BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF042K22

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797256.1|  PREDICTED: uncharacterized protein LOC104243716    245   2e-77   Nicotiana sylvestris
ref|XP_009631591.1|  PREDICTED: uncharacterized protein LOC104121329    243   2e-76   Nicotiana tomentosiformis
ref|XP_009626744.1|  PREDICTED: uncharacterized protein LOC104117398    243   2e-76   Nicotiana tomentosiformis
ref|XP_009791619.1|  PREDICTED: uncharacterized protein LOC104238836    241   8e-76   Nicotiana sylvestris
emb|CDP14558.1|  unnamed protein product                                239   4e-75   Coffea canephora [robusta coffee]
ref|XP_006359698.1|  PREDICTED: uncharacterized protein LOC102599645    236   5e-74   Solanum tuberosum [potatoes]
ref|XP_004231042.1|  PREDICTED: uncharacterized protein LOC101266077    233   6e-73   Solanum lycopersicum
ref|XP_004147043.1|  PREDICTED: uncharacterized protein LOC101219501    225   1e-69   Cucumis sativus [cucumbers]
ref|XP_002278836.1|  PREDICTED: uncharacterized protein LOC100243471    224   2e-69   Vitis vinifera
emb|CAN73631.1|  hypothetical protein VITISV_026643                     224   3e-69   Vitis vinifera
ref|XP_010265995.1|  PREDICTED: uncharacterized protein LOC104603629    224   5e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010107666.1|  hypothetical protein L484_008383                   221   3e-68   
ref|XP_008457698.1|  PREDICTED: uncharacterized protein LOC103497...    221   4e-68   Cucumis melo [Oriental melon]
ref|XP_008457697.1|  PREDICTED: uncharacterized protein LOC103497...    221   4e-68   
ref|XP_002534148.1|  DNA binding protein, putative                      221   4e-68   
ref|XP_006422593.1|  hypothetical protein CICLE_v10028931mg             221   4e-68   
gb|KDO68071.1|  hypothetical protein CISIN_1g024365mg                   221   5e-68   Citrus sinensis [apfelsine]
ref|XP_004505820.1|  PREDICTED: uncharacterized protein LOC101509009    221   5e-68   Cicer arietinum [garbanzo]
ref|XP_007041832.1|  Basic-leucine zipper (bZIP) transcription fa...    218   7e-68   
ref|XP_006422601.1|  hypothetical protein CICLE_v10028931mg             221   1e-67   
ref|XP_007041826.1|  Basic-leucine zipper transcription factor fa...    219   2e-67   
ref|XP_008236021.1|  PREDICTED: uncharacterized protein LOC103334...    219   2e-67   Prunus mume [ume]
ref|XP_007041828.1|  Basic-leucine zipper transcription factor fa...    219   2e-67   
ref|XP_008236016.1|  PREDICTED: uncharacterized protein LOC103334...    219   3e-67   Prunus mume [ume]
ref|XP_010266832.1|  PREDICTED: uncharacterized protein LOC104604256    219   4e-67   Nelumbo nucifera [Indian lotus]
ref|XP_007041827.1|  Basic-leucine zipper transcription factor fa...    219   7e-67   
gb|KHG28517.1|  Protein FD -like protein                                217   1e-66   Gossypium arboreum [tree cotton]
ref|XP_007201303.1|  hypothetical protein PRUPE_ppa009913mg             217   2e-66   Prunus persica
ref|XP_007131714.1|  hypothetical protein PHAVU_011G035700g             216   2e-66   Phaseolus vulgaris [French bean]
gb|KJB15817.1|  hypothetical protein B456_002G197800                    213   6e-65   Gossypium raimondii
ref|XP_003607180.1|  hypothetical protein MTR_4g073100                  213   7e-65   Medicago truncatula
gb|KJB32659.1|  hypothetical protein B456_005G254200                    212   1e-64   Gossypium raimondii
ref|XP_010028728.1|  PREDICTED: uncharacterized protein LOC104418944    212   2e-64   Eucalyptus grandis [rose gum]
ref|XP_002305521.2|  bZIP transcription factor family protein           211   3e-64   
ref|XP_006384577.1|  hypothetical protein POPTR_0004s18120g             211   3e-64   
gb|KDP29660.1|  hypothetical protein JCGZ_18822                         211   7e-64   Jatropha curcas
ref|XP_011046685.1|  PREDICTED: uncharacterized protein LOC105141...    208   4e-63   Populus euphratica
ref|XP_011046688.1|  PREDICTED: uncharacterized protein LOC105141...    208   4e-63   Populus euphratica
ref|XP_011046689.1|  PREDICTED: uncharacterized protein LOC105141...    208   5e-63   Populus euphratica
gb|KJB12146.1|  hypothetical protein B456_002G003000                    208   5e-63   Gossypium raimondii
gb|KJB12148.1|  hypothetical protein B456_002G003000                    208   6e-63   Gossypium raimondii
ref|XP_010530900.1|  PREDICTED: uncharacterized protein LOC104807371    207   1e-62   Tarenaya hassleriana [spider flower]
ref|XP_010526894.1|  PREDICTED: uncharacterized protein LOC104804328    207   2e-62   Tarenaya hassleriana [spider flower]
gb|AFP19453.1|  bZIP transcription factor family protein 2              207   2e-62   Camellia sinensis [black tea]
ref|XP_006409392.1|  hypothetical protein EUTSA_v10022810mg             205   7e-62   Eutrema salsugineum [saltwater cress]
ref|XP_006409393.1|  hypothetical protein EUTSA_v10022810mg             205   8e-62   
ref|XP_010690366.1|  PREDICTED: uncharacterized protein LOC104903923    205   1e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009787001.1|  PREDICTED: uncharacterized protein LOC104235...    203   5e-61   Nicotiana sylvestris
ref|XP_006590380.1|  PREDICTED: bZIP transcription factor bZIP121...    202   6e-61   
ref|XP_009786999.1|  PREDICTED: uncharacterized protein LOC104235...    202   8e-61   Nicotiana sylvestris
ref|XP_004164905.1|  PREDICTED: uncharacterized protein LOC101232700    202   1e-60   
gb|KHN39873.1|  hypothetical protein glysoja_020613                     202   1e-60   Glycine soja [wild soybean]
ref|XP_008447959.1|  PREDICTED: uncharacterized protein LOC103490288    202   1e-60   Cucumis melo [Oriental melon]
ref|XP_004144846.1|  PREDICTED: uncharacterized protein LOC101208161    202   1e-60   Cucumis sativus [cucumbers]
ref|XP_011046168.1|  PREDICTED: uncharacterized protein LOC105140851    202   1e-60   Populus euphratica
ref|NP_001237296.1|  bZIP transcription factor bZIP121                  202   2e-60   
gb|AAM63358.1|  putative transcription factor                           200   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006284366.1|  hypothetical protein CARUB_v10005538mg             199   9e-60   Capsella rubella
ref|XP_002313707.2|  hypothetical protein POPTR_0009s13730g             199   1e-59   
ref|NP_567974.1|  transcription factor bZIP19                           199   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437531.1|  PREDICTED: uncharacterized protein LOC104721282    199   2e-59   
ref|XP_010432347.1|  PREDICTED: uncharacterized protein LOC104716633    199   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_002869111.1|  bZIP transcription factor family protein           199   2e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_010447005.1|  PREDICTED: uncharacterized protein LOC104729711    198   2e-59   Camelina sativa [gold-of-pleasure]
emb|CAA17769.1|  putative protein                                       199   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KFK30142.1|  hypothetical protein AALP_AA7G222200                    198   3e-59   Arabis alpina [alpine rockcress]
ref|XP_006412160.1|  hypothetical protein EUTSA_v10026007mg             197   5e-59   
ref|XP_006591923.1|  PREDICTED: bZIP transcription factor bZIP122...    196   2e-58   
ref|NP_001235033.1|  bZIP transcription factor bZIP122                  196   2e-58   Glycine max [soybeans]
ref|XP_009112401.1|  PREDICTED: uncharacterized protein LOC103837...    193   1e-57   
ref|XP_009112403.1|  PREDICTED: uncharacterized protein LOC103837...    193   1e-57   Brassica rapa
ref|XP_009624365.1|  PREDICTED: uncharacterized protein LOC104115438    192   4e-57   Nicotiana tomentosiformis
ref|XP_002884017.1|  DNA binding protein                                192   8e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_010548099.1|  PREDICTED: uncharacterized protein LOC104819648    191   2e-56   Tarenaya hassleriana [spider flower]
ref|XP_010467405.1|  PREDICTED: uncharacterized protein LOC104747472    188   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_011088608.1|  PREDICTED: uncharacterized protein LOC105169791    189   2e-55   Sesamum indicum [beniseed]
ref|XP_009108690.1|  PREDICTED: uncharacterized protein LOC103834377    188   2e-55   Brassica rapa
ref|XP_009376970.1|  PREDICTED: uncharacterized protein LOC103965622    188   3e-55   Pyrus x bretschneideri [bai li]
ref|XP_009376950.1|  PREDICTED: uncharacterized protein LOC103965600    188   3e-55   Pyrus x bretschneideri [bai li]
emb|CDY47478.1|  BnaA09g08870D                                          185   2e-54   Brassica napus [oilseed rape]
emb|CDY17503.1|  BnaC03g65600D                                          185   2e-54   Brassica napus [oilseed rape]
emb|CDX76308.1|  BnaA08g10920D                                          184   8e-54   
ref|XP_006298365.1|  hypothetical protein CARUB_v10014436mg             184   8e-54   Capsella rubella
ref|XP_008377738.1|  PREDICTED: uncharacterized protein LOC103440807    183   1e-53   
ref|XP_010327411.1|  PREDICTED: uncharacterized protein LOC104649609    183   2e-53   Solanum lycopersicum
emb|CDY26786.1|  BnaC09g09130D                                          182   2e-53   Brassica napus [oilseed rape]
ref|XP_009355669.1|  PREDICTED: uncharacterized protein LOC103946638    181   1e-52   Pyrus x bretschneideri [bai li]
ref|NP_179268.2|  transcription factor bZIP23                           180   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAD24610.1|  hypothetical protein                                    179   6e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004289872.1|  PREDICTED: uncharacterized protein LOC101314521    179   8e-52   Fragaria vesca subsp. vesca
ref|XP_011092972.1|  PREDICTED: uncharacterized protein LOC105173...    179   1e-51   Sesamum indicum [beniseed]
ref|XP_011092974.1|  PREDICTED: uncharacterized protein LOC105173...    179   1e-51   Sesamum indicum [beniseed]
gb|AFP19452.1|  bZIP transcription factor family protein 1              179   1e-51   Camellia sinensis [black tea]
ref|XP_010516149.1|  PREDICTED: uncharacterized protein LOC104791854    178   1e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010489260.1|  PREDICTED: uncharacterized protein LOC104766980    178   1e-51   Camelina sativa [gold-of-pleasure]
gb|EYU37954.1|  hypothetical protein MIMGU_mgv1a011243mg                177   8e-51   Erythranthe guttata [common monkey flower]
emb|CDX89748.1|  BnaC03g46620D                                          173   9e-50   
ref|XP_009408222.1|  PREDICTED: uncharacterized protein LOC103990...    166   4e-47   
gb|ACI90291.1|  putative bZIP transcription factor                      167   6e-47   Picrorhiza kurrooa
ref|XP_009391011.1|  PREDICTED: uncharacterized protein LOC103977271    166   1e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX69107.1|  BnaC01g03460D                                          166   1e-46   
ref|XP_009408220.1|  PREDICTED: uncharacterized protein LOC103990...    165   2e-46   
ref|XP_006656494.1|  PREDICTED: uncharacterized protein LOC102721653    160   2e-44   Oryza brachyantha
ref|NP_001058591.1|  Os06g0716800                                       160   2e-44   
gb|AAL79736.1|AC091774_27  putative transcription factor                160   4e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004966468.1|  PREDICTED: uncharacterized protein LOC101762...    158   7e-44   
ref|XP_002439031.1|  hypothetical protein SORBIDRAFT_10g030250          158   2e-43   Sorghum bicolor [broomcorn]
ref|NP_001141059.1|  uncharacterized protein LOC100273140               157   3e-43   Zea mays [maize]
gb|ACG32751.1|  DNA binding protein                                     157   3e-43   Zea mays [maize]
gb|EPS65924.1|  hypothetical protein M569_08855                         155   5e-43   Genlisea aurea
ref|XP_009401478.1|  PREDICTED: uncharacterized protein LOC103985487    156   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW69519.1|  putative bZIP transcription factor superfamily pr...    156   3e-42   
ref|XP_010935120.1|  PREDICTED: uncharacterized protein LOC105055101    154   4e-42   Elaeis guineensis
ref|XP_006846902.1|  hypothetical protein AMTR_s00152p00031760          154   7e-42   Amborella trichopoda
ref|XP_009136335.1|  PREDICTED: uncharacterized protein LOC103860484    152   1e-41   Brassica rapa
emb|CDY02237.1|  BnaA03g39300D                                          152   1e-41   
ref|XP_003563276.1|  PREDICTED: uncharacterized protein LOC100823660    151   5e-41   Brachypodium distachyon [annual false brome]
ref|XP_009418779.1|  PREDICTED: uncharacterized protein LOC103998893    148   7e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009106517.1|  PREDICTED: uncharacterized protein LOC103832273    147   1e-39   Brassica rapa
emb|CDY52654.1|  BnaAnng11690D                                          146   2e-39   Brassica napus [oilseed rape]
ref|XP_008800178.1|  PREDICTED: uncharacterized protein LOC103714...    146   3e-39   Phoenix dactylifera
ref|XP_008800177.1|  PREDICTED: uncharacterized protein LOC103714...    146   6e-39   
ref|XP_010920114.1|  PREDICTED: uncharacterized protein LOC105044037    142   1e-37   Elaeis guineensis
ref|XP_008790182.1|  PREDICTED: uncharacterized protein LOC103707462    141   3e-37   Phoenix dactylifera
ref|XP_008813516.1|  PREDICTED: uncharacterized protein LOC103724133    141   3e-37   
ref|XP_001758867.1|  predicted protein                                  135   5e-36   
ref|NP_001148839.1|  LOC100282457                                       137   9e-36   Zea mays [maize]
ref|XP_008647848.1|  PREDICTED: LOC100282457 isoform X1                 137   9e-36   Zea mays [maize]
gb|KJB76278.1|  hypothetical protein B456_012G081200                    133   3e-34   Gossypium raimondii
gb|KJB76277.1|  hypothetical protein B456_012G081200                    133   3e-34   Gossypium raimondii
gb|EMT00406.1|  hypothetical protein F775_29696                         132   8e-34   
ref|XP_011091785.1|  PREDICTED: putative transcription factor kapC      120   2e-29   
ref|XP_008788583.1|  PREDICTED: uncharacterized protein LOC103706294    117   2e-28   Phoenix dactylifera
emb|CBI37871.3|  unnamed protein product                                110   8e-27   Vitis vinifera
gb|EMS54685.1|  hypothetical protein TRIUR3_17772                       114   2e-26   Triticum urartu
dbj|BAJ84803.1|  predicted protein                                      110   9e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT32713.1|  hypothetical protein F775_17323                         111   2e-25   
gb|EMT13528.1|  hypothetical protein F775_07298                         109   2e-25   
ref|XP_007149027.1|  hypothetical protein PHAVU_005G034400g             108   7e-25   Phaseolus vulgaris [French bean]
gb|EMS67651.1|  hypothetical protein TRIUR3_23486                       108   9e-25   Triticum urartu
emb|CDP21594.1|  unnamed protein product                                106   6e-24   Coffea canephora [robusta coffee]
gb|EMS45140.1|  hypothetical protein TRIUR3_21208                       105   6e-24   Triticum urartu
emb|CAB41316.1|  putative protein                                       103   6e-24   Arabidopsis thaliana [mouse-ear cress]
gb|EMS47152.1|  hypothetical protein TRIUR3_12850                       102   4e-23   Triticum urartu
ref|XP_003566090.1|  PREDICTED: uncharacterized protein LOC100823248    102   5e-23   Brachypodium distachyon [annual false brome]
gb|EMT32723.1|  hypothetical protein F775_08202                         101   7e-23   
gb|EMT18405.1|  hypothetical protein F775_16738                         101   8e-23   
dbj|BAJ86065.1|  predicted protein                                      101   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_190764.2|  basic leucine zipper 24                               101   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010922246.1|  PREDICTED: uncharacterized protein LOC105045595    101   2e-22   Elaeis guineensis
ref|NP_850680.1|  basic leucine zipper 24                               100   2e-22   Arabidopsis thaliana [mouse-ear cress]
gb|EMT32714.1|  hypothetical protein F775_17324                       99.4    4e-22   
gb|EMS52367.1|  hypothetical protein TRIUR3_01653                     99.4    4e-22   Triticum urartu
emb|CDM84592.1|  unnamed protein product                              99.8    6e-22   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002973971.1|  hypothetical protein SELMODRAFT_414462           99.8    1e-21   Selaginella moellendorffii
ref|XP_002969093.1|  hypothetical protein SELMODRAFT_409920           99.8    2e-21   Selaginella moellendorffii
ref|XP_006403861.1|  hypothetical protein EUTSA_v10010764mg           97.4    2e-21   
ref|XP_002877837.1|  bZIP family transcription factor                 98.2    2e-21   
ref|XP_006291938.1|  hypothetical protein CARUB_v10018125mg           97.4    2e-21   Capsella rubella
ref|XP_008647614.1|  PREDICTED: putative bZIP transcription facto...  98.6    5e-21   
ref|XP_010426786.1|  PREDICTED: uncharacterized protein LOC104711...  96.3    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010426784.1|  PREDICTED: uncharacterized protein LOC104711...  97.4    6e-21   Camelina sativa [gold-of-pleasure]
emb|CDY60641.1|  BnaCnng36700D                                        96.3    6e-21   Brassica napus [oilseed rape]
ref|NP_001142351.1|  putative bZIP transcription factor superfami...  97.1    6e-21   Zea mays [maize]
ref|XP_004970277.1|  PREDICTED: uncharacterized protein LOC101760...  96.7    8e-21   Setaria italica
ref|XP_010104020.1|  hypothetical protein L484_001603                 96.7    1e-20   
emb|CDY23178.1|  BnaA04g05810D                                        95.9    1e-20   Brassica napus [oilseed rape]
ref|XP_010515638.1|  PREDICTED: uncharacterized protein LOC104791...  95.5    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010515641.1|  PREDICTED: uncharacterized protein LOC104791...  95.1    2e-20   Camelina sativa [gold-of-pleasure]
gb|ACN36681.1|  unknown                                               94.4    7e-20   Zea mays [maize]
ref|XP_006850552.1|  hypothetical protein AMTR_s00159p00081760        94.0    1e-19   
ref|XP_008344616.1|  PREDICTED: uncharacterized protein LOC103407459  92.4    4e-19   
gb|KDO83274.1|  hypothetical protein CISIN_1g024477mg                 92.8    4e-19   Citrus sinensis [apfelsine]
dbj|BAK03166.1|  predicted protein                                    91.7    6e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006438937.1|  hypothetical protein CICLE_v10032430mg           92.0    7e-19   Citrus clementina [clementine]
ref|XP_009354398.1|  PREDICTED: transcription factor TGA3             90.5    2e-18   
ref|XP_010694687.1|  PREDICTED: GATA zinc finger domain-containin...  90.9    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006644854.1|  PREDICTED: uncharacterized protein LOC102712588  90.1    2e-18   Oryza brachyantha
ref|XP_010232460.1|  PREDICTED: uncharacterized protein LOC100829391  90.1    3e-18   Brachypodium distachyon [annual false brome]
ref|XP_011042101.1|  PREDICTED: uncharacterized protein LOC105137...  89.7    3e-18   Populus euphratica
gb|AEX11140.1|  hypothetical protein 0_12104_01                       87.4    4e-18   Pinus taeda
ref|XP_010279543.1|  PREDICTED: uncharacterized protein LOC104613430  90.1    4e-18   Nelumbo nucifera [Indian lotus]
gb|AEX11155.1|  hypothetical protein 0_12104_01                       87.4    4e-18   Pinus radiata
gb|AEX11142.1|  hypothetical protein 0_12104_01                       86.7    8e-18   Pinus taeda
gb|AEX11144.1|  hypothetical protein 0_12104_01                       86.3    9e-18   Pinus taeda
ref|XP_011042103.1|  PREDICTED: uncharacterized protein LOC105137...  88.2    1e-17   Populus euphratica
ref|XP_007008741.1|  Basic-leucine zipper transcription factor fa...  87.8    2e-17   
ref|XP_010269693.1|  PREDICTED: uncharacterized protein LOC104606282  88.2    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_009117143.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  86.3    2e-17   
ref|XP_002303896.2|  hypothetical protein POPTR_0003s20320g           85.9    8e-17   
ref|XP_004303083.1|  PREDICTED: uncharacterized protein LOC101298723  85.9    9e-17   Fragaria vesca subsp. vesca
ref|NP_001237285.1|  uncharacterized protein LOC100527780             84.3    2e-16   
gb|EYU42976.1|  hypothetical protein MIMGU_mgv1a023968mg              83.6    2e-16   Erythranthe guttata [common monkey flower]
gb|KHN22064.1|  hypothetical protein glysoja_008976                   84.3    3e-16   Glycine soja [wild soybean]
gb|EMS52399.1|  hypothetical protein TRIUR3_11502                     84.0    4e-16   Triticum urartu
emb|CAN72907.1|  hypothetical protein VITISV_033868                   82.4    1e-15   Vitis vinifera
gb|EEE52735.1|  hypothetical protein OsJ_35154                        82.0    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003633543.1|  PREDICTED: uncharacterized protein LOC100255414  82.0    2e-15   Vitis vinifera
ref|XP_006664845.1|  PREDICTED: uncharacterized protein LOC102716091  80.1    4e-15   
gb|KHN25468.1|  hypothetical protein glysoja_010385                   80.1    7e-15   Glycine soja [wild soybean]
ref|XP_006663805.1|  PREDICTED: uncharacterized protein LOC102722911  79.3    8e-15   
ref|XP_011037808.1|  PREDICTED: uncharacterized protein LOC105134916  79.3    2e-14   Populus euphratica
ref|XP_002299223.2|  hypothetical protein POPTR_0001s05750g           78.2    4e-14   Populus trichocarpa [western balsam poplar]
dbj|BAJ85954.1|  predicted protein                                    77.0    5e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001055929.1|  Os05g0495200                                     77.4    6e-14   
ref|XP_006368575.1|  hypothetical protein POPTR_0001s05750g           77.4    6e-14   
gb|EAY98546.1|  hypothetical protein OsI_20459                        77.4    6e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_002456496.1|  hypothetical protein SORBIDRAFT_03g037300        76.3    9e-14   
ref|XP_008364717.1|  PREDICTED: uncharacterized protein LOC103428389  76.3    2e-13   
ref|XP_006654590.1|  PREDICTED: uncharacterized protein LOC102713546  75.1    4e-13   Oryza brachyantha
ref|XP_003577077.2|  PREDICTED: uncharacterized protein LOC100844010  74.7    4e-13   
ref|XP_007219551.1|  hypothetical protein PRUPE_ppa019868mg           73.2    2e-12   
ref|XP_008231529.1|  PREDICTED: uncharacterized protein LOC103330...  72.4    2e-12   Prunus mume [ume]
gb|EAY79873.1|  hypothetical protein OsI_35035                        75.5    3e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_009395944.1|  PREDICTED: uncharacterized protein LOC103981078  72.0    4e-12   
gb|AFW82390.1|  putative bZIP transcription factor superfamily pr...  72.0    5e-12   
ref|NP_001130683.1|  putative bZIP transcription factor superfami...  71.6    5e-12   Zea mays [maize]
ref|XP_008231525.1|  PREDICTED: uncharacterized protein LOC103330...  71.2    7e-12   Prunus mume [ume]
emb|CBI28617.3|  unnamed protein product                              72.4    1e-11   Vitis vinifera
ref|XP_008786882.1|  PREDICTED: uncharacterized protein LOC103705064  70.1    2e-11   Phoenix dactylifera
ref|XP_002441312.1|  hypothetical protein SORBIDRAFT_09g024290        68.9    4e-11   
gb|EAY82198.1|  hypothetical protein OsI_37401                        71.2    6e-11   Oryza sativa Indica Group [Indian rice]
dbj|BAJ84101.1|  RNA-dependent RNA polymerase                         65.9    1e-10   Bat coronavirus M.ful/Japan/02/2010
gb|EMS45371.1|  hypothetical protein TRIUR3_18393                     65.5    4e-10   Triticum urartu
ref|XP_010931563.1|  PREDICTED: uncharacterized protein LOC105052451  65.9    6e-10   Elaeis guineensis
gb|EAZ13857.1|  hypothetical protein OsJ_03780                        64.7    6e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAY76169.1|  hypothetical protein OsI_04102                        64.7    7e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004961638.1|  PREDICTED: uncharacterized protein LOC101767291  64.7    1e-09   Setaria italica
ref|XP_010692028.1|  PREDICTED: uncharacterized protein LOC104905249  63.9    5e-09   Beta vulgaris subsp. vulgaris [field beet]
gb|ABP88241.1|  transcription factor bZIP120                          50.4    5e-05   Glycine max [soybeans]
ref|XP_009395145.1|  PREDICTED: uncharacterized protein LOC103980446  49.7    3e-04   Musa acuminata subsp. malaccensis [pisang utan]



