=290

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA TA+ KL DD+  QLLDIR  +    +GSP++R   K  V V +N  D+ GF
Sbjct  137  SALTAFRKLRDDSCVQLLDIRDEKSKGYLGSPNLRMFSKNVVQVPFNQSDEDGF  190



>gb|KDP45207.1| hypothetical protein JCGZ_15072 [Jatropha curcas]
Length=333

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 39/66 (59%), Gaps = 3/66 (5%)
 Frame = +1

Query  460  QLLSKPKPWGVESAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNG  639
            QLL K   +   SA  A+ KL DD NAQLLDIR  + +  + SP+++ L K    V ++ 
Sbjct  119  QLLRK---YNFISAIDAFRKLKDDKNAQLLDIREKKSMVALESPNLKILDKTACQVEFSE  175

Query  640  EDKPGF  657
            ED+ GF
Sbjct  176  EDEDGF  181



>ref|XP_004493040.1| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic-like 
[Cicer arietinum]
Length=413

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ KL DD ++QLLDIR  + +K +GSP++  LKK+ V V +N  ++ GF
Sbjct  205  SAIDAFRKLRDDPDSQLLDIRDRKNVKFLGSPNLNMLKKEVVLVEFNEGNEDGF  258



>ref|XP_002271020.2| PREDICTED: rhodanese-like domain-containing protein 4A, chloroplastic 
[Vitis vinifera]
 emb|CBI23335.3| unnamed protein product [Vitis vinifera]
Length=355

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +1

Query  496  SAKTAYAKLADDANAQLLDIRPARELKEVGSPDIRGLKKKPVTVSYNGEDKPGF  657
            SA  A+ KL DD NAQLLDIR  + L  +GSP+++ L K  V V ++ +D+  F
Sbjct  148  SAINAFRKLRDDPNAQLLDIRDGKSLAYLGSPNLKILNKGVVQVQFSQDDEDAF  201



Lambda      K        H        a         alpha
   0.315    0.130    0.365    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500