>ref|XP_009797256.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797257.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797258.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797259.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797260.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
Length=273

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 145/160 (91%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEFSNQEMLSSSNF EFPDS S MDSF NEILKDTHACTH HTCNPPGPDN+HTH
Sbjct  1    MDDGELEFSNQEMLSSSNFGEFPDSGS-MDSFFNEILKDTHACTHTHTCNPPGPDNTHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKIVP P  EDK  SDDTAES + K KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCYHVHTKIVP-PLSEDKTASDDTAESAEGKRKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRA+NQQL+KRLQGQAVLE+E+ARLKCLLVDIRGRIE
Sbjct  119  VVRLRAINQQLMKRLQGQAVLESEIARLKCLLVDIRGRIE  158



>ref|XP_009631591.1| PREDICTED: uncharacterized protein LOC104121329 [Nicotiana tomentosiformis]
 ref|XP_009631599.1| PREDICTED: uncharacterized protein LOC104121329 [Nicotiana tomentosiformis]
Length=273

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 144/160 (90%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEFSNQEMLSSSNF EFPDS   MDSF NEILKDTHACTH HTCNPPGPD++HTH
Sbjct  1    MDDGELEFSNQEMLSSSNFGEFPDS-GLMDSFFNEILKDTHACTHTHTCNPPGPDSTHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKIVP P  EDK  SDDTAES + K KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCYHVHTKIVP-PLSEDKTASDDTAESAEGKRKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRA+NQQL+KRLQGQAVLEAE+ARLKCLLVDIRGRIE
Sbjct  119  VVRLRAINQQLMKRLQGQAVLEAEIARLKCLLVDIRGRIE  158



>ref|XP_009626744.1| PREDICTED: uncharacterized protein LOC104117398 [Nicotiana tomentosiformis]
 ref|XP_009626745.1| PREDICTED: uncharacterized protein LOC104117398 [Nicotiana tomentosiformis]
Length=276

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 146/162 (90%), Gaps = 6/162 (4%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M DGELEFSNQEMLSSSNF EF   +S MDSF NEILKDTHACTHAHTCNPPGPDNSHTH
Sbjct  2    MADGELEFSNQEMLSSSNFGEF---SSSMDSFFNEILKDTHACTHAHTCNPPGPDNSHTH  58

Query  318  TCYHVHTKIVPAPSE--EDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  491
            TCYHVHTKIVP PSE  EDK PSDDTAES +KK KKRP+GN+EAVRKYREKKKARAA LE
Sbjct  59   TCYHVHTKIVP-PSEEDEDKNPSDDTAESSEKKGKKRPVGNKEAVRKYREKKKARAASLE  117

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D V+RLRA+NQQL KRLQGQAVLEAEVARLKCLLVDIRGRIE
Sbjct  118  DEVIRLRAINQQLFKRLQGQAVLEAEVARLKCLLVDIRGRIE  159



>ref|XP_009791619.1| PREDICTED: uncharacterized protein LOC104238836 [Nicotiana sylvestris]
 ref|XP_009791625.1| PREDICTED: uncharacterized protein LOC104238836 [Nicotiana sylvestris]
Length=276

 Score =   241 bits (615),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 139/162 (86%), Positives = 145/162 (90%), Gaps = 6/162 (4%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M DGELEFSNQEMLSSSNF EF   +S MDSF NEILKDTHACTHAHTCNPPGPDNSHTH
Sbjct  2    MADGELEFSNQEMLSSSNFGEF---SSSMDSFFNEILKDTHACTHAHTCNPPGPDNSHTH  58

Query  318  TCYHVHTKIVPAPSE--EDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  491
            TCYHVHTK VP PSE  EDK PSDDTAES +KK KKRP+GN+EAVRKYREKKKARAA LE
Sbjct  59   TCYHVHTKFVP-PSEEDEDKNPSDDTAESSEKKGKKRPVGNKEAVRKYREKKKARAASLE  117

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D V+RLRA+NQQL KRLQGQAVLEAEVARLKCLLVDIRGRIE
Sbjct  118  DEVIRLRAINQQLFKRLQGQAVLEAEVARLKCLLVDIRGRIE  159



>emb|CDP14558.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 145/160 (91%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEFSN EM S+S+F + P S S M SFL+EILKDTHACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELEFSNHEMFSNSSFGDLPSSCS-MGSFLDEILKDTHACTHTHTCNPPGPDNSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKIVPAPS EDK P+DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCYHVHTKIVPAPS-EDKTPTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQQL+KRLQGQAVLEAE+ARLKCLLVDIRGRIE
Sbjct  119  VVRLRALNQQLMKRLQGQAVLEAEIARLKCLLVDIRGRIE  158



>ref|XP_006359698.1| PREDICTED: uncharacterized protein LOC102599645 [Solanum tuberosum]
Length=272

 Score =   236 bits (603),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 134/160 (84%), Positives = 143/160 (89%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M DGEL+ SNQEMLSSSNF EF   +S MDSF NEILKD HACTHAHTCNPPGPDNSHTH
Sbjct  1    MADGELDISNQEMLSSSNFGEF---SSSMDSFFNEILKDAHACTHAHTCNPPGPDNSHTH  57

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKIVP  +++DK PSDDTAES D K KKRP+GN+EAVRKYREKKKARAA LED 
Sbjct  58   TCYHVHTKIVPT-TDDDKNPSDDTAESADNKGKKRPVGNKEAVRKYREKKKARAASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RLRA+NQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE
Sbjct  117  VIRLRAINQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  156



>ref|XP_004231042.1| PREDICTED: uncharacterized protein LOC101266077 [Solanum lycopersicum]
Length=270

 Score =   233 bits (595),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 133/160 (83%), Positives = 142/160 (89%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M DGEL+ S QEMLSSSNF EF   +S MDSF NEILKD HACTHAHTCNPPGPDNSHTH
Sbjct  1    MADGELDISTQEMLSSSNFGEF---SSSMDSFFNEILKDAHACTHAHTCNPPGPDNSHTH  57

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKIVP  +++DK PSDDTAES + K KKRP+GN+EAVRKYREKKKARAA LED 
Sbjct  58   TCYHVHTKIVPT-TDDDKNPSDDTAESAENKGKKRPVGNKEAVRKYREKKKARAASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRA+NQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE
Sbjct  117  VVRLRAINQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  156



>ref|XP_004147043.1| PREDICTED: uncharacterized protein LOC101219501 [Cucumis sativus]
 ref|XP_004158374.1| PREDICTED: uncharacterized LOC101219501 [Cucumis sativus]
 gb|KGN61936.1| hypothetical protein Csa_2G270780 [Cucumis sativus]
Length=273

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 141/160 (88%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            MEDGELE SN E+ SSSN  E P S S MDSF +EILKDTHACTHAHTCNPPGPD SHTH
Sbjct  1    MEDGELESSNPEVFSSSNAIELPSSCS-MDSFFDEILKDTHACTHAHTCNPPGPDYSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIV +P+EE K  +DDTA+SVDKK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVSSPTEE-KVSTDDTADSVDKKNKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQQLLKRLQGQA LEAE++RLKCLLVDIRGRIE
Sbjct  119  VVRLRALNQQLLKRLQGQAALEAEISRLKCLLVDIRGRIE  158



>ref|XP_002278836.1| PREDICTED: uncharacterized protein LOC100243471 [Vitis vinifera]
Length=273

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++ SS N  + P S S MDSF +EILKDTHACTH HTCNPPGPD SHTH
Sbjct  3    MDDGELDFSNQDVFSSPNMADLPSSCS-MDSFFDEILKDTHACTHTHTCNPPGPDFSHTH  61

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPAP+E++ A +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  62   TCFHVHTKIVPAPAEDNIA-TDDTAESAEKKSKKRPLGNREAVRKYREKKKARAASLEDE  120

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLR+LNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  121  VVRLRSLNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  160



>emb|CAN73631.1| hypothetical protein VITISV_026643 [Vitis vinifera]
Length=264

 Score =   224 bits (571),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 142/160 (89%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++ SS N  + P S S MDSF +EILKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNMADLPSSCS-MDSFFDEILKDTHACTHTHTCNPPGPDFSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPAP+E++ A +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVPAPAEDNIA-TDDTAESAEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLR+LNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  119  VVRLRSLNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  158



>ref|XP_010265995.1| PREDICTED: uncharacterized protein LOC104603629 [Nelumbo nucifera]
Length=280

 Score =   224 bits (570),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQEM SS N  + P S+  MDSF +E+L DTHACTH HTCNPPGPD +HTH
Sbjct  1    MDDGELDFSNQEMFSSPNMGDQPPSSCSMDSFFDELLNDTHACTHTHTCNPPGPDFTHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKI+ APS EDK  +DDTAESV+KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  61   TCFHVHTKILSAPS-EDKIATDDTAESVEKKAKKRPLGNREAVRKYREKKKARAASLEDE  119

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VV+LRALNQQLLKRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  120  VVKLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIE  159



>ref|XP_010107666.1| hypothetical protein L484_008383 [Morus notabilis]
 gb|EXC16577.1| hypothetical protein L484_008383 [Morus notabilis]
Length=262

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 141/161 (88%), Gaps = 3/161 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFC-EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  314
            M+DGE++FSNQE+ SS N   E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHT
Sbjct  1    MDDGEVDFSNQEVFSSPNIGGELPSSCS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHT  59

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTC+HVHTKIVPA S EDKA SDDTAES +KK KKRPLGNREAVRKYREKKKARAA LED
Sbjct  60   HTCFHVHTKIVPA-SGEDKAASDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLED  118

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             VVRLRA+NQQLLKRLQGQA LE+EVARLKCLLVDIRGRIE
Sbjct  119  EVVRLRAINQQLLKRLQGQAALESEVARLKCLLVDIRGRIE  159



>ref|XP_008457698.1| PREDICTED: uncharacterized protein LOC103497333 isoform X2 [Cucumis 
melo]
 ref|XP_008457699.1| PREDICTED: uncharacterized protein LOC103497333 isoform X2 [Cucumis 
melo]
Length=272

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 139/160 (87%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            MEDGELE SN E+ S SN  E P S S MDSF +EILKDTHACTHAHTCNPPGPD SHTH
Sbjct  1    MEDGELESSNPEVFSGSNAVELPSSCS-MDSFFDEILKDTHACTHAHTCNPPGPDYSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIV +P+EE K  +DDT +SVDKK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVSSPTEE-KLSTDDTEDSVDKKNKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQQLLKRLQGQA LEAEV+RLKCLLVDIRGRIE
Sbjct  119  VVRLRALNQQLLKRLQGQAALEAEVSRLKCLLVDIRGRIE  158



>ref|XP_008457697.1| PREDICTED: uncharacterized protein LOC103497333 isoform X1 [Cucumis 
melo]
Length=273

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 139/160 (87%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            MEDGELE SN E+ S SN  E P S S MDSF +EILKDTHACTHAHTCNPPGPD SHTH
Sbjct  1    MEDGELESSNPEVFSGSNAVELPSSCS-MDSFFDEILKDTHACTHAHTCNPPGPDYSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIV +P+EE K  +DDT +SVDKK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVSSPTEE-KLSTDDTEDSVDKKNKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQQLLKRLQGQA LEAEV+RLKCLLVDIRGRIE
Sbjct  119  VVRLRALNQQLLKRLQGQAALEAEVSRLKCLLVDIRGRIE  158



>ref|XP_002534148.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF28231.1| DNA binding protein, putative [Ricinus communis]
Length=284

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FS+QE+ S +N  E P+ N  MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSHQEVFSGTNMGEMPN-NCSMDSFFDELLKDTHACTHTHTCNPPGPDYSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIV APS +DK  +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVSAPS-DDKTGTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VV+LRALNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  119  VVKLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  158



>ref|XP_006422593.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422594.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422595.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422596.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422597.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422598.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422599.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422600.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006486739.1| PREDICTED: uncharacterized protein LOC102628933 isoform X1 [Citrus 
sinensis]
 ref|XP_006486740.1| PREDICTED: uncharacterized protein LOC102628933 isoform X2 [Citrus 
sinensis]
 ref|XP_006486741.1| PREDICTED: uncharacterized protein LOC102628933 isoform X3 [Citrus 
sinensis]
 gb|ESR35833.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35834.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35835.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35836.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35837.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35838.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35839.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35840.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|KDO68066.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68067.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68068.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68069.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68070.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
Length=268

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE++FSNQEMLS+ N  +FP  +  MDSF  +ILKDTHACTH HTCNPPGPD+SHTH
Sbjct  1    MDDGEVDFSNQEMLSA-NIGDFPSCS--MDSFFEDILKDTHACTHTHTCNPPGPDSSHTH  57

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIV AP+ EDK  +DDTAES +KK KKRPLGNREAVRKYREKKKAR A LED 
Sbjct  58   TCFHVHTKIV-APTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRA+NQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  117  VVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  156



>gb|KDO68071.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
Length=262

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE++FSNQEMLS+ N  +FP  +  MDSF  +ILKDTHACTH HTCNPPGPD+SHTH
Sbjct  1    MDDGEVDFSNQEMLSA-NIGDFPSCS--MDSFFEDILKDTHACTHTHTCNPPGPDSSHTH  57

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIV AP+ EDK  +DDTAES +KK KKRPLGNREAVRKYREKKKAR A LED 
Sbjct  58   TCFHVHTKIV-APTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRA+NQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  117  VVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  156



>ref|XP_004505820.1| PREDICTED: uncharacterized protein LOC101509009 [Cicer arietinum]
Length=269

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            MEDGEL+FSN E+ SS N  EFP S S MDSF +E+LKD+HACTH HTCNPPGPD+SHTH
Sbjct  1    MEDGELDFSNHEVFSSPNMGEFPSSGS-MDSFFDELLKDSHACTHTHTCNPPGPDSSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKIVPAP EED+  +DDTAES +KK KKRP GN+EAVRKYREKKKARAA LE+ 
Sbjct  60   TCYHVHTKIVPAP-EEDQIGTDDTAESAEKKSKKRPTGNKEAVRKYREKKKARAASLEEE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V++LRALNQ L+++LQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  119  VMKLRALNQHLMRKLQGQAALEAEVARLKCLLVDIRGRIE  158



>ref|XP_007041832.1| Basic-leucine zipper (bZIP) transcription factor family protein 
isoform 7, partial [Theobroma cacao]
 gb|EOX97663.1| Basic-leucine zipper (bZIP) transcription factor family protein 
isoform 7, partial [Theobroma cacao]
Length=202

 Score =   218 bits (556),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+F NQE+ S  N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSG-NMADIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPAP+ EDKA  DDTAES +KK KKRPLGNREAVRKYREK KARAA LED 
Sbjct  59   TCFHVHTKIVPAPT-EDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAASLEDE  117

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQQLLKRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  118  VVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIE  157



>ref|XP_006422601.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35841.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
Length=302

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 140/160 (88%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE++FSNQEMLS+ N  +FP  +  MDSF  +ILKDTHACTH HTCNPPGPD+SHTH
Sbjct  1    MDDGEVDFSNQEMLSA-NIGDFPSCS--MDSFFEDILKDTHACTHTHTCNPPGPDSSHTH  57

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIV AP+ EDK  +DDTAES +KK KKRPLGNREAVRKYREKKKAR A LED 
Sbjct  58   TCFHVHTKIV-APTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRA+NQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  117  VVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  156



>ref|XP_007041826.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041829.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041830.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041831.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97657.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97660.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97661.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97662.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
Length=266

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+F NQE+ S  N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSG-NMADIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPAP+ EDKA  DDTAES +KK KKRPLGNREAVRKYREK KARAA LED 
Sbjct  59   TCFHVHTKIVPAPT-EDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAASLEDE  117

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQQLLKRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  118  VVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIE  157



>ref|XP_008236021.1| PREDICTED: uncharacterized protein LOC103334826 isoform X2 [Prunus 
mume]
Length=265

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            MEDGEL+FSNQEM S  N      S+  MDSF +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQEMFSGPNMGGEHPSSCSMDSFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  318  TCYHVHTKIV-PAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            TC+HVHTKIV  A   EDKA +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED
Sbjct  61   TCFHVHTKIVSSATGSEDKAGTDDTAESGEKKSKKRPLGNREAVRKYREKKKARAASLED  120

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             VVRLRALNQQLLKRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  121  EVVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIE  161



>ref|XP_007041828.1| Basic-leucine zipper transcription factor family protein isoform 
3 [Theobroma cacao]
 gb|EOX97659.1| Basic-leucine zipper transcription factor family protein isoform 
3 [Theobroma cacao]
Length=281

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+F NQE+ S  N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSG-NMADIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPAP+ EDKA  DDTAES +KK KKRPLGNREAVRKYREK KARAA LED 
Sbjct  59   TCFHVHTKIVPAPT-EDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAASLEDE  117

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQQLLKRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  118  VVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIE  157



>ref|XP_008236016.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236017.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236018.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236020.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
Length=272

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 136/161 (84%), Gaps = 1/161 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            MEDGEL+FSNQEM S  N      S+  MDSF +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQEMFSGPNMGGEHPSSCSMDSFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  318  TCYHVHTKIV-PAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            TC+HVHTKIV  A   EDKA +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED
Sbjct  61   TCFHVHTKIVSSATGSEDKAGTDDTAESGEKKSKKRPLGNREAVRKYREKKKARAASLED  120

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             VVRLRALNQQLLKRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  121  EVVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIE  161



>ref|XP_010266832.1| PREDICTED: uncharacterized protein LOC104604256 [Nelumbo nucifera]
Length=273

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQE+ SS+N  +   S+  MD F +E+LKD  ACTH HTCNPPGPD++HTH
Sbjct  1    MDDGELDFSNQEVFSSANLGDQLPSSCSMDEFFDELLKDAQACTHTHTCNPPGPDSTHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKI+PAPS EDKA +DDT ESV+KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  61   TCFHVHTKILPAPS-EDKAATDDTEESVEKKAKKRPLGNREAVRKYREKKKARAASLEDE  119

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VV+LRALNQQLLKRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  120  VVKLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIE  159



>ref|XP_007041827.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOX97658.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
Length=310

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 138/160 (86%), Gaps = 3/160 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+F NQE+ S  N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSG-NMADIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPAP+ EDKA  DDTAES +KK KKRPLGNREAVRKYREK KARAA LED 
Sbjct  59   TCFHVHTKIVPAPT-EDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAASLEDE  117

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQQLLKRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  118  VVRLRALNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIE  157



>gb|KHG28517.1| Protein FD -like protein [Gossypium arboreum]
Length=261

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQE+ S +N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFSNQEVFSGNNMGDIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+H HTKIVPA S EDKA  DDTA S + K KKRPLGNREAVRKYREK KARAA LED 
Sbjct  60   TCFHFHTKIVPA-SSEDKAAIDDTAVSGENKSKKRPLGNREAVRKYREKVKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQQL+KRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  119  VVRLRALNQQLVKRLQGQAALEAEVARLKCLLVDIRGRIE  158



>ref|XP_007201303.1| hypothetical protein PRUPE_ppa009913mg [Prunus persica]
 gb|EMJ02502.1| hypothetical protein PRUPE_ppa009913mg [Prunus persica]
Length=272

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 135/161 (84%), Gaps = 1/161 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            MEDGEL+FSNQEM S  N      S+  MDSF +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQEMFSGPNMGGEHPSSCSMDSFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  318  TCYHVHTKIV-PAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            TC+HVHTKIV  A   EDKA +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED
Sbjct  61   TCFHVHTKIVSSATGSEDKAGTDDTAESGEKKSKKRPLGNREAVRKYREKKKARAASLED  120

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             VVRLR LNQQLLKRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  121  EVVRLRTLNQQLLKRLQGQAALEAEIARLKCLLVDIRGRIE  161



>ref|XP_007131714.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 ref|XP_007131715.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 gb|ESW03708.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 gb|ESW03709.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
Length=265

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FS  E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSTHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKIVPAP+ ED+  +DDTAES +KK KKRPLGN+EAVRKYREKKKARAA LED 
Sbjct  60   TCYHVHTKIVPAPA-EDQVATDDTAESAEKKSKKRPLGNKEAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VV+LRALNQ L+K+LQ QA LEAE+ARLKCLLVDIRGRIE
Sbjct  119  VVKLRALNQHLMKKLQSQAGLEAEIARLKCLLVDIRGRIE  158



>gb|KJB15817.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
 gb|KJB15818.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
 gb|KJB15819.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
Length=257

 Score =   213 bits (541),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 135/160 (84%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL++SNQE+ S +N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDYSNQEVFSVNNMGDIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+H HTKIVPA S EDKA  D TA S + K KKRPLGNREAVRKYREK KARAA LED 
Sbjct  60   TCFHFHTKIVPA-SSEDKAAIDGTAVSGENKSKKRPLGNREAVRKYREKVKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQQL+KRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  119  VVRLRALNQQLVKRLQGQAALEAEVARLKCLLVDIRGRIE  158



>ref|XP_003607180.1| hypothetical protein MTR_4g073100 [Medicago truncatula]
 gb|ACJ84596.1| unknown [Medicago truncatula]
 gb|AES89377.1| BZIP transcription factor [Medicago truncatula]
Length=267

 Score =   213 bits (541),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 139/161 (86%), Gaps = 4/161 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            MEDGEL+FSNQ++ SS N  EF  S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQDVFSSPNMGEFQTSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLED  494
            TCYHVHTKIVPA  E+D+  +DDTAES +KK  KKRP+GN+EAVRKYREKKKARAA LED
Sbjct  60   TCYHVHTKIVPA--EDDQVGTDDTAESAEKKSSKKRPVGNKEAVRKYREKKKARAASLED  117

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V++LRALNQ L+++LQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  118  EVMKLRALNQHLMRKLQGQAALEAEVARLKCLLVDIRGRIE  158



>gb|KJB32659.1| hypothetical protein B456_005G254200 [Gossypium raimondii]
 gb|KJB32660.1| hypothetical protein B456_005G254200 [Gossypium raimondii]
Length=266

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 137/160 (86%), Gaps = 3/160 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQE+ S +N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFSNQEVFSGNNMGDIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPA S EDKA  DDTA S + K KKRPLGNREAVRKYREK KARAA LED 
Sbjct  60   TCFHVHTKIVPA-STEDKASIDDTAGSRE-KSKKRPLGNREAVRKYREKVKARAASLEDE  117

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RLRA+NQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  118  VMRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  157



>ref|XP_010028728.1| PREDICTED: uncharacterized protein LOC104418944 [Eucalyptus grandis]
 gb|KCW55527.1| hypothetical protein EUGRSUZ_I01416 [Eucalyptus grandis]
 gb|KCW55528.1| hypothetical protein EUGRSUZ_I01416 [Eucalyptus grandis]
Length=269

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 138/166 (83%), Gaps = 8/166 (5%)
 Frame = +3

Query  138  MEDGELEFSNQEML------SSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGP  299
            M+DGEL+FSNQE+       S S   E P S S MDSFL EI +DTHACTH HTCNPPGP
Sbjct  1    MDDGELDFSNQEVFANHDVFSGSTLGEVPGSRS-MDSFLEEIFRDTHACTHTHTCNPPGP  59

Query  300  DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkara  479
            D+SHTHTC+HVHTKIVPA SEE K  +DDTAES++KK KKRPLGNREAVRKYREKKKARA
Sbjct  60   DSSHTHTCFHVHTKIVPATSEE-KVSTDDTAESMEKKSKKRPLGNREAVRKYREKKKARA  118

Query  480  aLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            A LED V RLRA+NQQL+KRLQ QA LEAE+ARLKCLLVDIRGRIE
Sbjct  119  ASLEDEVNRLRAVNQQLMKRLQNQAALEAEIARLKCLLVDIRGRIE  164



>ref|XP_002305521.2| bZIP transcription factor family protein [Populus trichocarpa]
 gb|EEE86032.2| bZIP transcription factor family protein [Populus trichocarpa]
Length=265

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 134/160 (84%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++LSS N  E P S S+   FL+E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDTHACTHTHTCNPPGPDYSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKI+P    EDK  SDDTAES DKK KKR  GNREAVRKYRE+KKA+AA LED 
Sbjct  59   TCYHVHTKILPPA--EDKVVSDDTAESTDKKSKKRSSGNREAVRKYRERKKAKAASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V  LRALNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  117  VKHLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  156



>ref|XP_006384577.1| hypothetical protein POPTR_0004s18120g [Populus trichocarpa]
 gb|ERP62374.1| hypothetical protein POPTR_0004s18120g [Populus trichocarpa]
Length=266

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 134/160 (84%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++LSS N  E P S S+   FL+E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDTHACTHTHTCNPPGPDYSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKI+P    EDK  SDDTAES DKK KKR  GNREAVRKYRE+KKA+AA LED 
Sbjct  59   TCYHVHTKILPPA--EDKVVSDDTAESTDKKSKKRSSGNREAVRKYRERKKAKAASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V  LRALNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  117  VKHLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  156



>gb|KDP29660.1| hypothetical protein JCGZ_18822 [Jatropha curcas]
Length=284

 Score =   211 bits (536),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 136/160 (85%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE++FS QE+ S++N  +    N  MD+F  E+ KD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGEVDFSQQEVFSNTNIGDI-QPNCSMDNFFEELFKDSHACTHTHTCNPPGPDFSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIV APS +DK  +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVSAPS-DDKTATDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VV+LRALNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  119  VVKLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  158



>ref|XP_011046685.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
 ref|XP_011046686.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
 ref|XP_011046687.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
Length=266

 Score =   208 bits (530),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++LSS N  E P S S+   FL+E+LKD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDSHACTHTHTCNPPGPDYSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKI+P    EDK  SDDTAES DKK KK+  GNREAVRKYRE+KKA+AA LED 
Sbjct  59   TCYHVHTKILPPA--EDKVVSDDTAESTDKKSKKQSSGNREAVRKYRERKKAKAASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V  LRALNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  117  VKHLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  156



>ref|XP_011046688.1| PREDICTED: uncharacterized protein LOC105141220 isoform X2 [Populus 
euphratica]
 ref|XP_011046690.1| PREDICTED: uncharacterized protein LOC105141220 isoform X2 [Populus 
euphratica]
Length=265

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++LSS N  E P S S+   FL+E+LKD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDSHACTHTHTCNPPGPDYSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKI+P    EDK  SDDTAES DKK KK+  GNREAVRKYRE+KKA+AA LED 
Sbjct  59   TCYHVHTKILPPA--EDKVVSDDTAESTDKKSKKQSSGNREAVRKYRERKKAKAASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V  LRALNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  117  VKHLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  156



>ref|XP_011046689.1| PREDICTED: uncharacterized protein LOC105141220 isoform X3 [Populus 
euphratica]
Length=265

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++LSS N  E P S S+   FL+E+LKD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDSHACTHTHTCNPPGPDYSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTKI+P    EDK  SDDTAES DKK KK+  GNREAVRKYRE+KKA+AA LED 
Sbjct  59   TCYHVHTKILPPA--EDKVVSDDTAESTDKKSKKQSSGNREAVRKYRERKKAKAASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V  LRALNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  117  VKHLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  156



>gb|KJB12146.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
 gb|KJB12147.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
Length=265

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M++GEL+FSN E+ S  N      S+  MDSF NEIL D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDEGELDFSNHEVFSGGNSMGDIPSSCSMDSFFNEILNDSHACTHTHTCNPPGPDNSHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPA S ED+A +DDT  S +KK KKR LGNREAVRKYR+K KARAA LED 
Sbjct  61   TCFHVHTKIVPA-STEDEAAADDTEGSREKKPKKRSLGNREAVRKYRQKVKARAASLEDE  119

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLR LNQQLLKRLQGQA LEAE+ARLKCLLVD+RGRIE
Sbjct  120  VVRLRTLNQQLLKRLQGQAALEAEIARLKCLLVDVRGRIE  159



>gb|KJB12148.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
Length=269

 Score =   208 bits (529),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M++GEL+FSN E+ S  N      S+  MDSF NEIL D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDEGELDFSNHEVFSGGNSMGDIPSSCSMDSFFNEILNDSHACTHTHTCNPPGPDNSHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPA S ED+A +DDT  S +KK KKR LGNREAVRKYR+K KARAA LED 
Sbjct  61   TCFHVHTKIVPA-STEDEAAADDTEGSREKKPKKRSLGNREAVRKYRQKVKARAASLEDE  119

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLR LNQQLLKRLQGQA LEAE+ARLKCLLVD+RGRIE
Sbjct  120  VVRLRTLNQQLLKRLQGQAALEAEIARLKCLLVDVRGRIE  159



>ref|XP_010530900.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530901.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530902.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530904.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530905.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530906.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530907.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530908.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530909.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530910.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530911.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530912.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
Length=270

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 138/160 (86%), Gaps = 1/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQE+ S+SN  +   S+  MD+F +E+L+D+HACTH HTCNPPGP+++HTH
Sbjct  1    MDDGELDFSNQEVFSNSNMDDIQPSSCSMDTFFDELLRDSHACTHTHTCNPPGPESTHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKI+PA SEE K  +DDTAE  +KK KKRP GNREAVRKYREKKKARAA LED 
Sbjct  61   TCFHVHTKILPAQSEE-KVSTDDTAEFSEKKNKKRPSGNREAVRKYREKKKARAASLEDE  119

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V++LRA NQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  120  VIKLRANNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  159



>ref|XP_010526894.1| PREDICTED: uncharacterized protein LOC104804328 [Tarenaya hassleriana]
Length=273

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 2/161 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE++FSNQE+ S+SN  E P S+  MD+F +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGEVDFSNQEVFSNSNMEEIPPSSCSMDTFFDELLRDSHACTHTHTCNPPGPENTHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVD-KKEKKRPLGNreavrkyrekkkaraaLLED  494
            TC+HVHTKI+PA SEE K  +DDTAES + KK KKRPLGNREAVRKYREKKKARAA LED
Sbjct  61   TCFHVHTKILPAQSEE-KVSADDTAESSEKKKNKKRPLGNREAVRKYREKKKARAASLED  119

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V++LRA+NQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  120  EVIKLRAINQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  160



>gb|AFP19453.1| bZIP transcription factor family protein 2 [Camellia sinensis]
Length=270

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 135/160 (84%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE++FSNQ++ SS N  E P S S MDSF +E+LKDT  CTH HTCNPPGPD SHTH
Sbjct  1    MDDGEIDFSNQDVFSSPNMGELPSSCS-MDSFFDELLKDT--CTHTHTCNPPGPDFSHTH  57

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPAP+ EDK  +DDTAES +KK KK P GNREAVRKYREKKKAR A LED 
Sbjct  58   TCFHVHTKIVPAPT-EDKVSTDDTAESSEKKSKKCPTGNREAVRKYREKKKARTASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRA+NQQL+KRLQGQA LE E+ARLKCLLVDIRGRIE
Sbjct  117  VVRLRAVNQQLVKRLQGQAALETEIARLKCLLVDIRGRIE  156



>ref|XP_006409392.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
 gb|ESQ50845.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
Length=263

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEFSNQE LS+    EFP SN  MDSF +E+L D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNQEALSNPKMPEFPPSNCSMDSFFDELLNDSHACTHTHTCNPPGPENTHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+PA S +DKA +DDT+ES  KK KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  61   TCLHVHTKILPAQS-DDKASTDDTSESSGKKSKKRPLGNREAVRKYREKKKAKAASLEDE  119

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RLRA+N QLLKRLQGQA LEAEV RLKCLLVDIRGRIE
Sbjct  120  VIRLRAVNNQLLKRLQGQAALEAEVTRLKCLLVDIRGRIE  159



>ref|XP_006409393.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
 gb|ESQ50846.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
Length=265

 Score =   205 bits (521),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEFSNQE LS+    EFP SN  MDSF +E+L D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNQEALSNPKMPEFPPSNCSMDSFFDELLNDSHACTHTHTCNPPGPENTHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+PA S +DKA +DDT+ES  KK KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  61   TCLHVHTKILPAQS-DDKASTDDTSESSGKKSKKRPLGNREAVRKYREKKKAKAASLEDE  119

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RLRA+N QLLKRLQGQA LEAEV RLKCLLVDIRGRIE
Sbjct  120  VIRLRAVNNQLLKRLQGQAALEAEVTRLKCLLVDIRGRIE  159



>ref|XP_010690366.1| PREDICTED: uncharacterized protein LOC104903923 [Beta vulgaris 
subsp. vulgaris]
Length=290

 Score =   205 bits (522),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 138/164 (84%), Gaps = 5/164 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEFSNQE+LSS+N  + P S S MDSF +E+LKDTHACTH HTCNPPGPD  HTH
Sbjct  23   MDDGELEFSNQELLSSANIGDVPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDLHHTH  81

Query  318  TCYHVHTKIVPAPSEEDKAP-SDDTAESVDKKEKKRPL---GNreavrkyrekkkaraaL  485
            TC+HVHTKI+P PSEE+K+  +DD+AES + K KKR     GNREAVRKYR+KKKA AA 
Sbjct  82   TCFHVHTKILPPPSEEEKSGNNDDSAESEELKSKKRGRERGGNREAVRKYRQKKKAHAAS  141

Query  486  LEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            LED V +LRALNQQL++RLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  142  LEDEVAKLRALNQQLVRRLQGQAALEAEIARLKCLLVDIRGRIE  185



>ref|XP_009787001.1| PREDICTED: uncharacterized protein LOC104235029 isoform X2 [Nicotiana 
sylvestris]
Length=269

 Score =   203 bits (516),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 130/161 (81%), Gaps = 3/161 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M +GELE SNQE +SSSNF E P+ +S    F NEIL D HAC H HTCNPPGPDNSHTH
Sbjct  1    MHNGELELSNQETVSSSNFGEIPECSSTKRLF-NEILSDMHACIHTHTCNPPGPDNSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLED  494
            +CYHVHTK+VP P  EDK  SDDTAES + K  KKRPL N EAVRKYREK KAR A LED
Sbjct  60   SCYHVHTKVVPPPI-EDKILSDDTAESAENKIGKKRPLSNNEAVRKYREKNKARVASLED  118

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             VVRLRA+NQQLLKRLQGQ+VLEAE+ RLKCLLVDIRGRIE
Sbjct  119  EVVRLRAINQQLLKRLQGQSVLEAEITRLKCLLVDIRGRIE  159



>ref|XP_006590380.1| PREDICTED: bZIP transcription factor bZIP121 isoform X1 [Glycine 
max]
 ref|XP_006590381.1| PREDICTED: bZIP transcription factor bZIP121 isoform X2 [Glycine 
max]
 ref|XP_006590382.1| PREDICTED: bZIP transcription factor bZIP121 isoform X3 [Glycine 
max]
Length=270

 Score =   202 bits (515),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 134/162 (83%), Gaps = 4/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSN E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDT--AESVDKKEKKRPLGNreavrkyrekkkaraaLLE  491
            TCYHVHTKIVPAP EED+  +DDT  +       KKRPLGN+EAVRKYREKKKARAA LE
Sbjct  60   TCYHVHTKIVPAP-EEDQVATDDTAESAEKKSSSKKRPLGNKEAVRKYREKKKARAASLE  118

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D VV+LRALNQ L+K+LQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  119  DEVVKLRALNQHLMKKLQGQAALEAEIARLKCLLVDIRGRIE  160



>ref|XP_009786999.1| PREDICTED: uncharacterized protein LOC104235029 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009787000.1| PREDICTED: uncharacterized protein LOC104235029 isoform X1 [Nicotiana 
sylvestris]
Length=274

 Score =   202 bits (515),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 130/161 (81%), Gaps = 3/161 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M +GELE SNQE +SSSNF E P+ +S    F NEIL D HAC H HTCNPPGPDNSHTH
Sbjct  1    MHNGELELSNQETVSSSNFGEIPECSSTKRLF-NEILSDMHACIHTHTCNPPGPDNSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLED  494
            +CYHVHTK+VP P  EDK  SDDTAES + K  KKRPL N EAVRKYREK KAR A LED
Sbjct  60   SCYHVHTKVVPPPI-EDKILSDDTAESAENKIGKKRPLSNNEAVRKYREKNKARVASLED  118

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             VVRLRA+NQQLLKRLQGQ+VLEAE+ RLKCLLVDIRGRIE
Sbjct  119  EVVRLRAINQQLLKRLQGQSVLEAEITRLKCLLVDIRGRIE  159



>ref|XP_004164905.1| PREDICTED: uncharacterized protein LOC101232700 [Cucumis sativus]
Length=262

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++ SS N  E P S S MDSF +E+LKDTH CTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNM-EIPSSCS-MDSFFDELLKDTHTCTHTHTCNPPGPDYSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPAPSEEDK  +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  59   TCFHVHTKIVPAPSEEDKVVTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQ L+KRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  119  VVRLRALNQHLMKRLQGQAALEAEIARLKCLLVDIRGRIE  158



>gb|KHN39873.1| hypothetical protein glysoja_020613 [Glycine soja]
Length=268

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 134/162 (83%), Gaps = 4/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSN E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDT--AESVDKKEKKRPLGNreavrkyrekkkaraaLLE  491
            TCYHVHTKIVPAP EED+  +DDT  +       KKRPLGN+EAVRKYREKKKARAA LE
Sbjct  60   TCYHVHTKIVPAP-EEDQVATDDTAESAEKKSSSKKRPLGNKEAVRKYREKKKARAASLE  118

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D VV+LRALNQ L+K+LQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  119  DEVVKLRALNQHLMKKLQGQAALEAEIARLKCLLVDIRGRIE  160



>ref|XP_008447959.1| PREDICTED: uncharacterized protein LOC103490288 [Cucumis melo]
Length=270

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++ SS N  E P S S MDSF +E+LKDTH CTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNI-EIPSSCS-MDSFFDELLKDTHTCTHTHTCNPPGPDYSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPAPSEEDK  +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  59   TCFHVHTKIVPAPSEEDKVVTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQ L+KRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  119  VVRLRALNQHLMKRLQGQAALEAEIARLKCLLVDIRGRIE  158



>ref|XP_004144846.1| PREDICTED: uncharacterized protein LOC101208161 [Cucumis sativus]
 gb|KGN43249.1| DNA binding protein [Cucumis sativus]
Length=270

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++ SS N  E P S S MDSF +E+LKDTH CTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNM-EIPSSCS-MDSFFDELLKDTHTCTHTHTCNPPGPDYSHTH  58

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIVPAPSEEDK  +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  59   TCFHVHTKIVPAPSEEDKVVTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRALNQ L+KRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  119  VVRLRALNQHLMKRLQGQAALEAEIARLKCLLVDIRGRIE  158



>ref|XP_011046168.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046178.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046187.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046199.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
Length=267

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 134/161 (83%), Gaps = 5/161 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT-HACTHAHTCNPPGPDNSHT  314
            M+DGEL++SNQE+  S N  + P S SY   FL+E+LKDT HACTH HTCNPPGPDN HT
Sbjct  1    MDDGELDYSNQELFLSPNMDDLPSSCSY--GFLDELLKDTPHACTHTHTCNPPGPDNPHT  58

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            H C+H HTK++   S EDK  S+DTAES++KK KKRPLGNREAVRKYREKKKA+AA LED
Sbjct  59   HVCFHAHTKLLS--SSEDKVDSEDTAESIEKKSKKRPLGNREAVRKYREKKKAKAASLED  116

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V RLRALNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  117  EVKRLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  157



>ref|NP_001237296.1| bZIP transcription factor bZIP121 [Glycine max]
 gb|ABI34680.1| bZIP transcription factor bZIP121 [Glycine max]
Length=270

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 133/162 (82%), Gaps = 4/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSN E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDT--AESVDKKEKKRPLGNreavrkyrekkkaraaLLE  491
            TCYHVHTKIVPAP EED   +DDT  +       KKRPLGN+EAVRKYREKKKARAA LE
Sbjct  60   TCYHVHTKIVPAP-EEDHVATDDTAESAEKKSSSKKRPLGNKEAVRKYREKKKARAASLE  118

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D VV+LRALNQ L+K+LQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  119  DEVVKLRALNQHLMKKLQGQAALEAEIARLKCLLVDIRGRIE  160



>gb|AAM63358.1| putative transcription factor [Arabidopsis thaliana]
Length=261

 Score =   200 bits (508),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  314
            MEDGEL+FSNQE+ SSS   E P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LED
Sbjct  61   HTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLED  119

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V RLRALNQQL+KRLQ QA LEAEV+RLKCLLVD+RGRI+
Sbjct  120  EVARLRALNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRID  160



>ref|XP_006284366.1| hypothetical protein CARUB_v10005538mg [Capsella rubella]
 gb|EOA17264.1| hypothetical protein CARUB_v10005538mg [Capsella rubella]
Length=258

 Score =   199 bits (507),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  314
            MEDGELEFSNQE+ SSS   E P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LED
Sbjct  61   HTCFHVHTKILPDDSDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLED  119

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V RLRA+NQQL+KRLQ QA LEAEV+RLKCLLVD+RGRI+
Sbjct  120  EVSRLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRID  160



>ref|XP_002313707.2| hypothetical protein POPTR_0009s13730g [Populus trichocarpa]
 gb|EEE87662.2| hypothetical protein POPTR_0009s13730g [Populus trichocarpa]
Length=267

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 133/161 (83%), Gaps = 5/161 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT-HACTHAHTCNPPGPDNSHT  314
            M+DGEL++SNQE+  S N  + P S SY   FL+E+L DT HACTH HTCNPPGPDN HT
Sbjct  1    MDDGELDYSNQELFLSPNMDDLPSSCSY--GFLDELLMDTPHACTHTHTCNPPGPDNPHT  58

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            H C+H HTK++   S EDK  S+DTAES++KK KKRPLGNREAVRKYREKKKA+AA LED
Sbjct  59   HVCFHAHTKLLS--SSEDKVESEDTAESIEKKSKKRPLGNREAVRKYREKKKAKAASLED  116

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V RLRALNQQLLKRLQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  117  EVKRLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIE  157



>ref|NP_567974.1| transcription factor bZIP19 [Arabidopsis thaliana]
 gb|AAL62378.1| putative protein [Arabidopsis thaliana]
 gb|AAN15479.1| putative protein [Arabidopsis thaliana]
 gb|AEE86454.1| transcription factor bZIP19 [Arabidopsis thaliana]
Length=261

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  314
            MEDGEL+FSNQE+ SSS   E P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LED
Sbjct  61   HTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLED  119

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V RLRA+NQQL+KRLQ QA LEAEV+RLKCLLVD+RGRI+
Sbjct  120  EVARLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRID  160



>ref|XP_010437531.1| PREDICTED: uncharacterized protein LOC104721282 [Camelina sativa]
 ref|XP_010437532.1| PREDICTED: uncharacterized protein LOC104721282 [Camelina sativa]
Length=264

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 5/164 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT----HACTHAHTCNPPGPDN  305
            MEDGELEFSNQE+ SSS+  E P SN  MDSF + +L DT     ACTH HTCNP GP+N
Sbjct  1    MEDGELEFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDTTNANAACTHTHTCNPTGPEN  60

Query  306  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  485
            +HTHTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA 
Sbjct  61   THTHTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAAS  119

Query  486  LEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            LED V RLRA+NQQL+KRLQ QA LEAEV+RLKCLLVD+RGRI+
Sbjct  120  LEDEVARLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRID  163



>ref|XP_010432347.1| PREDICTED: uncharacterized protein LOC104716633 [Camelina sativa]
 ref|XP_010432348.1| PREDICTED: uncharacterized protein LOC104716633 [Camelina sativa]
Length=264

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 5/164 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT----HACTHAHTCNPPGPDN  305
            MEDGELEFSNQE+ SSS+  E P SN  MDSF + +L DT     ACTH HTCNP GP+N
Sbjct  1    MEDGELEFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDTTNANAACTHTHTCNPTGPEN  60

Query  306  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  485
            +HTHTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA 
Sbjct  61   THTHTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAAS  119

Query  486  LEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            LED V RLRA+NQQL+KRLQ QA LEAEV+RLKCLLVD+RGRI+
Sbjct  120  LEDEVARLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRID  163



>ref|XP_002869111.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45370.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=261

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  314
            MEDGEL+FSNQE+ SSS   E P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LED
Sbjct  61   HTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLED  119

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V RLRA+NQQL+KRLQ QA LEAEV+RLKCLLVD+RGRI+
Sbjct  120  EVARLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRID  160



>ref|XP_010447005.1| PREDICTED: uncharacterized protein LOC104729711 [Camelina sativa]
Length=261

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 134/164 (82%), Gaps = 5/164 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT----HACTHAHTCNPPGPDN  305
            MEDGELEFSNQE+ SSS+  E P SN  MDSF + +L DT     ACTH HTCNP GP+N
Sbjct  1    MEDGELEFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDTTTTNAACTHTHTCNPTGPEN  60

Query  306  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  485
            +HTHTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA 
Sbjct  61   THTHTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAAS  119

Query  486  LEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            LED V RLRA+NQQL+KRLQ QA LEAEV+RLKCLLVD+RGRI+
Sbjct  120  LEDEVARLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRID  163



>emb|CAA17769.1| putative protein [Arabidopsis thaliana]
 emb|CAB80221.1| putative protein [Arabidopsis thaliana]
Length=278

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  314
            MEDGEL+FSNQE+ SSS   E P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LED
Sbjct  61   HTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLED  119

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V RLRA+NQQL+KRLQ QA LEAEV+RLKCLLVD+RGRI+
Sbjct  120  EVARLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRID  160



>gb|KFK30142.1| hypothetical protein AALP_AA7G222200 [Arabis alpina]
Length=263

 Score =   198 bits (503),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 3/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  311
            MEDGEL+FSNQE+ SSS+  E P SN  MDSF + +L D+H  ACTH HTCNP GP+N+H
Sbjct  1    MEDGELDFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDSHQAACTHTHTCNPTGPENTH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  491
            THTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LE
Sbjct  61   THTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLE  119

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D V RLRA+NQQL+KRLQ  A LEAEV+RLKCLLVD+RGRI+
Sbjct  120  DEVARLRAVNQQLVKRLQSHATLEAEVSRLKCLLVDLRGRID  161



>ref|XP_006412160.1| hypothetical protein EUTSA_v10026007mg [Eutrema salsugineum]
 gb|ESQ53613.1| hypothetical protein EUTSA_v10026007mg [Eutrema salsugineum]
Length=262

 Score =   197 bits (502),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 134/162 (83%), Gaps = 3/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  311
            MEDGEL+FSNQE+ SSS+  E P SN  +DSF   +L D+H  ACTH HTCNP GP+N+H
Sbjct  1    MEDGELDFSNQEVFSSSDMGELPPSNCSIDSFFEGLLMDSHQAACTHTHTCNPTGPENTH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  491
            THTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LE
Sbjct  61   THTCFHVHTKILPEDSDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLE  119

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D V RLRA+NQQL+KRLQ QA LEAEV+RLKCLLVD+RGRI+
Sbjct  120  DEVSRLRAVNQQLVKRLQSQATLEAEVSRLKCLLVDLRGRID  161



>ref|XP_006591923.1| PREDICTED: bZIP transcription factor bZIP122 isoform X1 [Glycine 
max]
 ref|XP_006591924.1| PREDICTED: bZIP transcription factor bZIP122 isoform X2 [Glycine 
max]
 ref|XP_006591925.1| PREDICTED: bZIP transcription factor bZIP122 isoform X3 [Glycine 
max]
 ref|XP_006591926.1| PREDICTED: bZIP transcription factor bZIP122 isoform X4 [Glycine 
max]
 ref|XP_006591927.1| PREDICTED: bZIP transcription factor bZIP122 isoform X5 [Glycine 
max]
 ref|XP_006591928.1| PREDICTED: bZIP transcription factor bZIP122 isoform X6 [Glycine 
max]
 ref|XP_006591929.1| PREDICTED: bZIP transcription factor bZIP122 isoform X7 [Glycine 
max]
Length=271

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 133/163 (82%), Gaps = 5/163 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSN E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDT---AESVDKKEKKRPLGNreavrkyrekkkaraaLL  488
            TCYHVHTKIVPAP EED   +DDT   AE      KKR LGN+EAVRKYREKKKARAA L
Sbjct  60   TCYHVHTKIVPAP-EEDHVATDDTAESAEKKSSSSKKRSLGNKEAVRKYREKKKARAASL  118

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            ED VV+LRALNQ L+K+L+GQA LEAE+ARLKCLLVDIRGRIE
Sbjct  119  EDEVVKLRALNQHLMKKLKGQAALEAEIARLKCLLVDIRGRIE  161



>ref|NP_001235033.1| bZIP transcription factor bZIP122 [Glycine max]
 ref|XP_006591930.1| PREDICTED: bZIP transcription factor bZIP122 isoform X8 [Glycine 
max]
 ref|XP_006591931.1| PREDICTED: bZIP transcription factor bZIP122 isoform X9 [Glycine 
max]
 gb|ABI34664.1| bZIP transcription factor bZIP122 [Glycine max]
Length=265

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 133/163 (82%), Gaps = 5/163 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSN E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDT---AESVDKKEKKRPLGNreavrkyrekkkaraaLL  488
            TCYHVHTKIVPAP EED   +DDT   AE      KKR LGN+EAVRKYREKKKARAA L
Sbjct  60   TCYHVHTKIVPAP-EEDHVATDDTAESAEKKSSSSKKRSLGNKEAVRKYREKKKARAASL  118

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            ED VV+LRALNQ L+K+L+GQA LEAE+ARLKCLLVDIRGRIE
Sbjct  119  EDEVVKLRALNQHLMKKLKGQAALEAEIARLKCLLVDIRGRIE  161



>ref|XP_009112401.1| PREDICTED: uncharacterized protein LOC103837781 isoform X1 [Brassica 
rapa]
 ref|XP_009112402.1| PREDICTED: uncharacterized protein LOC103837781 isoform X1 [Brassica 
rapa]
Length=242

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 127/160 (79%), Gaps = 14/160 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEF              P S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  2    MDDGELEF--------------PPSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  47

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+PA   +DK  +DDT+ES  K+ KKRP GNREAVRKYREKKKA+AA LED 
Sbjct  48   TCLHVHTKILPAAQSDDKETTDDTSESSGKRSKKRPSGNREAVRKYREKKKAKAASLEDE  107

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RLRA+N QL+KRLQGQA LEAEV RLKCLLVDIRGRIE
Sbjct  108  VLRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIE  147



>ref|XP_009112403.1| PREDICTED: uncharacterized protein LOC103837781 isoform X2 [Brassica 
rapa]
Length=239

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 127/160 (79%), Gaps = 14/160 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEF              P S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  2    MDDGELEF--------------PPSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  47

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+PA   +DK  +DDT+ES  K+ KKRP GNREAVRKYREKKKA+AA LED 
Sbjct  48   TCLHVHTKILPAAQSDDKETTDDTSESSGKRSKKRPSGNREAVRKYREKKKAKAASLEDE  107

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RLRA+N QL+KRLQGQA LEAEV RLKCLLVDIRGRIE
Sbjct  108  VLRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIE  147



>ref|XP_009624365.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624366.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624367.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624368.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
Length=263

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 126/161 (78%), Gaps = 9/161 (6%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M + EL FSNQEM SSSNF E P+ +S      NEIL D HAC H HTCNPPGPDNSHTH
Sbjct  1    MHNRELHFSNQEMGSSSNFGEIPECSS-TKRLFNEILSDMHACIHTHTCNPPGPDNSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLED  494
            TCYHVHTK+VP         SDDTAES + K  KKRPL N+EAVRKYREK KAR A LED
Sbjct  60   TCYHVHTKVVP-------PLSDDTAESAENKIGKKRPLSNKEAVRKYREKNKARVASLED  112

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             VVRLRA+NQQLLKRLQGQ+VLEAE+++LKCLLVDIRGRIE
Sbjct  113  EVVRLRAINQQLLKRLQGQSVLEAEISKLKCLLVDIRGRIE  153



>ref|XP_002884017.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60276.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   192 bits (487),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 131/160 (82%), Gaps = 9/160 (6%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEFSN  M       E P S+  MDSF +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNSNMGG-----ELPPSSCSMDSFFDELLRDSHACTHTHTCNPPGPENTHTH  55

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+P+ S EDK  +DDT+ES     KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  56   TCLHVHTKILPSQS-EDKVSTDDTSES---SGKKRPLGNREAVRKYREKKKAKAASLEDE  111

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RL+A+N QLLKRLQGQAVLEAEV RLKCLLVDIRGRI+
Sbjct  112  VMRLKAVNNQLLKRLQGQAVLEAEVTRLKCLLVDIRGRID  151



>ref|XP_010548099.1| PREDICTED: uncharacterized protein LOC104819648 [Tarenaya hassleriana]
Length=260

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 131/162 (81%), Gaps = 3/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNF--CEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSH  311
            M++GEL+FSNQE+ SS N      P S+  MDSF +E+LKD   CTH HTCNPPGP+N+H
Sbjct  1    MDEGELDFSNQELFSSPNMEGIRIPLSSCSMDSFFDELLKDPQTCTHTHTCNPPGPENTH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  491
            +HTC+HVHTK +P  S E K  +DDTAES +K+ + RP GNREAVRKYREKK+ARAA LE
Sbjct  61   SHTCFHVHTKFLPLQSGE-KVSTDDTAESSEKRNRNRPSGNREAVRKYREKKRARAASLE  119

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D V++LRA+NQQLLKRLQ QA LEAEVARLKCLLVDIRGRIE
Sbjct  120  DEVIKLRAINQQLLKRLQSQAGLEAEVARLKCLLVDIRGRIE  161



>ref|XP_010467405.1| PREDICTED: uncharacterized protein LOC104747472 [Camelina sativa]
 ref|XP_010467406.1| PREDICTED: uncharacterized protein LOC104747472 [Camelina sativa]
Length=259

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 129/161 (80%), Gaps = 7/161 (4%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGP-DNSHT  314
            M+DGELEFSN  M+      E   S+  MDSF +E+L+D+HACTH HTCNP GP +N+HT
Sbjct  1    MDDGELEFSNSNMVG-----ELLPSSCSMDSFFDELLRDSHACTHTHTCNPSGPENNTHT  55

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTC HVHTKI+P+ SE DK  +DDT+ES  K  KKRPLGNREAVRKYREKKKA+AA LED
Sbjct  56   HTCLHVHTKILPSQSE-DKVSTDDTSESSGKNSKKRPLGNREAVRKYREKKKAKAASLED  114

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V RLRA+N QL+KRLQGQA LEAEV RLKCLLVDIRGRI+
Sbjct  115  EVTRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRID  155



>ref|XP_011088608.1| PREDICTED: uncharacterized protein LOC105169791 [Sesamum indicum]
 ref|XP_011088609.1| PREDICTED: uncharacterized protein LOC105169791 [Sesamum indicum]
Length=287

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 134/177 (76%), Gaps = 18/177 (10%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSY-MDSFLN----------------EILKDTHAC  266
            M+DGEL+F + +MLS  +      S S+ +D FL                 ++L  T AC
Sbjct  1    MDDGELDFPSDQMLSCLDMTNAQSSCSFDIDEFLGRTQACNDALGRTEAYTDVLGRTQAC  60

Query  267  THAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreav  446
            THAH CNP GPD SHTHTC HVHT+I+P+PSE  +APSDDTAESV+KK KKRPLGNREAV
Sbjct  61   THAHACNPSGPDKSHTHTCIHVHTQIMPSPSEP-QAPSDDTAESVEKKGKKRPLGNREAV  119

Query  447  rkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            RKYREKKKAR A LED V+RLRALNQQL+KRLQGQA+LEAE+ARLKCLLVDIRGRIE
Sbjct  120  RKYREKKKARTASLEDEVIRLRALNQQLMKRLQGQALLEAEIARLKCLLVDIRGRIE  176



>ref|XP_009108690.1| PREDICTED: uncharacterized protein LOC103834377 [Brassica rapa]
Length=255

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 133/162 (82%), Gaps = 3/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  314
            MEDGELEFSNQE+ S+S+    P +N  MD+F +E+LKD++A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSTSDMNGLPLTNCSMDTFFDELLKDSNAACTHTHTCNPTGPENAHT  60

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLE  491
            HTC+HVHTKI+P  S+E K  +DDTAES  KK + KRPLGNREAVRKYREKKKA+AA LE
Sbjct  61   HTCFHVHTKILPEDSDE-KVSTDDTAESCGKKGDNKRPLGNREAVRKYREKKKAKAASLE  119

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D V RL A+N QL+KRLQ Q  LEAEV+RLKCLLVD+RGRI+
Sbjct  120  DEVARLTAVNHQLVKRLQSQGALEAEVSRLKCLLVDLRGRID  161



>ref|XP_009376970.1| PREDICTED: uncharacterized protein LOC103965622 [Pyrus x bretschneideri]
Length=268

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 128/160 (80%), Gaps = 3/160 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+D E++FSNQE+ SS+N      S+  MD+F +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDHEVDFSNQEVFSSANMGGELASSCSMDTFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIV + S EDKA  DDT ES +KK KK+PLGN+ AVRKYRE KKAR  LLE  
Sbjct  61   TCFHVHTKIVSSAS-EDKA--DDTCESGEKKSKKQPLGNKVAVRKYRENKKARVKLLEAE  117

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VV LRA N+QL+ RLQGQ  LEAE+ARLKCLLVDIRGRIE
Sbjct  118  VVNLRAENRQLVMRLQGQPALEAEIARLKCLLVDIRGRIE  157



>ref|XP_009376950.1| PREDICTED: uncharacterized protein LOC103965600 [Pyrus x bretschneideri]
 ref|XP_009376951.1| PREDICTED: uncharacterized protein LOC103965600 [Pyrus x bretschneideri]
Length=268

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 128/160 (80%), Gaps = 3/160 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+D E++FSNQE+ SS+N      S+  MD+F +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDHEVDFSNQEVFSSANMGGELASSCSMDTFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+HVHTKIV + S EDKA  DDT ES +KK KK+PLGN+ AVRKYRE KKAR  LLE  
Sbjct  61   TCFHVHTKIVSSAS-EDKA--DDTCESGEKKSKKQPLGNKVAVRKYRENKKARVKLLEAE  117

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VV LRA N+QL+ RLQGQ  LEAE+ARLKCLLVDIRGRIE
Sbjct  118  VVNLRAENRQLVMRLQGQPALEAEIARLKCLLVDIRGRIE  157



>emb|CDY47478.1| BnaA09g08870D [Brassica napus]
Length=241

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 128/160 (80%), Gaps = 14/160 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            MEDGELEF              P S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  1    MEDGELEF--------------PPSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  46

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+PAP  +DK  +DDT+ES  KK KKRP GNREAVRKYREKKKA+AA LED 
Sbjct  47   TCLHVHTKILPAPQSDDKETTDDTSESSGKKSKKRPSGNREAVRKYREKKKAKAASLEDE  106

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RLRA+N QL+KRLQGQA LEAEV RLKCLLVDIRGRIE
Sbjct  107  VLRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIE  146



>emb|CDY17503.1| BnaC03g65600D [Brassica napus]
Length=255

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 132/162 (81%), Gaps = 3/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  314
            MEDGELEFSNQE+ S+S+    P +N  MD+F +E+L D++A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSTSDMNGLPLTNCSMDTFFDELLMDSNAACTHTHTCNPTGPENAHT  60

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLE  491
            HTC+HVHTKI+P  S+E K  +DDTAES  KK + KRPLGNREAVRKYREKKKA+AA LE
Sbjct  61   HTCFHVHTKILPEDSDE-KVSTDDTAESCGKKGDNKRPLGNREAVRKYREKKKAKAASLE  119

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D V RL A+N QL+KRLQ Q  LEAEV+RLKCLLVD+RGRI+
Sbjct  120  DEVARLTAVNHQLVKRLQSQGALEAEVSRLKCLLVDLRGRID  161



>emb|CDX76308.1| BnaA08g10920D [Brassica napus]
Length=273

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 110/162 (68%), Positives = 132/162 (81%), Gaps = 3/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  314
            MEDGELEFSNQE+ S+S+    P +N  MD+F +E+L D++A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSTSDMNGLPLTNCSMDTFFDELLMDSNAACTHTHTCNPTGPENAHT  60

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLE  491
            HTC+HVHTKI+P  S+E K  +DDTAES  KK + KRPLGNREAVRKYREKKKA+AA LE
Sbjct  61   HTCFHVHTKILPEDSDE-KVSTDDTAESCGKKGDNKRPLGNREAVRKYREKKKAKAASLE  119

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            D V RL A+N QL+KRLQ Q  LEAEV+RLKCLLVD+RGRI+
Sbjct  120  DEVARLTAVNHQLVKRLQSQGALEAEVSRLKCLLVDLRGRID  161



>ref|XP_006298365.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 ref|XP_006298366.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 gb|EOA31263.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 gb|EOA31264.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
Length=258

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 131/160 (82%), Gaps = 6/160 (4%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEFSN  M       E P ++  MDSF +E+L+D+HACTH HTCNP GP+N+HTH
Sbjct  1    MDDGELEFSNSNMGG-----ELPLTSCSMDSFFDELLRDSHACTHTHTCNPSGPENTHTH  55

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+PA S EDK  +DDT+ES  KK KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  56   TCLHVHTKILPAQS-EDKVSTDDTSESSGKKSKKRPLGNREAVRKYREKKKAKAASLEDE  114

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RLRA+N QL+KRLQGQA LEAEV RLKCLLVDIRGRI+
Sbjct  115  VMRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRID  154



>ref|XP_008377738.1| PREDICTED: uncharacterized protein LOC103440807 [Malus domestica]
 ref|XP_008377739.1| PREDICTED: uncharacterized protein LOC103440807 [Malus domestica]
Length=263

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = +3

Query  165  NQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKI  344
            +QE+   +N      S+  MDSF +++LKDTHACTHAHTCNPPGPD SHTHTC+HVHTKI
Sbjct  3    DQEVFPGANMGGELASSCSMDSFFDDLLKDTHACTHAHTCNPPGPDYSHTHTCFHVHTKI  62

Query  345  VPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQ  524
            + + S EDKA +DDTAES +KK KK+PLGN+ AVRKYREK+KAR  LLED VV LRA N+
Sbjct  63   LSSAS-EDKAGTDDTAESGEKKSKKQPLGNKVAVRKYREKEKARVKLLEDEVVNLRAENR  121

Query  525  QLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            +L+ RLQGQ  LEAE+ARLKCLLVDIRGRIE
Sbjct  122  RLVMRLQGQPALEAEIARLKCLLVDIRGRIE  152



>ref|XP_010327411.1| PREDICTED: uncharacterized protein LOC104649609 [Solanum lycopersicum]
 ref|XP_010327412.1| PREDICTED: uncharacterized protein LOC104649609 [Solanum lycopersicum]
Length=262

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 126/159 (79%), Gaps = 6/159 (4%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+D ELEFS+Q++LSSS F E P+S S M+   NEIL D HAC HAHTCNPPGPDNSHTH
Sbjct  1    MDDMELEFSSQQVLSSSTFGEIPES-SPMNKRFNEILTDVHACIHAHTCNPPGPDNSHTH  59

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYHVHTK+V  P ++  A S  TA +V    KKR L N+EAVRKY EKKKAR A LE+ 
Sbjct  60   TCYHVHTKVVTPPRDDTTAES--TAANVG---KKRSLSNKEAVRKYCEKKKARVASLEEE  114

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRI  614
            VVRLR +NQQLL RLQGQAVLEAEV+RLKCLLVDIRGRI
Sbjct  115  VVRLRDINQQLLNRLQGQAVLEAEVSRLKCLLVDIRGRI  153



>emb|CDY26786.1| BnaC09g09130D [Brassica napus]
Length=239

 Score =   182 bits (463),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 127/160 (79%), Gaps = 14/160 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEF              P S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEF--------------PPSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  46

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+PA   +DK  +DDT+ES  KK KKRP GNREAVRKYREKKKA+AA LED 
Sbjct  47   TCLHVHTKILPAAQSDDKETTDDTSESSGKKSKKRPSGNREAVRKYREKKKAKAASLEDE  106

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRA+N QL+KRLQGQA LEAEV RLKCLLVDIRGRIE
Sbjct  107  VVRLRAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRIE  146



>ref|XP_009355669.1| PREDICTED: uncharacterized protein LOC103946638 [Pyrus x bretschneideri]
Length=263

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = +3

Query  165  NQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKI  344
            +QE+   +N      S+  MDSF +++LKDTHACTHAHTCNPPGPD SHTHTC+HVHTKI
Sbjct  3    DQEVFPGANMGGELASSCSMDSFFDDLLKDTHACTHAHTCNPPGPDYSHTHTCFHVHTKI  62

Query  345  VPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQ  524
            + + S EDKA +DDTAES +KK KK+PLGN+ AVRKYREK+KAR  LLED V+ LRA N+
Sbjct  63   LSSAS-EDKAGTDDTAESGEKKSKKQPLGNKVAVRKYREKEKARVKLLEDEVLNLRAENR  121

Query  525  QLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            +L+ RLQGQ  LEAE+ARLKCLLVDIRGRIE
Sbjct  122  RLVMRLQGQPALEAEIARLKCLLVDIRGRIE  152



>ref|NP_179268.2| transcription factor bZIP23 [Arabidopsis thaliana]
 dbj|BAC42143.1| putative bzip transcription factor atbzip23 [Arabidopsis thaliana]
 gb|ABI93931.1| At2g16770 [Arabidopsis thaliana]
 gb|AEC06536.1| Basic-leucine zipper (bZIP) transcription factor family protein 
[Arabidopsis thaliana]
Length=249

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 126/160 (79%), Gaps = 15/160 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEFSN  M       E P  +  MDSF +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNSNMGG-----ELPSCS--MDSFFDELLRDSHACTHTHTCNPPGPENTHTH  53

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+P     DK  +DDT+ES     KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  54   TCLHVHTKILP-----DKVSTDDTSES---SGKKRPLGNREAVRKYREKKKAKAASLEDE  105

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RL+A+N QLLKRLQGQA LEAEV RLKCLLVDIRGRI+
Sbjct  106  VMRLKAVNNQLLKRLQGQAALEAEVTRLKCLLVDIRGRID  145



>gb|AAD24610.1| hypothetical protein [Arabidopsis thaliana]
Length=255

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 126/160 (79%), Gaps = 15/160 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGELEFSN  M       E P  +  MDSF +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNSNMGG-----ELPSCS--MDSFFDELLRDSHACTHTHTCNPPGPENTHTH  53

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+P     DK  +DDT+ES     KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  54   TCLHVHTKILP-----DKVSTDDTSES---SGKKRPLGNREAVRKYREKKKAKAASLEDE  105

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RL+A+N QLLKRLQGQA LEAEV RLKCLLVDIRGRI+
Sbjct  106  VMRLKAVNNQLLKRLQGQAALEAEVTRLKCLLVDIRGRID  145



>ref|XP_004289872.1| PREDICTED: uncharacterized protein LOC101314521 [Fragaria vesca 
subsp. vesca]
Length=276

 Score =   179 bits (455),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 131/164 (80%), Gaps = 5/164 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEM-LSSSNFC-EFPDSNSYMDSFLNEILKDTH-ACTHAHTCNPP-GPDN  305
            M+DGEL+FSNQE+  S  N   E P S S M++   +  K+T  ACTH H CNPP GPD+
Sbjct  1    MDDGELDFSNQELDFSIPNMTGELPSSCS-MENIFGDFFKETDTACTHNHICNPPSGPDS  59

Query  306  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  485
            +H HTC HVHTKI+ + + EDKA +DDTAES +K  KKRPLGNREAVRKYREKKKARAA 
Sbjct  60   AHRHTCIHVHTKILSSGASEDKAGTDDTAESGEKNSKKRPLGNREAVRKYREKKKARAAS  119

Query  486  LEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            LED V+RLRA+NQQL+KRLQGQA LEAE+ARLKCLLVDIRGRIE
Sbjct  120  LEDEVIRLRAVNQQLMKRLQGQAALEAEIARLKCLLVDIRGRIE  163



>ref|XP_011092972.1| PREDICTED: uncharacterized protein LOC105173033 isoform X1 [Sesamum 
indicum]
 ref|XP_011092973.1| PREDICTED: uncharacterized protein LOC105173033 isoform X1 [Sesamum 
indicum]
Length=288

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 127/177 (72%), Gaps = 18/177 (10%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSY-MDSFL----------------NEILKDTHAC  266
            M D ELEF ++E+LS  +      S S+ +D FL                 ++L  THAC
Sbjct  1    MYDTELEFPSEELLSCLDMANAQSSCSFDIDEFLVRTQACNDALGGTEACPDLLGRTHAC  60

Query  267  THAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreav  446
            THAH CNPPGPD SHTHTC HVHT+I+P P E   AP DDTAESV KK KKRP GN EAV
Sbjct  61   THAHACNPPGPDKSHTHTCIHVHTQIMPTPGEL-HAPGDDTAESVGKKAKKRPSGNNEAV  119

Query  447  rkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            RKYREKKKARAA LED VVRLRALNQ L+KRLQ QA+LEAEVARLKCLLVDIRGRIE
Sbjct  120  RKYREKKKARAASLEDEVVRLRALNQHLMKRLQSQALLEAEVARLKCLLVDIRGRIE  176



>ref|XP_011092974.1| PREDICTED: uncharacterized protein LOC105173033 isoform X2 [Sesamum 
indicum]
Length=287

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 127/177 (72%), Gaps = 18/177 (10%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSY-MDSFL----------------NEILKDTHAC  266
            M D ELEF ++E+LS  +      S S+ +D FL                 ++L  THAC
Sbjct  1    MYDTELEFPSEELLSCLDMANAQSSCSFDIDEFLVRTQACNDALGGTEACPDLLGRTHAC  60

Query  267  THAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreav  446
            THAH CNPPGPD SHTHTC HVHT+I+P P E   AP DDTAESV KK KKRP GN EAV
Sbjct  61   THAHACNPPGPDKSHTHTCIHVHTQIMPTPGEL-HAPGDDTAESVGKKAKKRPSGNNEAV  119

Query  447  rkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            RKYREKKKARAA LED VVRLRALNQ L+KRLQ QA+LEAEVARLKCLLVDIRGRIE
Sbjct  120  RKYREKKKARAASLEDEVVRLRALNQHLMKRLQSQALLEAEVARLKCLLVDIRGRIE  176



>gb|AFP19452.1| bZIP transcription factor family protein 1 [Camellia sinensis]
Length=270

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 128/160 (80%), Gaps = 4/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            MEDGE++FSNQE+ SS N  E P ++S+ +SFLN+  ++T  CTH H CNPP  D+SH+H
Sbjct  1    MEDGEIDFSNQEVCSSPNIGELPKTSSW-ESFLNDFQRET--CTHTHICNPPRLDSSHSH  57

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKIVPA ++ DK  + D AE ++KK  + P GNREAVRKYREKKKAR A LED 
Sbjct  58   TCRHVHTKIVPAATQ-DKVSTGDIAECLEKKSNRCPTGNREAVRKYREKKKARTASLEDE  116

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VVRLRA+NQQL+KRLQGQA LE E+ARLKCLLVDIRGRIE
Sbjct  117  VVRLRAVNQQLVKRLQGQAALETEIARLKCLLVDIRGRIE  156



>ref|XP_010516149.1| PREDICTED: uncharacterized protein LOC104791854 [Camelina sativa]
 ref|XP_010516157.1| PREDICTED: uncharacterized protein LOC104791854 [Camelina sativa]
Length=256

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 127/161 (79%), Gaps = 10/161 (6%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGP-DNSHT  314
            M+DGELEFSN  M+      E   S+  MDSF +E+L+D+HACTH HTCNP GP +N+HT
Sbjct  1    MDDGELEFSNSNMVG-----ELLPSSCSMDSFFDELLRDSHACTHTHTCNPSGPENNTHT  55

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTC HVHTKI+P+ SE DK  +DDT+ES  KK   RPLGNREAVRKYREKKKA+AA LED
Sbjct  56   HTCLHVHTKILPSQSE-DKVSTDDTSESSGKK---RPLGNREAVRKYREKKKAKAASLED  111

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V RL A+N QL+KRLQGQA LEAEV RLKCLLVDIRGRI+
Sbjct  112  EVRRLTAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRID  152



>ref|XP_010489260.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489261.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489262.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489264.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
Length=256

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 127/161 (79%), Gaps = 10/161 (6%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGP-DNSHT  314
            M+DGELEFSN  M+      E   S+  MDSF +E+L+D+HACTH HTCNP GP +N+HT
Sbjct  1    MDDGELEFSNSNMVG-----ELLPSSCSMDSFFDELLRDSHACTHTHTCNPSGPENNTHT  55

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTC HVHTKI+P+ SE DK  +DDT+ES     KKRPLGNREAVRKYREKKKA+AA LED
Sbjct  56   HTCLHVHTKILPSQSE-DKVSTDDTSES---SGKKRPLGNREAVRKYREKKKAKAASLED  111

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V RL A+N QL+KRLQGQA LEAEV RLKCLLVDIRGRI+
Sbjct  112  EVRRLTAVNNQLMKRLQGQAALEAEVTRLKCLLVDIRGRID  152



>gb|EYU37954.1| hypothetical protein MIMGU_mgv1a011243mg [Erythranthe guttata]
Length=288

 Score =   177 bits (449),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 131/177 (74%), Gaps = 18/177 (10%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSY-MDSFLN----------------EILKDTHAC  266
            M+DGEL+F + +M+S  +      S S+ +D FL                 ++L  T AC
Sbjct  1    MDDGELDFPSDQMMSCLDLPNAQSSCSFDIDEFLGRTQSCNDALGRTEAYTDVLGRTQAC  60

Query  267  THAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreav  446
            THAH CNP GPD SHTHTC HVHT+I+ +PSE  + PSDDTAESV+KK KKRP GNREAV
Sbjct  61   THAHACNPSGPDKSHTHTCIHVHTQIMHSPSE-GQDPSDDTAESVEKKGKKRPTGNREAV  119

Query  447  rkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            RKYREKKKARAA LED V+RLRALNQQL+KRLQGQA+LEAE+ RLKCLLVDIRGRIE
Sbjct  120  RKYREKKKARAASLEDEVIRLRALNQQLMKRLQGQALLEAEITRLKCLLVDIRGRIE  176



>emb|CDX89748.1| BnaC03g46620D [Brassica napus]
Length=248

 Score =   173 bits (439),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 128/160 (80%), Gaps = 15/160 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+EF              P S+S MDSF +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGEVEF--------------PLSSSSMDSFFDELLRDSHACTHTHTCNPPGPENTHTH  46

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC HVHTKI+PA + EDK  +DDT+ES   K KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  47   TCLHVHTKILPAQA-EDKEATDDTSESSGNKSKKRPLGNREAVRKYREKKKAKAASLEDE  105

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V+RLRA+N QL+KRLQGQA LEAEV RLKCLLVDIRGRIE
Sbjct  106  VMRLRAVNSQLMKRLQGQAALEAEVTRLKCLLVDIRGRIE  145



>ref|XP_009408222.1| PREDICTED: uncharacterized protein LOC103990705 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=239

 Score =   166 bits (420),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 120/162 (74%), Gaps = 9/162 (6%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE + SN E+ S+    E   S+  MDSF ++IL D H CTH HTCNPPGP+ SHTH
Sbjct  1    MDDGEPDLSNPEVFSTPGAGEDLPSSCSMDSFFDKILNDGHTCTHTHTCNPPGPNLSHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGNreavrkyrekkkaraaLLE  491
            TC+HVHTKI+        +P D+TAESV+K +  KKRP  NREAVRKYREKKKA AA LE
Sbjct  61   TCFHVHTKIL-------SSPPDETAESVEKSDSSKKRPCNNREAVRKYREKKKAHAASLE  113

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            +    LRA+NQQL KRLQ QA LEAE+ARLKCLLVD+RGRIE
Sbjct  114  EEAAHLRAINQQLFKRLQNQAALEAEIARLKCLLVDLRGRIE  155



>gb|ACI90291.1| putative bZIP transcription factor [Picrorhiza kurrooa]
Length=289

 Score =   167 bits (423),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 129/178 (72%), Gaps = 20/178 (11%)
 Frame = +3

Query  138  MEDGELEFSNQEMLS------SSNFCEF------------PDSNSYMDSFLNEILKDTHA  263
            M+ GEL+F ++++LS      + + C F             D+    ++F  ++L  T A
Sbjct  1    MDHGELDFPSEQLLSCLDVPNAQSSCSFDIEEYLGRPQTFSDTLGRTEAF-TDVLGRTQA  59

Query  264  CTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNrea  443
            CTHAH CNP GPD SHTHTC HVHT+I+P  S +   PSDDTAESV+KK KKR  GNREA
Sbjct  60   CTHAHACNPSGPDKSHTHTCIHVHTQIMPT-SSDGHEPSDDTAESVEKKGKKRTSGNREA  118

Query  444  vrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VRKYREKKKARAA LED V+RLRALNQ L+KRLQGQA+LEAE+ARLKCLLVDIRGRIE
Sbjct  119  VRKYREKKKARAASLEDEVIRLRALNQHLMKRLQGQALLEAEIARLKCLLVDIRGRIE  176



>ref|XP_009391011.1| PREDICTED: uncharacterized protein LOC103977271 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391012.1| PREDICTED: uncharacterized protein LOC103977271 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 121/164 (74%), Gaps = 12/164 (7%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  311
            ME+G+L+FSN E+ S  N  + P S   MDS  + I  D+  H CTH HTCNPPGPD SH
Sbjct  1    MEEGDLDFSNPEVFSGPNAGDLP-SGCSMDSVFDNIFNDSQQHTCTHTHTCNPPGPDLSH  59

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGNreavrkyrekkkaraaL  485
            THTC+HVHTKI+        AP+D+TAES  K    KKR  GNREAVRKYREKKKA AA 
Sbjct  60   THTCFHVHTKIL-------SAPADETAESAGKSSPTKKRSCGNREAVRKYREKKKAHAAS  112

Query  486  LEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            LE+ V +LRA+NQQL+KRLQ QA LEAEVARL+CLLVD+RGRIE
Sbjct  113  LEEEVAQLRAINQQLMKRLQSQAALEAEVARLRCLLVDLRGRIE  156



>emb|CDX69107.1| BnaC01g03460D [Brassica napus]
Length=271

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 127/173 (73%), Gaps = 14/173 (8%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCE-FPDSNSYMDSFLNEILKDTH----------ACTHAHTC  284
            MEDGELEFSNQE+ SSS+     P SN  +DSF + +L D+H          ACTH HTC
Sbjct  1    MEDGELEFSNQEVFSSSDVVGGLPPSNGSIDSFFDGLLMDSHHQHQHQHQQGACTHTHTC  60

Query  285  N--PPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyr  458
            N      DN+H+HTC+HVHTK++P  S+E K  +DDTAES  K  +KRPLGNREAVRKYR
Sbjct  61   NNSTGTADNTHSHTCFHVHTKVLPEDSDE-KVSTDDTAESCGKNGEKRPLGNREAVRKYR  119

Query  459  ekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            EKKKA+AA LED   RLR LNQQL+KRLQ Q+ LE EV+RLKCLLVD+RGRI+
Sbjct  120  EKKKAKAASLEDECSRLRGLNQQLVKRLQSQSALEGEVSRLKCLLVDLRGRID  172



>ref|XP_009408220.1| PREDICTED: uncharacterized protein LOC103990705 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009408221.1| PREDICTED: uncharacterized protein LOC103990705 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=273

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 120/162 (74%), Gaps = 9/162 (6%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE + SN E+ S+    E   S+  MDSF ++IL D H CTH HTCNPPGP+ SHTH
Sbjct  1    MDDGEPDLSNPEVFSTPGAGEDLPSSCSMDSFFDKILNDGHTCTHTHTCNPPGPNLSHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGNreavrkyrekkkaraaLLE  491
            TC+HVHTKI+        +P D+TAESV+K +  KKRP  NREAVRKYREKKKA AA LE
Sbjct  61   TCFHVHTKIL-------SSPPDETAESVEKSDSSKKRPCNNREAVRKYREKKKAHAASLE  113

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            +    LRA+NQQL KRLQ QA LEAE+ARLKCLLVD+RGRIE
Sbjct  114  EEAAHLRAINQQLFKRLQNQAALEAEIARLKCLLVDLRGRIE  155



>ref|XP_006656494.1| PREDICTED: uncharacterized protein LOC102721653 [Oryza brachyantha]
Length=269

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 123/164 (75%), Gaps = 8/164 (5%)
 Frame = +3

Query  138  MEDGELEFSNQE--MLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDN  305
            M+DG+++FSN +  +  ++     PD +  MDS+ ++ILKDT  HACTH HTCNPP  D 
Sbjct  1    MDDGDIDFSNPDTFLCPAAGAGADPDGSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDL  60

Query  306  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  485
            SHTHTC HVHTKIV APS++  +P+  TA+  +   KKRP GNR AVRKYREKKKA  A 
Sbjct  61   SHTHTCVHVHTKIVSAPSDDADSPT--TAD--NNASKKRPSGNRAAVRKYREKKKAHTAS  116

Query  486  LEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            LE+ VV LRALNQQL+K+LQ  A LEAEV+RL+CLLVDIRGRIE
Sbjct  117  LEEEVVHLRALNQQLMKKLQNHAALEAEVSRLRCLLVDIRGRIE  160



>ref|NP_001058591.1| Os06g0716800 [Oryza sativa Japonica Group]
 dbj|BAD53586.1| transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAD61716.1| transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAF20505.1| Os06g0716800 [Oryza sativa Japonica Group]
 gb|EAZ02370.1| hypothetical protein OsI_24474 [Oryza sativa Indica Group]
 dbj|BAG96347.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92598.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66367.1| hypothetical protein OsJ_22672 [Oryza sativa Japonica Group]
Length=272

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 123/167 (74%), Gaps = 10/167 (6%)
 Frame = +3

Query  138  MEDGELEFSNQE-MLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNS  308
            M+DG+L+FSN +  L  +     PD +  MDS+ ++ILKDT  HACTH HTCNPP  D S
Sbjct  1    MDDGDLDFSNPDTFLCPAVGGADPDGSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDLS  60

Query  309  HTHTCYHVHTKIVPAPSEEDKAPSD--DTAESV--DKKEKKRPLGNreavrkyrekkkar  476
            HTHTC HVHTKIV APS+    PSD  +TAES   +   KKRP GNR AVRKYREKKKA 
Sbjct  61   HTHTCVHVHTKIVSAPSD---TPSDAAETAESPTENNASKKRPSGNRAAVRKYREKKKAH  117

Query  477  aaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             A LE+ VV LRALNQQL+K+LQ  A LEAEV+RL+CLLVDIRGRIE
Sbjct  118  TASLEEEVVHLRALNQQLMKKLQNHATLEAEVSRLRCLLVDIRGRIE  164



>gb|AAL79736.1|AC091774_27 putative transcription factor [Oryza sativa Japonica Group]
Length=297

 Score =   160 bits (404),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 123/167 (74%), Gaps = 10/167 (6%)
 Frame = +3

Query  138  MEDGELEFSNQE-MLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNS  308
            M+DG+L+FSN +  L  +     PD +  MDS+ ++ILKDT  HACTH HTCNPP  D S
Sbjct  1    MDDGDLDFSNPDTFLCPAVGGADPDGSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDLS  60

Query  309  HTHTCYHVHTKIVPAPSEEDKAPSD--DTAESV--DKKEKKRPLGNreavrkyrekkkar  476
            HTHTC HVHTKIV APS+    PSD  +TAES   +   KKRP GNR AVRKYREKKKA 
Sbjct  61   HTHTCVHVHTKIVSAPSD---TPSDAAETAESPTENNASKKRPSGNRAAVRKYREKKKAH  117

Query  477  aaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             A LE+ VV LRALNQQL+K+LQ  A LEAEV+RL+CLLVDIRGRIE
Sbjct  118  TASLEEEVVHLRALNQQLMKKLQNHATLEAEVSRLRCLLVDIRGRIE  164



>ref|XP_004966468.1| PREDICTED: uncharacterized protein LOC101762708 isoform X1 [Setaria 
italica]
 ref|XP_004966469.1| PREDICTED: uncharacterized protein LOC101762708 isoform X2 [Setaria 
italica]
Length=261

 Score =   158 bits (400),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 119/165 (72%), Gaps = 11/165 (7%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  311
            M+DG+L+FSN +          P S+  MDS+ ++ILKDT  HACTH HTCNPP  D+SH
Sbjct  1    MDDGDLDFSNPDTFLCPAIGNDPPSSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDHSH  60

Query  312  THTCYHVHTKIV---PAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraa  482
            THTC HVHTKIV   P  +E  ++PS++ A       KKRP GNR AVRKYREKKKA  A
Sbjct  61   THTCVHVHTKIVAASPDAAETAESPSENNAS------KKRPSGNRAAVRKYREKKKAHTA  114

Query  483  LLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             LE+ VV LRALNQQL+K+LQ  A LEAEVARL+CLLVDIRGRIE
Sbjct  115  SLEEEVVHLRALNQQLMKKLQNHAALEAEVARLRCLLVDIRGRIE  159



>ref|XP_002439031.1| hypothetical protein SORBIDRAFT_10g030250 [Sorghum bicolor]
 gb|EER90398.1| hypothetical protein SORBIDRAFT_10g030250 [Sorghum bicolor]
Length=273

 Score =   158 bits (399),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 117/173 (68%), Gaps = 19/173 (11%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  311
            M+DG+L+FSN +          P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAES-----------VDKKEKKRPLGNreavrkyr  458
            THTC HVHTKIV A      +P DD AES            +   KKRP GNR AVRKYR
Sbjct  61   THTCVHVHTKIVAA------SPGDDAAESPSENNTNTTGNSNAASKKRPSGNRAAVRKYR  114

Query  459  ekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            EKKKA  A LE+ VV LRALNQQL+K+LQ  A LEAEVARL+CLLVDIRGRIE
Sbjct  115  EKKKAHTASLEEEVVHLRALNQQLMKKLQSHATLEAEVARLRCLLVDIRGRIE  167



>ref|NP_001141059.1| uncharacterized protein LOC100273140 [Zea mays]
 ref|XP_008681415.1| PREDICTED: uncharacterized protein LOC100273140 isoform X1 [Zea 
mays]
 gb|ACF85309.1| unknown [Zea mays]
 gb|ADX60074.1| bZIP transcription factor [Zea mays]
 gb|AFW69520.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW69521.1| putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AFW69522.1| putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 gb|AFW69523.1| putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
 gb|AIB04274.1| bZIP transcription factor, partial [Zea mays]
Length=276

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 118/175 (67%), Gaps = 21/175 (12%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  311
            M+DG+L+FSN +          P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE-------------KKRPLGNreavrk  452
            THTC HVHTKIV A      +P DDTA+S  +               KKRP GNR AVRK
Sbjct  61   THTCVHVHTKIVAA------SPGDDTADSPSENNTNGSGGNGSNAASKKRPSGNRAAVRK  114

Query  453  yrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            YREKKKA  A LE+ VV LRALNQQL+K+LQ  A LEAEVARL+CLLVDIRGRIE
Sbjct  115  YREKKKAHTASLEEEVVHLRALNQQLVKKLQSHAALEAEVARLRCLLVDIRGRIE  169



>gb|ACG32751.1| DNA binding protein [Zea mays]
Length=276

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 118/175 (67%), Gaps = 21/175 (12%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  311
            M+DG+L+FSN +          P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE-------------KKRPLGNreavrk  452
            THTC HVHTKIV A      +P DDTA+S  +               KKRP GNR AVRK
Sbjct  61   THTCVHVHTKIVAA------SPGDDTADSPSENNTNGSGGNGSNAASKKRPSGNRAAVRK  114

Query  453  yrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            YREKKKA  A LE+ VV LRALNQQL+K+LQ  A LEAEVARL+CLLVDIRGRIE
Sbjct  115  YREKKKAHTASLEEEVVHLRALNQQLVKKLQSHAALEAEVARLRCLLVDIRGRIE  169



>gb|EPS65924.1| hypothetical protein M569_08855 [Genlisea aurea]
Length=246

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 107/127 (84%), Gaps = 8/127 (6%)
 Frame = +3

Query  240  EILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDK-KEK  416
            ++L  T ACTHAH CNP GPD SHTHTC HVHT+I+ +PS       DDTAES+DK K K
Sbjct  50   DVLGRTQACTHAHACNPSGPDKSHTHTCIHVHTQIMASPS-------DDTAESIDKNKSK  102

Query  417  KRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLV  596
            KRPLGNREAVRKYREKKKARAA LED V++LRA+NQQL+KR+Q Q++LEAEVARLKCLLV
Sbjct  103  KRPLGNREAVRKYREKKKARAASLEDEVIKLRAINQQLMKRVQSQSLLEAEVARLKCLLV  162

Query  597  DIRGRIE  617
            DIRGRIE
Sbjct  163  DIRGRIE  169



>ref|XP_009401478.1| PREDICTED: uncharacterized protein LOC103985487 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   156 bits (395),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 122/164 (74%), Gaps = 11/164 (7%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  311
            M++G+++FSN E+ S  +  E   S+  MDSF + I  ++  H+CTH HTCNPPGPD SH
Sbjct  1    MDEGDVDFSNPEVFSGPSAGEDLPSSCSMDSFFDNIFNESQQHSCTHTHTCNPPGPDLSH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGNreavrkyrekkkaraaL  485
            THTC HVHTKI+        A +D+TAESV+K    KKR  GNREAVRKYREKKKA AA 
Sbjct  61   THTCLHVHTKIL-------TAAADETAESVEKNSSTKKRSCGNREAVRKYREKKKAHAAS  113

Query  486  LEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            LE+ + +LR +NQQL+KRLQ QA LEAEVARL+CLLVD+RGRIE
Sbjct  114  LEEEIAQLRLINQQLVKRLQNQAALEAEVARLRCLLVDLRGRIE  157



>gb|AFW69519.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=332

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 118/175 (67%), Gaps = 21/175 (12%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  311
            M+DG+L+FSN +          P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE-------------KKRPLGNreavrk  452
            THTC HVHTKIV A      +P DDTA+S  +               KKRP GNR AVRK
Sbjct  61   THTCVHVHTKIVAA------SPGDDTADSPSENNTNGSGGNGSNAASKKRPSGNRAAVRK  114

Query  453  yrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            YREKKKA  A LE+ VV LRALNQQL+K+LQ  A LEAEVARL+CLLVDIRGRIE
Sbjct  115  YREKKKAHTASLEEEVVHLRALNQQLVKKLQSHAALEAEVARLRCLLVDIRGRIE  169



>ref|XP_010935120.1| PREDICTED: uncharacterized protein LOC105055101 [Elaeis guineensis]
Length=273

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 126/163 (77%), Gaps = 10/163 (6%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHT--CNPPGPDNSH  311
            M++G+L+ SN E  S  +  E   S+  MDSF +EILKDTH  +  HT  CNPPGPD SH
Sbjct  1    MDEGDLDLSNPEAFSGPSMGEDLPSSCSMDSFFDEILKDTHHHSCTHTHTCNPPGPDLSH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDK-KEKKRPLGNreavrkyrekkkaraaLL  488
            THTC+HVHTKI+        AP+D+TAES +K   KKRP GNREAVRKYREKKKARAA L
Sbjct  61   THTCFHVHTKIL-------SAPADETAESAEKSSSKKRPSGNREAVRKYREKKKARAASL  113

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            ED V++LRALNQQLLK+LQGQA LEAEVARL+CLLVD+RGRIE
Sbjct  114  EDEVIQLRALNQQLLKKLQGQAALEAEVARLRCLLVDLRGRIE  156



>ref|XP_006846902.1| hypothetical protein AMTR_s00152p00031760 [Amborella trichopoda]
 gb|ERN08483.1| hypothetical protein AMTR_s00152p00031760 [Amborella trichopoda]
Length=293

 Score =   154 bits (389),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 131/176 (74%), Gaps = 19/176 (11%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNF------CEFPDSNSYMDSFLNEI-LKDTHA--CTHAHTCNP  290
            MEDGE++FSNQ++ S  +       C   D    M SF  ++ +KD H+  CTH HTCNP
Sbjct  1    MEDGEIDFSNQDVFSRPSMEMGLGDC---DDGCSMGSFFEDLFVKDIHSQSCTHTHTCNP  57

Query  291  P-GPDNSHTHTCYHVHTKIVPA--PSEEDKAPS----DDTAESVDKKEKKRPLGNreavr  449
            P GPD +HTHTC+HVHTKI+ +  P+ +D A +    ++++   ++++KKRPLGN+EAVR
Sbjct  58   PAGPDLAHTHTCFHVHTKILSSADPNNDDDAAATTGEEESSSINEQQKKKRPLGNKEAVR  117

Query  450  kyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            KYREKKKARAA LED VV LRA+N QL+K+LQGQA LEAEVARLKCLLVDIRGRIE
Sbjct  118  KYREKKKARAASLEDEVVHLRAMNHQLMKKLQGQAALEAEVARLKCLLVDIRGRIE  173



>ref|XP_009136335.1| PREDICTED: uncharacterized protein LOC103860484 [Brassica rapa]
 ref|XP_009136337.1| PREDICTED: uncharacterized protein LOC103860484 [Brassica rapa]
Length=239

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 117/140 (84%), Gaps = 7/140 (5%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            EFP S+S MDSF +E+L+D+HACTH HTCNPPGP+N+HTHTC HVHTKI+P       A 
Sbjct  7    EFPLSSSSMDSFFDELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILP-------AQ  59

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
            +DDT+ES   K KK PLGNREAVRKYREKKKA+AA LED V+RLRA+N QL+KRLQGQA 
Sbjct  60   ADDTSESSGSKSKKTPLGNREAVRKYREKKKAKAASLEDEVIRLRAVNSQLMKRLQGQAA  119

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LEAEV RLKCLLVDIRGRIE
Sbjct  120  LEAEVTRLKCLLVDIRGRIE  139



>emb|CDY02237.1| BnaA03g39300D [Brassica napus]
Length=239

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 117/140 (84%), Gaps = 7/140 (5%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            EFP S+S MDSF +E+L+D+HACTH HTCNPPGP+N+HTHTC HVHTKI+P       A 
Sbjct  7    EFPLSSSSMDSFFDELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILP-------AK  59

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
            +DDT+ES   K KK PLGNREAVRKYREKKKA+AA LED V+RLRA+N QL+KRLQGQA 
Sbjct  60   ADDTSESSGSKSKKTPLGNREAVRKYREKKKAKAASLEDEVIRLRAVNSQLMKRLQGQAA  119

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LEAEV RLKCLLVDIRGRIE
Sbjct  120  LEAEVTRLKCLLVDIRGRIE  139



>ref|XP_003563276.1| PREDICTED: uncharacterized protein LOC100823660 [Brachypodium 
distachyon]
Length=269

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 121/165 (73%), Gaps = 8/165 (5%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSS---SNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPD  302
            M+DG+L+F+    L S   +   E P + S MDS+ +EILKDT   ACTH HTCNPP  D
Sbjct  1    MDDGDLDFNPDTYLCSGAAAGGTETPGACS-MDSYFDEILKDTEHLACTHTHTCNPPVHD  59

Query  303  NSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraa  482
             SHTHTC HVHTKIV A S+  ++P+++T     K  K+RP GNR AVRKYREKKKA  A
Sbjct  60   LSHTHTCVHVHTKIVSASSDGAESPAENTTSGTSK--KRRPSGNRAAVRKYREKKKAHTA  117

Query  483  LLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            LLE+ VV L+ALN++L+K++Q  A LEAEVARL+CLLVDIRGRIE
Sbjct  118  LLEEEVVHLKALNKELMKKVQNHAALEAEVARLRCLLVDIRGRIE  162



>ref|XP_009418779.1| PREDICTED: uncharacterized protein LOC103998893 [Musa acuminata 
subsp. malaccensis]
Length=272

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 119/165 (72%), Gaps = 17/165 (10%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCE-FPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNS  308
            M+DG+++FSN ++ S  N  +  P S S +DSF ++I  D   H CTH HTCNP     S
Sbjct  1    MDDGDIDFSNPDVFSGPNAGDDLPGSRS-IDSFFDDIFNDGQQHTCTHTHTCNPL----S  55

Query  309  HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGNreavrkyrekkkaraa  482
            HTHTC+HVHTKIV        AP D+ AES++K    KKR  GNREAVRKYR+KKKA AA
Sbjct  56   HTHTCFHVHTKIV-------SAPPDEAAESMEKSSSTKKRSCGNREAVRKYRQKKKAHAA  108

Query  483  LLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             LE+ V  LRA+NQQL+KRLQGQA LEAEVARL+CLLVD+RGRIE
Sbjct  109  SLEEEVAHLRAINQQLMKRLQGQAALEAEVARLRCLLVDMRGRIE  153



>ref|XP_009106517.1| PREDICTED: uncharacterized protein LOC103832273 [Brassica rapa]
Length=237

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 114/166 (69%), Gaps = 22/166 (13%)
 Frame = +3

Query  138  MEDGELE-FSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH-----ACTHAHTCNPPGP  299
            MEDGELE FS               SN  +DSF + +L D+H     ACTH HTCN    
Sbjct  1    MEDGELEVFS---------------SNGSIDSFFDGLLMDSHHHQQGACTHTHTCNNSTG  45

Query  300  DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkara  479
               H HTC+HVHTKI+P  S+E K  +DDTAES  K  +KRPLGNREAVRKYREKKKA+A
Sbjct  46   TEPHAHTCFHVHTKILPEDSDE-KVSTDDTAESCGKNGEKRPLGNREAVRKYREKKKAKA  104

Query  480  aLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            A LED   RLR LNQQL+KRLQ Q  LE+EV+RLKCLLVD+RGRI+
Sbjct  105  ASLEDECSRLRGLNQQLVKRLQSQGALESEVSRLKCLLVDLRGRID  150



>emb|CDY52654.1| BnaAnng11690D [Brassica napus]
Length=238

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 114/167 (68%), Gaps = 23/167 (14%)
 Frame = +3

Query  138  MEDGELE-FSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH------ACTHAHTCNPPG  296
            MEDGELE FS               SN  +DSF + +L D+H      ACTH HTCN   
Sbjct  1    MEDGELEVFS---------------SNGSIDSFFDGLLMDSHHQHQQGACTHTHTCNNST  45

Query  297  PDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkar  476
                H HTC+HVHTKI+P  S+E K  +DDTAES  K  +KRPLGNREAVRKYREKKKA+
Sbjct  46   GTEPHAHTCFHVHTKILPEDSDE-KVSTDDTAESCGKNGEKRPLGNREAVRKYREKKKAK  104

Query  477  aaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            AA LED   RLR LNQQL+KRLQ Q  LE+EV+RLKCLLVD+RGRI+
Sbjct  105  AASLEDECSRLRGLNQQLVKRLQSQGALESEVSRLKCLLVDLRGRID  151



>ref|XP_008800178.1| PREDICTED: uncharacterized protein LOC103714633 isoform X2 [Phoenix 
dactylifera]
Length=266

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 107/142 (75%), Gaps = 9/142 (6%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDK  371
            + P S S  D F +E LKD   H+CTH HTCN PGP+ SHTHTC+HVHTKIV A +EE  
Sbjct  22   QMPGSCSIND-FFDESLKDVPHHSCTHTHTCNHPGPNLSHTHTCFHVHTKIVSASAEE--  78

Query  372  APSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQ  551
              + D+AE      KKRP+GNREAVRKYREKKKA  A L D VV+LR+LNQQL+KRLQGQ
Sbjct  79   --TSDSAEK--SSSKKRPMGNREAVRKYREKKKAHTASLVDEVVQLRSLNQQLMKRLQGQ  134

Query  552  AVLEAEVARLKCLLVDIRGRIE  617
            A LEAE  RL+CLLVDIRGRIE
Sbjct  135  AALEAEATRLRCLLVDIRGRIE  156



>ref|XP_008800177.1| PREDICTED: uncharacterized protein LOC103714633 isoform X1 [Phoenix 
dactylifera]
Length=271

 Score =   146 bits (368),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 107/142 (75%), Gaps = 9/142 (6%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDK  371
            + P S S  D F +E LKD   H+CTH HTCN PGP+ SHTHTC+HVHTKIV A +EE  
Sbjct  22   QMPGSCSIND-FFDESLKDVPHHSCTHTHTCNHPGPNLSHTHTCFHVHTKIVSASAEE--  78

Query  372  APSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQ  551
              + D+AE      KKRP+GNREAVRKYREKKKA  A L D VV+LR+LNQQL+KRLQGQ
Sbjct  79   --TSDSAEK--SSSKKRPMGNREAVRKYREKKKAHTASLVDEVVQLRSLNQQLMKRLQGQ  134

Query  552  AVLEAEVARLKCLLVDIRGRIE  617
            A LEAE  RL+CLLVDIRGRIE
Sbjct  135  AALEAEATRLRCLLVDIRGRIE  156



>ref|XP_010920114.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
 ref|XP_010920115.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
 ref|XP_010920117.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
Length=262

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 105/138 (76%), Gaps = 10/138 (7%)
 Frame = +3

Query  213  NSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDD  386
            N  ++ F +E +KD   H+CTH HTCNPPGPD SH+HTC+H HTKI+ AP+ E       
Sbjct  22   NCSINGFFDESVKDMPRHSCTHTHTCNPPGPDLSHSHTCFHAHTKILSAPAME-------  74

Query  387  TAESVDKK-EKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLE  563
            T ES +K   KKRP+GNREAVRKYREKKKA  A L D +++LRALNQQL+KRLQ Q  LE
Sbjct  75   TFESAEKSLPKKRPIGNREAVRKYREKKKAHTASLADELLQLRALNQQLMKRLQRQVALE  134

Query  564  AEVARLKCLLVDIRGRIE  617
            AEVARL+CLLVDIRGRIE
Sbjct  135  AEVARLRCLLVDIRGRIE  152



>ref|XP_008790182.1| PREDICTED: uncharacterized protein LOC103707462 [Phoenix dactylifera]
Length=268

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 115/158 (73%), Gaps = 7/158 (4%)
 Frame = +3

Query  150  ELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTC  323
            +L+F N E+    +  +    N ++D F +E +KD   H+CTH HTCNPPG D SHTHTC
Sbjct  4    DLDFPNPEVFPGPDVGDQMPGNCWIDGFFDESVKDMPRHSCTHTHTCNPPGGDLSHTHTC  63

Query  324  YHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVV  503
            +H HT+I+ APSEE       +  +     KKRP+GNREAVRKYREKKKA+ A LED +V
Sbjct  64   FHAHTRILSAPSEETS-----SESAEKSSSKKRPIGNREAVRKYREKKKAQTASLEDEIV  118

Query  504  RLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            +LRALNQQL+KRLQGQ  LEAEVARL+CLLVDIRGRIE
Sbjct  119  QLRALNQQLMKRLQGQVALEAEVARLRCLLVDIRGRIE  156



>ref|XP_008813516.1| PREDICTED: uncharacterized protein LOC103724133, partial [Phoenix 
dactylifera]
Length=277

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 115/158 (73%), Gaps = 7/158 (4%)
 Frame = +3

Query  150  ELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTC  323
            +L+F N E+    +  +    N ++D F +E +KD   H+CTH HTCNPPG D SHTHTC
Sbjct  2    DLDFPNPEVFPGPDVGDQMPGNCWIDGFFDESVKDMPRHSCTHTHTCNPPGGDLSHTHTC  61

Query  324  YHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVV  503
            +H HT+I+ APSEE       +  +     KKRP+GNREAVRKYREKKKA+ A LED +V
Sbjct  62   FHAHTRILSAPSEETS-----SESAEKSSSKKRPIGNREAVRKYREKKKAQTASLEDEIV  116

Query  504  RLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            +LRALNQQL+KRLQGQ  LEAEVARL+CLLVDIRGRIE
Sbjct  117  QLRALNQQLMKRLQGQVALEAEVARLRCLLVDIRGRIE  154



>ref|XP_001758867.1| predicted protein [Physcomitrella patens]
 gb|EDQ76373.1| predicted protein, partial [Physcomitrella patens]
Length=171

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 117/163 (72%), Gaps = 4/163 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDS---FLNEILKDTHACTHAHTCNPPGPDNS  308
            M+DGELEF++ ++ +  + C+ P + + M S   FL E+L+ THACTH HTCNPPGPDN+
Sbjct  1    MDDGELEFTDHDVFAGCSLCDLPSTPTTMGSMENFLEEVLRSTHACTHTHTCNPPGPDNT  60

Query  309  HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  488
            HTHTCYH HT +  A  E+  A   +T  S     KKRPLGNREAVRKYREKKKA  A L
Sbjct  61   HTHTCYHTHTHLFAAGEEDTSADKSETPTS-SHNSKKRPLGNREAVRKYREKKKAHTAYL  119

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            E+ V  LR LNQQL+KRLQGQA LE+EV RL+ LL + RGRI+
Sbjct  120  EEQVHHLRGLNQQLVKRLQGQASLESEVIRLRSLLSEFRGRID  162



>ref|NP_001148839.1| LOC100282457 [Zea mays]
 gb|ACG33099.1| DNA binding protein [Zea mays]
Length=267

 Score =   137 bits (346),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  311
            M+DG+L+FSN +          P S+  MDS+ +EILKDT   ACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHLACTHTHTCNPPVHDLSH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  491
            THTC HVHTKIV A   + ++PS++ +   +   KKRP GNR AVRKYREKKKA  A LE
Sbjct  61   THTCVHVHTKIVAASPGDAESPSENNSNG-NAASKKRPSGNRAAVRKYREKKKAHTASLE  119

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            + VV LRALNQQL+K+LQ  A LEAE ARL+CLLVDIRGRIE
Sbjct  120  EEVVHLRALNQQLMKKLQSHAALEAEAARLRCLLVDIRGRIE  161



>ref|XP_008647848.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647849.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647850.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647851.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647852.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647853.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 gb|ACF83160.1| unknown [Zea mays]
 gb|ACN29059.1| unknown [Zea mays]
 gb|ACR33895.1| unknown [Zea mays]
 gb|AFU81623.1| bZIP-type transcription factor, partial [Zea mays subsp. mays]
 gb|AFW75759.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW75760.1| putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AFW75761.1| putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 gb|AFW75762.1| putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
 gb|AFW75763.1| putative bZIP transcription factor superfamily protein isoform 
5 [Zea mays]
 gb|AFW75764.1| putative bZIP transcription factor superfamily protein isoform 
6 [Zea mays]
 gb|AFW75765.1| putative bZIP transcription factor superfamily protein isoform 
7 [Zea mays]
Length=267

 Score =   137 bits (345),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 116/162 (72%), Gaps = 3/162 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  311
            M+DG+L+FSN +          P S+  MDS+ +EILKDT   ACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHLACTHTHTCNPPVHDLSH  60

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  491
            THTC HVHTKIV A   + ++PS++ +   +   KKRP GNR AVRKYREKKKA  A LE
Sbjct  61   THTCVHVHTKIVAASPGDAESPSENNSNG-NAASKKRPSGNRAAVRKYREKKKAHTASLE  119

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            + VV LRALNQQL+K+LQ  A LEAE ARL+CLLVDIRGRIE
Sbjct  120  EEVVHLRALNQQLMKKLQSHAALEAEAARLRCLLVDIRGRIE  161



>gb|KJB76278.1| hypothetical protein B456_012G081200 [Gossypium raimondii]
 gb|KJB76279.1| hypothetical protein B456_012G081200 [Gossypium raimondii]
Length=249

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 115/161 (71%), Gaps = 5/161 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSN-FCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  314
            MEDGE+E S+  +LS++     F DS S +D  ++E LK+T  C+H HTCNPPGPD +H+
Sbjct  5    MEDGEIELSDHVLLSNTAPSTNFQDSTS-VDLIIDEYLKNTRTCSHTHTCNPPGPDVAHS  63

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTCYH HT+++   + ED    ++ A S    + +R LGNREAVRKYREKKKA  A LE+
Sbjct  64   HTCYHTHTQLL---TSEDDDYHNNKASSGLNLKPRRSLGNREAVRKYREKKKAHTAYLEE  120

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V +LR LNQQL+++LQGQ +LEAEV RL+ LLV IR +++
Sbjct  121  EVKKLRLLNQQLVRKLQGQTILEAEVLRLRSLLVGIRAKVD  161



>gb|KJB76277.1| hypothetical protein B456_012G081200 [Gossypium raimondii]
Length=257

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 115/161 (71%), Gaps = 5/161 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSN-FCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  314
            MEDGE+E S+  +LS++     F DS S +D  ++E LK+T  C+H HTCNPPGPD +H+
Sbjct  13   MEDGEIELSDHVLLSNTAPSTNFQDSTS-VDLIIDEYLKNTRTCSHTHTCNPPGPDVAHS  71

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTCYH HT+++   + ED    ++ A S    + +R LGNREAVRKYREKKKA  A LE+
Sbjct  72   HTCYHTHTQLL---TSEDDDYHNNKASSGLNLKPRRSLGNREAVRKYREKKKAHTAYLEE  128

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V +LR LNQQL+++LQGQ +LEAEV RL+ LLV IR +++
Sbjct  129  EVKKLRLLNQQLVRKLQGQTILEAEVLRLRSLLVGIRAKVD  169



>gb|EMT00406.1| hypothetical protein F775_29696 [Aegilops tauschii]
Length=266

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 117/163 (72%), Gaps = 9/163 (6%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  311
            M+DG+L+FSN E    +   + P     MDS+ +E L DT   ACTH HTCNPP  D+SH
Sbjct  1    MDDGDLDFSNPEAYLDTG-ADLPGGGCSMDSYFDEFLNDTEHLACTHTHTCNPPVDDSSH  59

Query  312  THTCYHVHTKIVPAPSEEDK-APSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  488
            THTC HVHTKIV A S+    +P++++  S     KKRP GNR AVRKYREKKKA  ALL
Sbjct  60   THTCVHVHTKIVSASSDGGADSPAENSGAS-----KKRPSGNRAAVRKYREKKKAHTALL  114

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            E+ VV+L+ALN+QLLK+LQ  A LEAE ARL+CLLVDIRGRI+
Sbjct  115  EEEVVQLKALNKQLLKKLQNHAALEAEAARLRCLLVDIRGRID  157



>ref|XP_011091785.1| PREDICTED: putative transcription factor kapC [Sesamum indicum]
Length=256

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 120/159 (75%), Gaps = 5/159 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S++ +L +S+      ++   DSFL+++L++   CTH HTCNPPGPD +HTH
Sbjct  5    MDDGEVELSDRLLLPNSDSSSNIQASLSADSFLDDLLRNAQTCTHTHTCNPPGPDTAHTH  64

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT ++  PSEED  P D+ +  V K++  RPLGNREAVRKYREKKKA AA LE+ 
Sbjct  65   TCYHTHTHVI--PSEEDNDPCDEKS-PVSKRQ--RPLGNREAVRKYREKKKAHAAYLEEE  119

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRI  614
            V +LR LNQQL+K+LQ QA+LEAE+ RL+ LL+D+ G+I
Sbjct  120  VKKLRLLNQQLMKKLQRQAILEAEIVRLRTLLLDLSGKI  158



>ref|XP_008788583.1| PREDICTED: uncharacterized protein LOC103706294 [Phoenix dactylifera]
Length=225

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 108/161 (67%), Gaps = 18/161 (11%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNS-HT  314
            M+DGE++ S+  +L           N  M +  +E L+++  CTH HTCNPPGP  + HT
Sbjct  1    MDDGEVDLSSHLLLP----------NPEMTNSFDEYLRNSRTCTHTHTCNPPGPAAAMHT  50

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTCYH H ++  A ++ ++   ++       K  ++PLGNREAVRKYREKKKA+AA LE+
Sbjct  51   HTCYHTHMQVF-ATTDGERGGEEEL------KTSRKPLGNREAVRKYREKKKAQAAYLEE  103

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V +LR  NQQLL+RLQGQA LEAEV RL+ LLVD+R +I+
Sbjct  104  EVKKLRHANQQLLRRLQGQAALEAEVVRLRSLLVDLRAKID  144



>emb|CBI37871.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   110 bits (274),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGEL+FSNQ++ SS N  + P S S MDSF +EILKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNMADLPSSCS-MDSFFDEILKDTHACTHTHTCNPPGPDFSHTH  59

Query  318  TCYHVHTKI  344
            TC+HVHTKI
Sbjct  60   TCFHVHTKI  68



>gb|EMS54685.1| hypothetical protein TRIUR3_17772 [Triticum urartu]
Length=337

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 109/176 (62%), Gaps = 27/176 (15%)
 Frame = +3

Query  120  GIYISKMEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTC---  284
            G+++  M+DG+++F+N E             +  MDS+ ++ILKD    ACTH H C   
Sbjct  97   GLFLRTMDDGDIDFTNPETYL----------HPAMDSYFDDILKDPEHLACTHTHACCNL  146

Query  285  NPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE-----KKRPLGNreavr  449
            +       HT TC HVHTKI+       +  SDD A++ +  +     KKRP GNR AVR
Sbjct  147  HVRHDLAHHTQTCVHVHTKIL-------REESDDVAQTSESPQENNGPKKRPPGNRAAVR  199

Query  450  kyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            KYREKKKA   LLE+ V RL+ALN+QL+ RLQ  + LEAE +RL+CLLVDIRGRI+
Sbjct  200  KYREKKKAHTTLLEEEVARLKALNKQLVGRLQSHSALEAEASRLRCLLVDIRGRID  255



>dbj|BAJ84803.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score =   110 bits (276),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 106/163 (65%), Gaps = 7/163 (4%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILK---DTHACTHAHTCNPPGPDNS  308
            M+DG+++FSN E          P ++  M S+ ++IL    D  ACTH HTCNPP  D +
Sbjct  1    MDDGDIDFSNPETYLCEAMGNDPPASCSMGSYFDDILNSDADHLACTHTHTCNPPVHDLA  60

Query  309  HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  488
            H           + + S++    + +T+ES+   +K+RP GNR AVRKYREKKKA  ALL
Sbjct  61   HHTHTCVHVHTKILSASDD----AAETSESLPDAKKQRPSGNRAAVRKYREKKKAHTALL  116

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            E+ V  L+A+NQQL+K+LQ  + LEAEVARL+CLLVDIRGRIE
Sbjct  117  EEEVAHLKAVNQQLVKKLQSHSALEAEVARLRCLLVDIRGRIE  159



>gb|EMT32713.1| hypothetical protein F775_17323 [Aegilops tauschii]
Length=318

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 107/163 (66%), Gaps = 7/163 (4%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILK---DTHACTHAHTCNPPGPDNS  308
            M+DG+++FSN E          P ++  M ++ ++IL    D  ACTH HTCNPP  D +
Sbjct  1    MDDGDIDFSNPETFLCEAMGNDPPASCSMGTYFDDILNGDTDHLACTHTHTCNPPVHDLA  60

Query  309  HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  488
            H           + + S++    + +T+ES+ + +K+RP GNR AVRKYREKKKA  ALL
Sbjct  61   HHTHTCVHVHTKILSASDD----AAETSESLPESKKQRPSGNRAAVRKYREKKKAHTALL  116

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            E+ V  L+A+NQQL+K+LQ  + LEAEVARL+CLLVDIRGRIE
Sbjct  117  EEEVAHLKAVNQQLVKKLQSHSALEAEVARLRCLLVDIRGRIE  159



>gb|EMT13528.1| hypothetical protein F775_07298 [Aegilops tauschii]
Length=238

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 109/167 (65%), Gaps = 29/167 (17%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT-HACTHAHTCNPPGPDNSH-  311
            M+D +++F+N E         +P     MDS+ +++LKDT HAC     CNP   D +H 
Sbjct  1    MDDADIDFTNPET--------YP--RPAMDSYFDDVLKDTQHAC-----CNPHVEDLAHH  45

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE-----KKRPLGNreavrkyrekkkar  476
             HTC HVHTKI PA S       DD AE+ +  +     KKRP GNR AVR+YR+K+KAR
Sbjct  46   AHTCVHVHTKIHPAES-------DDVAETSESPQQNSGAKKRPSGNRAAVRRYRDKRKAR  98

Query  477  aaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             ALLE+ V RL+ALN+QL++++Q  + L+AE +RL+ LLVDIRGRIE
Sbjct  99   TALLEEEVARLKALNRQLVRKIQSHSALQAEASRLRYLLVDIRGRIE  145



>ref|XP_007149027.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 ref|XP_007149028.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 gb|ESW21021.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 gb|ESW21022.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
Length=260

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 85/121 (70%), Gaps = 8/121 (7%)
 Frame = +3

Query  255  THACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGN  434
            +  CTH HTCNPPGPD +HTHTCYH HT+I          P DD  +     + KRP GN
Sbjct  44   SRTCTHTHTCNPPGPDAAHTHTCYHSHTQIF--------GPEDDDDKEHTNSKPKRPSGN  95

Query  435  reavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRI  614
            REAVRKYREKKKA  A LE+ V +LR +NQQL ++LQGQA LEAE+ARL+ +L  ++G+I
Sbjct  96   REAVRKYREKKKAHTAYLEEEVKKLRLVNQQLARKLQGQAHLEAELARLRSILALLKGKI  155

Query  615  E  617
            +
Sbjct  156  D  156



>gb|EMS67651.1| hypothetical protein TRIUR3_23486 [Triticum urartu]
Length=253

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 111/164 (68%), Gaps = 6/164 (4%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILK---DTHACTHAHTCNPPGPD-N  305
            M+DG+++FSN E          P ++  M S+ ++IL    D  ACTH HTCNPP  D  
Sbjct  1    MDDGDIDFSNPETFLCEAMGNDPPASCSMGSYFDDILNSDADHLACTHTHTCNPPVHDLA  60

Query  306  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  485
             HTHTC HVHTKI+ A   +D A + ++       +K+RP GNR AVRKYREKKKA  AL
Sbjct  61   HHTHTCVHVHTKILSA--SDDAAETSESLPEGGATKKQRPSGNRAAVRKYREKKKAHTAL  118

Query  486  LEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            LE+ V  L+A+NQQL+K+LQ  + LEAEVARL+CLLVDIRGRIE
Sbjct  119  LEEEVAHLKAVNQQLVKKLQSHSALEAEVARLRCLLVDIRGRIE  162



>emb|CDP21594.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   106 bits (264),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 118/165 (72%), Gaps = 8/165 (5%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+D E+E S+  ++ +S+      ++  +DSFL+E+L++   CTH HTCNPPGPD +HTH
Sbjct  1    MDDREVELSHPVLVPNSDSSSSVQASISVDSFLDELLRNAQTCTHTHTCNPPGPDAAHTH  60

Query  318  TCYHVHTKIVPA-----PSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraa  482
            TCYH HT+++P+     PSE+   P D    +    + +R  GNREAVRKYREKKKA+ A
Sbjct  61   TCYHTHTQVIPSERVENPSEKVDGPCDSRKST---SKTRRSSGNREAVRKYREKKKAQTA  117

Query  483  LLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             LE+   +LR +NQQL++++Q QA+LEAE++RL+ LL+D+RG+I+
Sbjct  118  YLEEEAKKLRLVNQQLIRKVQRQAILEAEISRLRSLLLDVRGKID  162



>gb|EMS45140.1| hypothetical protein TRIUR3_21208 [Triticum urartu]
Length=214

 Score =   105 bits (261),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 95/141 (67%), Gaps = 18/141 (13%)
 Frame = +3

Query  201  FPD-SNSYMDSFLNEILKDTHACTHAHTCN-PPGPDNSHTHTCYHVHTKIVPAPSEEDKA  374
            +P+ S+ + D FL        ACTH HTCN P  P  +H+HTC H HT+++        A
Sbjct  17   YPEISHGFDDEFL--------ACTHTHTCNVPSWPAAAHSHTCLHAHTQVI--------A  60

Query  375  PSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQA  554
              +D AE    +  ++PLGNREAVRKYR+KKKA AA LE+ V +LRA NQQLL+RLQG A
Sbjct  61   SGEDHAEHDQLRNLRKPLGNREAVRKYRQKKKAHAAFLEEEVKKLRAANQQLLRRLQGHA  120

Query  555  VLEAEVARLKCLLVDIRGRIE  617
             LEAEVARL  LL+D+RG+I+
Sbjct  121  ALEAEVARLTGLLLDVRGKID  141



>emb|CAB41316.1| putative protein [Arabidopsis thaliana]
Length=157

 Score =   103 bits (257),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 89/122 (73%), Gaps = 8/122 (7%)
 Frame = +3

Query  255  THACTHAHTCNPPGP-DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLG  431
            T  C+H H+CNPPGP D SH+HTC+H HT ++ +  +++   SD +        KKR  G
Sbjct  13   TRGCSHTHSCNPPGPEDASHSHTCFHAHTHLIISQDQQENDHSDSS-------NKKRLCG  65

Query  432  NreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGR  611
            NREAVRKYREKKKAR A LED V+RL++LN+Q L++LQ Q ++E E+ RL+ LLV+++G+
Sbjct  66   NREAVRKYREKKKARTAYLEDEVMRLQSLNEQFLRKLQSQEMVETELIRLRALLVEMQGK  125

Query  612  IE  617
            IE
Sbjct  126  IE  127



>gb|EMS47152.1| hypothetical protein TRIUR3_12850 [Triticum urartu]
Length=195

 Score =   102 bits (253),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 102/163 (63%), Gaps = 15/163 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DG+L+FS+  M             SY D  L    +    CTH HTCNPP  D  HTH
Sbjct  1    MDDGDLDFSSMSM------------GSYFDDLLGGTAEHLACCTHTHTCNPPAHDLPHTH  48

Query  318  TCYHVHTKI--VPAPSEEDKAPSD-DTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  488
            TC+HVH+K     +      +P++ + A +  + +K+RP GNR AVRKYREKKK   A+L
Sbjct  49   TCHHVHSKFAASASSDAAADSPTEPEDAHATSRSKKRRPSGNRAAVRKYREKKKEHTAVL  108

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            ++   RLRA+N+QL K++Q  A LEAE ARL+CLLVD+RGRIE
Sbjct  109  QEEAARLRAMNEQLTKKVQDHAALEAEAARLRCLLVDVRGRIE  151



>ref|XP_003566090.1| PREDICTED: uncharacterized protein LOC100823248 [Brachypodium 
distachyon]
Length=233

 Score =   102 bits (255),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 86/123 (70%), Gaps = 11/123 (9%)
 Frame = +3

Query  255  THACTHAHTCNPPGPDNS-HTHTCYHVHTKIVPAPSEEDKA-PSDDTAESVDKKEKKRPL  428
            T +C+H HTCN PGP  + H+HTC H HTK+    SE+D   P+  T         +RPL
Sbjct  34   TSSCSHTHTCNAPGPSAAMHSHTCQHTHTKVFATGSEDDDGNPAAKT---------RRPL  84

Query  429  GNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRG  608
            GNREAVRKYREKKKARAA LE+ V +LRA NQQLL+RLQG   LEAEV RL+ LL D+R 
Sbjct  85   GNREAVRKYREKKKARAAFLEEEVRKLRAANQQLLRRLQGHGALEAEVVRLRSLLPDVRA  144

Query  609  RIE  617
            +I+
Sbjct  145  KID  147



>gb|EMT32723.1| hypothetical protein F775_08202 [Aegilops tauschii]
Length=176

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 102/163 (63%), Gaps = 15/163 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DG+L+FS+  M             SY D  L    +    CTH HTCNPP  D  H+H
Sbjct  1    MDDGDLDFSSMSM------------GSYFDDVLGGAAEHLACCTHTHTCNPPAHDLPHSH  48

Query  318  TCYHVHTKI--VPAPSEEDKAPSD-DTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  488
            TC+HVH+K     +      +P++ + A +  + +K+RP GNR AVRKYREKKK   A+L
Sbjct  49   TCHHVHSKFAASASSDAAADSPTEPEDAHATSRSKKRRPSGNRAAVRKYREKKKEHTAVL  108

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            ++   RLRA+N+QL K++Q  A LEAE ARL+CLLVD+RGRIE
Sbjct  109  QEEAARLRAMNEQLTKKVQDHAALEAEAARLRCLLVDVRGRIE  151



>gb|EMT18405.1| hypothetical protein F775_16738 [Aegilops tauschii]
Length=195

 Score =   101 bits (252),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 93/142 (65%), Gaps = 19/142 (13%)
 Frame = +3

Query  201  FPD-SNSYMDSFLNEILKDTHACTHAHTC--NPPGPDNSHTHTCYHVHTKIVPAPSEEDK  371
            +P+ S+ + D FL        ACTH HTC   P  P  +H HTC H HT+++        
Sbjct  17   YPEISHGFDDEFL--------ACTHTHTCCNVPSWPAAAHAHTCLHAHTQVI--------  60

Query  372  APSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQ  551
            A  +D AE    +  ++PLGNREAVRKYR+KKKA AA LE+ V +LRA NQQLL+RLQG 
Sbjct  61   ASGEDHAEHDQLRNLRKPLGNREAVRKYRQKKKAHAAFLEEEVKKLRAANQQLLRRLQGH  120

Query  552  AVLEAEVARLKCLLVDIRGRIE  617
            A LEAEVARL  LL+D+RG+I+
Sbjct  121  AALEAEVARLTGLLLDVRGKID  142



>dbj|BAJ86065.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=213

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 93/140 (66%), Gaps = 16/140 (11%)
 Frame = +3

Query  201  FPDSNSYMDSFLNEILKDTHACTHAHTC-NPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            +P+ +   D FL        ACTH H+C +   P  +HTHTC H HT++V   S ED A 
Sbjct  17   YPEISHGFDEFL--------ACTHTHSCPSWSSPAAAHTHTCLHAHTQVVA--SGEDYAV  66

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
              D     + +  ++PLGNREAVRKYR+KKKA AA LE+ V +LRA NQQLL+RLQG A 
Sbjct  67   EQD-----ELRNPRKPLGNREAVRKYRQKKKAHAAFLEEEVKKLRAANQQLLRRLQGHAA  121

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LEAEVARL  LL+D+RG+I+
Sbjct  122  LEAEVARLTSLLLDVRGKID  141



>ref|NP_190764.2| basic leucine zipper 24 [Arabidopsis thaliana]
 gb|AEE78868.1| basic leucine zipper 24 [Arabidopsis thaliana]
Length=228

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 89/122 (73%), Gaps = 8/122 (7%)
 Frame = +3

Query  255  THACTHAHTCNPPGP-DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLG  431
            T  C+H H+CNPPGP D SH+HTC+H HT ++ +  +++   SD +        KKR  G
Sbjct  52   TRGCSHTHSCNPPGPEDASHSHTCFHAHTHLIISQDQQENDHSDSS-------NKKRLCG  104

Query  432  NreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGR  611
            NREAVRKYREKKKAR A LED V+RL++LN+Q L++LQ Q ++E E+ RL+ LLV+++G+
Sbjct  105  NREAVRKYREKKKARTAYLEDEVMRLQSLNEQFLRKLQSQEMVETELIRLRALLVEMQGK  164

Query  612  IE  617
            IE
Sbjct  165  IE  166



>ref|XP_010922246.1| PREDICTED: uncharacterized protein LOC105045595 [Elaeis guineensis]
Length=230

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 103/161 (64%), Gaps = 16/161 (10%)
 Frame = +3

Query  135  KMEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  314
            +M+DGE++ S+  +L           NS M S   E  +++  CTH HTCNPPGP ++  
Sbjct  5    RMDDGEVDLSSHLLLP----------NSEMTSSFEEYFRNSRKCTHTHTCNPPGPADAMH  54

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
                +     V A ++ ++   ++      +K+ ++PLGNREAVRKYREKKKA+AA LE+
Sbjct  55   THTCYHTHTQVFATADGEREGEEE------QKKSRKPLGNREAVRKYREKKKAQAAYLEE  108

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             V +LR LNQQLLKRLQGQA LEAEV RL+  L+D+R +I+
Sbjct  109  EVKKLRLLNQQLLKRLQGQAALEAEVVRLRSHLMDLRAKID  149



>ref|NP_850680.1| basic leucine zipper 24 [Arabidopsis thaliana]
 dbj|BAC42285.1| putative bZip transcription factor Atbzip24 [Arabidopsis thaliana]
 gb|AAO63842.1| putative bZIP family transcription factor [Arabidopsis thaliana]
 gb|AEE78869.1| basic leucine zipper 24 [Arabidopsis thaliana]
Length=227

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 9/122 (7%)
 Frame = +3

Query  255  THACTHAHTCNPPGP-DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLG  431
            T  C+H H+CNPPGP D SH+HTC+H HT ++ +  +E+        +  D   KKR  G
Sbjct  52   TRGCSHTHSCNPPGPEDASHSHTCFHAHTHLIISDQQEN--------DHSDSSNKKRLCG  103

Query  432  NreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGR  611
            NREAVRKYREKKKAR A LED V+RL++LN+Q L++LQ Q ++E E+ RL+ LLV+++G+
Sbjct  104  NREAVRKYREKKKARTAYLEDEVMRLQSLNEQFLRKLQSQEMVETELIRLRALLVEMQGK  163

Query  612  IE  617
            IE
Sbjct  164  IE  165



>gb|EMT32714.1| hypothetical protein F775_17324 [Aegilops tauschii]
Length=188

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 97/140 (69%), Gaps = 7/140 (5%)
 Frame = +3

Query  216  SYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSE----EDKAP  377
            S M S+ ++IL DT   ACTH HTCNPP     HTHTC HVH+KI  + S     E  A 
Sbjct  9    SSMGSYFDDILMDTEQVACTHTHTCNPPAHHLPHTHTCLHVHSKIAASASSDAGAETPAG  68

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
             +D A +  + +++RP GN+ AVRKYREKKKA  ALLE+   RLRA+N+QL K++Q  A 
Sbjct  69   FED-AHATSRSKRRRPSGNQAAVRKYREKKKAHTALLEEEAARLRAMNEQLAKKVQDHAA  127

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LEAE ARL+CLLVD+RGRIE
Sbjct  128  LEAEAARLRCLLVDVRGRIE  147



>gb|EMS52367.1| hypothetical protein TRIUR3_01653 [Triticum urartu]
Length=182

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 98/139 (71%), Gaps = 5/139 (4%)
 Frame = +3

Query  216  SYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEED--KAPSD  383
            S M S+ ++IL DT   ACTH HTCNPP     HTHTC HVH+K   + S +   + P++
Sbjct  9    SSMGSYFDDILMDTEQVACTHTHTCNPPAHHLPHTHTCLHVHSKFAASASSDAGAETPAE  68

Query  384  -DTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVL  560
             + A +  + +K+RPLGNR AVRKYREKKK   A+L++   RLRA+N+QL K++Q  A L
Sbjct  69   FEDAHATSRSKKRRPLGNRAAVRKYREKKKEHTAVLQEEAARLRAMNEQLTKKVQDHAAL  128

Query  561  EAEVARLKCLLVDIRGRIE  617
            EAE ARL+CLLVD+RGRIE
Sbjct  129  EAEAARLRCLLVDVRGRIE  147



>emb|CDM84592.1| unnamed protein product [Triticum aestivum]
Length=213

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 90/140 (64%), Gaps = 17/140 (12%)
 Frame = +3

Query  201  FPDSNSYMDSFLNEILKDTHACTHAHTCNP-PGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            +P+ +   D FL        ACTH HTCN       +H HTC H HT+++        A 
Sbjct  17   YPEISHGFDEFL--------ACTHTHTCNGLSWSAAAHAHTCLHAHTQVI--------AS  60

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
             +D AE    +  ++PLGNREAVRKYR+KKKA AA LE+ V +LRA NQQLL+RLQG A 
Sbjct  61   GEDHAEHDQLRNLRKPLGNREAVRKYRQKKKAHAAFLEEEVKKLRAANQQLLRRLQGHAA  120

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LEAEVARL  LL+D+RG+I+
Sbjct  121  LEAEVARLTGLLLDVRGKID  140



>ref|XP_002973971.1| hypothetical protein SELMODRAFT_414462 [Selaginella moellendorffii]
 gb|EFJ24926.1| hypothetical protein SELMODRAFT_414462 [Selaginella moellendorffii]
Length=285

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 126/187 (67%), Gaps = 27/187 (14%)
 Frame = +3

Query  138  MEDGELEFSNQEML--SSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSH  311
            M+DGE++FS+ ++   +S+  C+   S S M+SFL+EILK TH CTH HTCNPPGPD +H
Sbjct  1    MDDGEVDFSDHDIFCGASNLVCDDDHSASAMESFLDEILKSTHTCTHTHTCNPPGPDKTH  60

Query  312  THTCYHVHTKIVPAP--------SEED-KAPSDDT----------------AESVDKKEK  416
            THTC+H HT++  +P         EED   PS +                 A +  +  K
Sbjct  61   THTCFHTHTQLFASPEEGSSHQKEEEDHHRPSSEALGPGSIATAATTTATTAAAAPQSSK  120

Query  417  KRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLV  596
            KRPLGNREAVRKYREKKKA AA LE+ V +L+ALNQQL+KRLQGQA LEAEVARL+ LL 
Sbjct  121  KRPLGNREAVRKYREKKKAHAAYLEEQVAQLKALNQQLVKRLQGQAALEAEVARLRALLS  180

Query  597  DIRGRIE  617
            + RGRI+
Sbjct  181  EFRGRID  187



>ref|XP_002969093.1| hypothetical protein SELMODRAFT_409920 [Selaginella moellendorffii]
 gb|EFJ30209.1| hypothetical protein SELMODRAFT_409920 [Selaginella moellendorffii]
Length=282

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 122/184 (66%), Gaps = 24/184 (13%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE++FS+ ++   ++     D +S M+SFL+EILK TH CTH HTCNPPGPD +HTH
Sbjct  1    MDDGEVDFSDHDIFCGASNLVCDDDHSAMESFLDEILKSTHTCTHTHTCNPPGPDKTHTH  60

Query  318  TCYHVHTKIVPAPSE----------------EDKAPSD--------DTAESVDKKEKKRP  425
            TC+H HT++  +P E                E   P           TA +  +  KKRP
Sbjct  61   TCFHTHTQLFASPEEGSSHQKEEEDHHRPGSEALGPGSIATAATTATTAAAAPQSSKKRP  120

Query  426  LGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIR  605
            LGNREAVRKYREKKKA AA LE+ V +L+ALNQQL+KRLQGQA LEAEVARL+ LL + R
Sbjct  121  LGNREAVRKYREKKKAHAAYLEEQVAQLKALNQQLVKRLQGQAALEAEVARLRALLSEFR  180

Query  606  GRIE  617
            GRI+
Sbjct  181  GRID  184



>ref|XP_006403861.1| hypothetical protein EUTSA_v10010764mg [Eutrema salsugineum]
 gb|ESQ45314.1| hypothetical protein EUTSA_v10010764mg [Eutrema salsugineum]
Length=176

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 85/123 (69%), Gaps = 11/123 (9%)
 Frame = +3

Query  255  THACTHAHTCNPPGP-DNSHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPL  428
            +  C+H H+CNPPGP D SH+HTC+H HT  I+P   E D           D   KKR  
Sbjct  13   SRGCSHTHSCNPPGPEDASHSHTCFHAHTHLIIPDSGENDHC---------DGSNKKRSC  63

Query  429  GNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRG  608
            GNREAVRKYREKKKAR A LED V RL++LN+QL+++LQ Q ++E E+ RL+ LLV+++G
Sbjct  64   GNREAVRKYREKKKARTAYLEDEVKRLQSLNEQLIRKLQSQEMVETEIIRLRTLLVEMQG  123

Query  609  RIE  617
             I+
Sbjct  124  MID  126



>ref|XP_002877837.1| bZIP family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54096.1| bZIP family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=211

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 89/123 (72%), Gaps = 11/123 (9%)
 Frame = +3

Query  255  THACTHAHTCNPPGPDNS-HTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPL  428
            T  C+H H+CNPPGP+++ H+HTC+H HT  I+P   E D +         D   KKR  
Sbjct  36   TRGCSHTHSCNPPGPEDAFHSHTCFHAHTHLIIPDQQENDHS---------DSSNKKRSC  86

Query  429  GNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRG  608
            GNREAVRKYREKKKAR A LED V RL++LN+Q+L++LQ Q ++E+E+ RL+ L+V+++G
Sbjct  87   GNREAVRKYREKKKARTAYLEDEVKRLQSLNEQMLRKLQSQEMMESELIRLRTLVVEMQG  146

Query  609  RIE  617
            +I+
Sbjct  147  KID  149



>ref|XP_006291938.1| hypothetical protein CARUB_v10018125mg [Capsella rubella]
 gb|EOA24836.1| hypothetical protein CARUB_v10018125mg [Capsella rubella]
Length=171

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 85/123 (69%), Gaps = 11/123 (9%)
 Frame = +3

Query  255  THACTHAHTCNPPGPDN-SHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPL  428
            +  C+H H+CNPPGPD+ SH+HTC+H HT  I+P   E D +         D   KKR  
Sbjct  15   SRGCSHTHSCNPPGPDDASHSHTCFHTHTHLIIPDQQENDHS---------DSSNKKRSC  65

Query  429  GNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRG  608
            GNREAVRKYREKKKAR A LED V RL+ LN+ L ++LQ QA +E EV RL+ LLV+++G
Sbjct  66   GNREAVRKYREKKKARTAYLEDEVKRLQTLNEHLHRKLQSQATVETEVIRLRTLLVEMQG  125

Query  609  RIE  617
            +I+
Sbjct  126  KID  128



>ref|XP_008647614.1| PREDICTED: putative bZIP transcription factor superfamily protein 
isoform 1 isoform X1 [Zea mays]
Length=332

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 107/170 (63%), Gaps = 27/170 (16%)
 Frame = +3

Query  126  YISKMEDG-----ELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNP  290
            + + M+DG     +L FS+ EM         PDS    D F N         TH H+CNP
Sbjct  100  FSATMDDGADLPCQLLFSHPEM---------PDS---FDEFFNSATTTC---THTHSCNP  144

Query  291  PGPDNS-HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekk  467
            PGP  + HTHTC H HT ++ +  E+D    DD  E  D  + +RPLGNREAVRKYREKK
Sbjct  145  PGPSVAMHTHTCLHAHTLVLGSGGEDD----DDARE--DSAKPRRPLGNREAVRKYREKK  198

Query  468  karaaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            KA AA LE+ V +LRA NQQL +RLQG A LEAEVARL+ LL+DIRG+I+
Sbjct  199  KAHAAFLEEEVKKLRAANQQLQRRLQGHAALEAEVARLRGLLLDIRGKID  248



>ref|XP_010426786.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426787.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426788.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426789.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426790.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
Length=190

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 11/123 (9%)
 Frame = +3

Query  255  THACTHAHTCNPPGPDN-SHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPL  428
            +  C+H H+CNPPGPD+ SH+HTC+H HT  I+P   E D +         D   KKR  
Sbjct  13   SRGCSHTHSCNPPGPDDASHSHTCFHTHTHLIIPDQQENDHS---------DSSNKKRSC  63

Query  429  GNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRG  608
            GNREAVRKYREKKKAR A LED V RL  LN+ L+++LQ QA++EAE+ RL+ LLV+++ 
Sbjct  64   GNREAVRKYREKKKARTAYLEDEVKRLETLNEHLVRKLQSQAIVEAELIRLRTLLVEMQE  123

Query  609  RIE  617
            +I+
Sbjct  124  KID  126



>ref|XP_010426784.1| PREDICTED: uncharacterized protein LOC104711744 isoform X1 [Camelina 
sativa]
Length=231

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 92/138 (67%), Gaps = 12/138 (9%)
 Frame = +3

Query  213  NSYMDSFLNEILKD-THACTHAHTCNPPGPDN-SHTHTCYHVHTK-IVPAPSEEDKAPSD  383
            N+ MD    E+    +  C+H H+CNPPGPD+ SH+HTC+H HT  I+P   E D +   
Sbjct  39   NTTMDEEEVEVWGGASRGCSHTHSCNPPGPDDASHSHTCFHTHTHLIIPDQQENDHS---  95

Query  384  DTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLE  563
                  D   KKR  GNREAVRKYREKKKAR A LED V RL  LN+ L+++LQ QA++E
Sbjct  96   ------DSSNKKRSCGNREAVRKYREKKKARTAYLEDEVKRLETLNEHLVRKLQSQAIVE  149

Query  564  AEVARLKCLLVDIRGRIE  617
            AE+ RL+ LLV+++ +I+
Sbjct  150  AELIRLRTLLVEMQEKID  167



>emb|CDY60641.1| BnaCnng36700D [Brassica napus]
Length=188

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 85/119 (71%), Gaps = 9/119 (8%)
 Frame = +3

Query  261  ACTHAHTCNPPGP-DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNr  437
             C+H H+CNPPGP D SH+HTC+H HT ++   S+E+           D   K+R  GNR
Sbjct  15   GCSHTHSCNPPGPEDASHSHTCFHTHTHLIIPDSQENGHS--------DSSNKRRSCGNR  66

Query  438  eavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRI  614
            EAVRKYREKKKAR A LED V RL+++N+ LL++LQ QA++EAE+ RL+ LLV+++G +
Sbjct  67   EAVRKYREKKKARTAYLEDEVQRLQSMNEFLLRKLQSQAIVEAEIVRLRTLLVEMQGTM  125



>ref|NP_001142351.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|ACF88261.1| unknown [Zea mays]
 gb|ACN25229.1| unknown [Zea mays]
 gb|ACR38309.1| unknown [Zea mays]
 gb|AFW78521.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW78522.1| putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AFW78523.1| putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 gb|AFW78524.1| putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
Length=229

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 105/166 (63%), Gaps = 27/166 (16%)
 Frame = +3

Query  138  MEDG-----ELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPD  302
            M+DG     +L FS+ EM         PDS    D F N         TH H+CNPPGP 
Sbjct  1    MDDGADLPCQLLFSHPEM---------PDS---FDEFFNSATTTC---THTHSCNPPGPS  45

Query  303  NS-HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkara  479
             + HTHTC H HT ++ +  E+D    DD  E  D  + +RPLGNREAVRKYREKKKA A
Sbjct  46   VAMHTHTCLHAHTLVLGSGGEDD----DDARE--DSAKPRRPLGNREAVRKYREKKKAHA  99

Query  480  aLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            A LE+ V +LRA NQQL +RLQG A LEAEVARL+ LL+DIRG+I+
Sbjct  100  AFLEEEVKKLRAANQQLQRRLQGHAALEAEVARLRGLLLDIRGKID  145



>ref|XP_004970277.1| PREDICTED: uncharacterized protein LOC101760983 isoform X1 [Setaria 
italica]
 ref|XP_004970278.1| PREDICTED: uncharacterized protein LOC101760983 isoform X2 [Setaria 
italica]
Length=213

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 85/139 (61%), Gaps = 13/139 (9%)
 Frame = +3

Query  201  FPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPS  380
             P S+  +   L++ LK T ACTH H CNPPGP  +            V A  EE + P 
Sbjct  13   LPLSHPEISHGLDDFLKSTTACTHTHPCNPPGPAAAMHTHTCLHTHTQVIASGEEQRKP-  71

Query  381  DDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVL  560
                        ++PLGNREAVRKYREKKKA AA LE+ V +LRA NQQLL+RLQG A L
Sbjct  72   ------------QKPLGNREAVRKYREKKKAHAAFLEEEVKKLRATNQQLLRRLQGHAAL  119

Query  561  EAEVARLKCLLVDIRGRIE  617
            EAEV RL+ LL D+RG+I+
Sbjct  120  EAEVVRLRVLLFDVRGKID  138



>ref|XP_010104020.1| hypothetical protein L484_001603 [Morus notabilis]
 gb|EXB97908.1| hypothetical protein L484_001603 [Morus notabilis]
Length=232

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 101/132 (77%), Gaps = 5/132 (4%)
 Frame = +3

Query  222  MDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESV  401
            +DSF++++LK+   CTH HTCNPPGPD++HTHTCYH HT+++ A  ++D   S   + S 
Sbjct  3    LDSFIDDLLKNARTCTHTHTCNPPGPDSTHTHTCYHTHTQVL-ASEDDDHTTSKQNSTS-  60

Query  402  DKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARL  581
               + +RP GNR+AVRKYREKKKA AA LE+ V +LR  NQQL ++L+ QAVLEAEV RL
Sbjct  61   ---KSRRPSGNRDAVRKYREKKKAHAAYLEEEVNKLRLANQQLARKLRRQAVLEAEVLRL  117

Query  582  KCLLVDIRGRIE  617
            + LLVD+RG+I+
Sbjct  118  RGLLVDLRGKID  129



>emb|CDY23178.1| BnaA04g05810D [Brassica napus]
Length=188

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 86/120 (72%), Gaps = 9/120 (8%)
 Frame = +3

Query  261  ACTHAHTCNPPGP-DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNr  437
             C+H H+CNPPGP D SH+HTC+H HT ++   S+E+        +  D   K+RP GNR
Sbjct  15   GCSHTHSCNPPGPEDASHSHTCFHTHTHLIIPDSQEN--------DHSDSSNKRRPCGNR  66

Query  438  eavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            EAVRKYREKKKAR A LED V RL+++N+ LL++LQ QA++EAE+ RL+ LL +++  I+
Sbjct  67   EAVRKYREKKKARTAYLEDEVKRLQSMNEFLLRKLQSQAIVEAEIIRLRTLLAEMQKTID  126



>ref|XP_010515638.1| PREDICTED: uncharacterized protein LOC104791444 isoform X1 [Camelina 
sativa]
 ref|XP_010515639.1| PREDICTED: uncharacterized protein LOC104791444 isoform X1 [Camelina 
sativa]
 ref|XP_010515640.1| PREDICTED: uncharacterized protein LOC104791444 isoform X1 [Camelina 
sativa]
Length=207

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 11/123 (9%)
 Frame = +3

Query  255  THACTHAHTCNPPGP-DNSHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPL  428
            +  C+H H+CNPPGP D SH+HTC+H HT  I+P   E D + S++         KKR  
Sbjct  15   SRGCSHTHSCNPPGPEDASHSHTCFHTHTHLIIPDQQENDHSDSNN---------KKRSC  65

Query  429  GNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRG  608
            GNREAVRKYREKKKAR A LED V RL  LN+ L+++LQ QA++E E+ RL+ LLV+I+ 
Sbjct  66   GNREAVRKYREKKKARTAYLEDEVKRLETLNEHLVRKLQSQAIVETELIRLRTLLVEIQE  125

Query  609  RIE  617
            +I+
Sbjct  126  KID  128



>ref|XP_010515641.1| PREDICTED: uncharacterized protein LOC104791444 isoform X2 [Camelina 
sativa]
Length=194

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 11/121 (9%)
 Frame = +3

Query  261  ACTHAHTCNPPGP-DNSHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPLGN  434
             C+H H+CNPPGP D SH+HTC+H HT  I+P   E D + S++         KKR  GN
Sbjct  17   GCSHTHSCNPPGPEDASHSHTCFHTHTHLIIPDQQENDHSDSNN---------KKRSCGN  67

Query  435  reavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRI  614
            REAVRKYREKKKAR A LED V RL  LN+ L+++LQ QA++E E+ RL+ LLV+I+ +I
Sbjct  68   REAVRKYREKKKARTAYLEDEVKRLETLNEHLVRKLQSQAIVETELIRLRTLLVEIQEKI  127

Query  615  E  617
            +
Sbjct  128  D  128



>gb|ACN36681.1| unknown [Zea mays]
 gb|AIB05224.1| bZIP transcription factor, partial [Zea mays]
Length=229

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 104/166 (63%), Gaps = 27/166 (16%)
 Frame = +3

Query  138  MEDG-----ELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPD  302
            M+DG     +L FS+ EM         PDS    D F N         TH H+CNPPGP 
Sbjct  1    MDDGADLPCQLLFSHPEM---------PDS---FDEFFNSATTTC---THTHSCNPPGPS  45

Query  303  NS-HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkara  479
             + HT TC H HT ++ +  E+D    DD  E  D  + +RPLGNREAVRKYREKKKA A
Sbjct  46   VAMHTRTCLHAHTLVLGSGGEDD----DDARE--DSAKPRRPLGNREAVRKYREKKKAHA  99

Query  480  aLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            A LE+ V +LRA NQQL +RLQG A LEAEVARL+ LL+DIRG+I+
Sbjct  100  AFLEEEVKKLRAANQQLQRRLQGHAALEAEVARLRGLLLDIRGKID  145



>ref|XP_006850552.1| hypothetical protein AMTR_s00159p00081760 [Amborella trichopoda]
 gb|ERN12133.1| hypothetical protein AMTR_s00159p00081760 [Amborella trichopoda]
Length=271

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 116/173 (67%), Gaps = 24/173 (14%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFL-----------NEILKDTHA--CTHAH  278
            M+DGE+E S++ +    N  ++P   S +D+ +           N I KD+ A  CTH H
Sbjct  1    MDDGEVELSSEHVFLC-NSDDYP-MESMLDALMSKSKKKNMSEKNRITKDSSARTCTHTH  58

Query  279  TCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyr  458
            TCNPPGPD++HTHTCYH HT  + +P+EE   PS+  +      +  +  GNREAVRKYR
Sbjct  59   TCNPPGPDSTHTHTCYHTHTTQLFSPNEE---PSNSPS------KPNKTSGNREAVRKYR  109

Query  459  ekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            EKKKA  A LE+ V +LRALNQQLL+ LQGQA+LEAEV RL+ +L+D+RG+I+
Sbjct  110  EKKKAHTAYLEEEVKKLRALNQQLLRTLQGQAMLEAEVVRLRTILMDLRGKID  162



>ref|XP_008344616.1| PREDICTED: uncharacterized protein LOC103407459 [Malus domestica]
 ref|XP_008344617.1| PREDICTED: uncharacterized protein LOC103407459 [Malus domestica]
 ref|XP_008363297.1| PREDICTED: uncharacterized protein LOC103426998 [Malus domestica]
 ref|XP_008363299.1| PREDICTED: uncharacterized protein LOC103426998 [Malus domestica]
Length=245

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+  S+  +L + N       ++Y D+F +E LK    CTH HTCNPPGPD +HTH
Sbjct  1    MDDGEVVTSDHALLPNPNSSSTFHGSTYEDTFFDEFLKTARTCTHTHTCNPPGPDAAHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT+I+   S ED   + +   S+ +  ++RP GNREAVRKYREKKKA  A LE+ 
Sbjct  61   TCYHTHTQIL---SSEDDDGTKNKDHSIPRPRRRRPSGNREAVRKYREKKKAHTAYLEEE  117

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +L+ LNQQL+++LQGQA+LEAE  RL+ LL++ RG+I+
Sbjct  118  VKKLQVLNQQLVRKLQGQAILEAERLRLRGLLLEFRGKID  157



>gb|KDO83274.1| hypothetical protein CISIN_1g024477mg [Citrus sinensis]
 gb|KDO83275.1| hypothetical protein CISIN_1g024477mg [Citrus sinensis]
Length=267

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 5/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+  +L +  F     +++ +DSFL+E LK+T  CTH HTCNPPGPD +HTH
Sbjct  5    MDDGEVELSDHALLLNQEFSRNFHNSASVDSFLDEFLKNTKTCTHTHTCNPPGPDAAHTH  64

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT+++   SEED   S+    SV K   +R  GNREAVRKYREKKKA  A LE+ 
Sbjct  65   TCYHTHTQVI--ASEEDN-HSNSKENSVSK--PRRSSGNREAVRKYREKKKAHTAYLEEE  119

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +L  LNQQL+++LQGQA+LEAE  RL+ LL D RG+I+
Sbjct  120  VKKLHTLNQQLVRKLQGQAILEAEFLRLRSLLADFRGKID  159



>dbj|BAK03166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score = 91.7 bits (226),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 89/143 (62%), Gaps = 14/143 (10%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNS--HTHTCYHVHTKIVPAPSEED  368
            +F  S+  M    +++L D  A CTH HTCNPPGP  +       +    ++  A SE+D
Sbjct  10   QFLFSHPEMPGAFDDLLADAAATCTHTHTCNPPGPSAAMHTHTCLHTHTHQLFAAGSEDD  69

Query  369  KAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQG  548
                       D    +RPLGNREAVRKYREKKKA AA LE+ V +LRA NQQLL+RLQG
Sbjct  70   -----------DAARPRRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLRRLQG  118

Query  549  QAVLEAEVARLKCLLVDIRGRIE  617
             A LEAEVARL+ LL D+R +I+
Sbjct  119  HATLEAEVARLRGLLSDVRAKID  141



>ref|XP_006438937.1| hypothetical protein CICLE_v10032430mg [Citrus clementina]
 ref|XP_006438938.1| hypothetical protein CICLE_v10032430mg [Citrus clementina]
 ref|XP_006482937.1| PREDICTED: uncharacterized protein LOC102609311 isoform X1 [Citrus 
sinensis]
 ref|XP_006482938.1| PREDICTED: uncharacterized protein LOC102609311 isoform X2 [Citrus 
sinensis]
 gb|ESR52177.1| hypothetical protein CICLE_v10032430mg [Citrus clementina]
 gb|ESR52178.1| hypothetical protein CICLE_v10032430mg [Citrus clementina]
Length=267

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 114/160 (71%), Gaps = 5/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+  +L +  F     +++ +DSFL+E LK+T  CTH HTCNPPGPD +HTH
Sbjct  5    MDDGEVELSDHALLLNQEFSGNFHNSASVDSFLDEFLKNTKTCTHTHTCNPPGPDAAHTH  64

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT+++   SEED   S+    SV K   +R  GNREAVRKYREKKKA  A LE+ 
Sbjct  65   TCYHTHTQVI--ASEEDN-HSNSKENSVSK--PRRSSGNREAVRKYREKKKAHTAYLEEE  119

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +L  LNQQL+++LQGQA+LEAE  RL+ LL D RG+I+
Sbjct  120  VKKLHTLNQQLVRKLQGQAILEAEFLRLRSLLADFRGKID  159



>ref|XP_009354398.1| PREDICTED: transcription factor TGA3 [Pyrus x bretschneideri]
 ref|XP_009354399.1| PREDICTED: transcription factor TGA3 [Pyrus x bretschneideri]
Length=245

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 101/147 (69%), Gaps = 11/147 (7%)
 Frame = +3

Query  138  MEDGELEFSNQEML----SSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDN  305
            M+DGE+  S+  +L    SSSNF      ++Y D+F +E LK    CTH HTCNPPGP+ 
Sbjct  1    MDDGEVVTSDHALLPNPNSSSNF----HGSTYEDTFFDEFLKTARTCTHTHTCNPPGPEA  56

Query  306  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  485
            +HTHTCYH HT+++P+   ED   + +   S  +  ++R  GN+EAVRKYREKKKA  A 
Sbjct  57   AHTHTCYHTHTQVLPS---EDDDGTKNKEHSNLRPRRRRSSGNKEAVRKYREKKKAHTAY  113

Query  486  LEDGVVRLRALNQQLLKRLQGQAVLEA  566
            LED V +L+ LNQQL+++LQGQA+LEA
Sbjct  114  LEDEVKKLQVLNQQLVRKLQGQAILEA  140



>ref|XP_010694687.1| PREDICTED: GATA zinc finger domain-containing protein 4-like 
[Beta vulgaris subsp. vulgaris]
Length=275

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 100/161 (62%), Gaps = 7/161 (4%)
 Frame = +3

Query  153  LEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKD-THACTHAHTCNPPGPD-NSHTHTCY  326
            L FSNQE   S N  + P++ S + + L++IL+D        +T   PG D  + TH   
Sbjct  38   LNFSNQEFFPSPNLGDVPNAES-LGNILDDILQDHADGSNDTNTIQHPGQDLTNDTHDYL  96

Query  327  HVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPL----GNreavrkyrekkkaraaLLED  494
             ++ +++  P+EE  + +DD+ +  +++  KR       NREAVRKYREK K R A LED
Sbjct  97   RLYAEMLSPPTEEKSSDNDDSTQIEEQRANKRGRTDRGDNREAVRKYREKLKTREAALED  156

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             +  L+ LNQQLLK+L+G+A ++AE+  LK LLVDIRGRIE
Sbjct  157  EIKELKTLNQQLLKKLEGEAAMQAEIYWLKSLLVDIRGRIE  197



>ref|XP_006644854.1| PREDICTED: uncharacterized protein LOC102712588 [Oryza brachyantha]
Length=224

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 92/129 (71%), Gaps = 10/129 (8%)
 Frame = +3

Query  234  LNEILKDTHACTHAHTCNPPGPDNS-HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKK  410
             +EILK+T  CTH+HTCNPPGP  + HTHTC H H +++        A  ++  E  D +
Sbjct  24   FDEILKNTTTCTHSHTCNPPGPSVAMHTHTCLHTHIQVL--------ASGENNVEE-DLR  74

Query  411  EKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCL  590
            + ++PLGNREAVRKYREKKKA AA LE+ V +LR  NQQLL+RLQG   LEAEV RL+ L
Sbjct  75   KTRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRTTNQQLLRRLQGHISLEAEVVRLRAL  134

Query  591  LVDIRGRIE  617
            L DIRG+I+
Sbjct  135  LFDIRGKID  143



>ref|XP_010232460.1| PREDICTED: uncharacterized protein LOC100829391 [Brachypodium 
distachyon]
 ref|XP_003567206.2| PREDICTED: uncharacterized protein LOC100829391 [Brachypodium 
distachyon]
Length=238

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 89/145 (61%), Gaps = 18/145 (12%)
 Frame = +3

Query  201  FPDSNSYMDSFLNEILKDTHA---CTHAHTCN--PPGPDNS-HTHTCYHVHTKIVPAPSE  362
            FP    +   F +E L +T A   CTH HTCN  P  P  + HTHTC H HT+++ +  +
Sbjct  35   FPHPEIFSHGF-DEFLMNTTAIPTCTHTHTCNNAPSSPLVAMHTHTCLHRHTQVLASAEQ  93

Query  363  EDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRL  542
            E + P              +PLGNREAVRKYREKKKA AA LE+ V  LRA NQQLL+RL
Sbjct  94   EPRNP-----------RVIKPLGNREAVRKYREKKKAHAAFLEEEVRSLRAANQQLLRRL  142

Query  543  QGQAVLEAEVARLKCLLVDIRGRIE  617
            QG A LEAEV RL  LL D+R +I+
Sbjct  143  QGHAALEAEVVRLTSLLFDVRAKID  167



>ref|XP_011042101.1| PREDICTED: uncharacterized protein LOC105137881 isoform X1 [Populus 
euphratica]
 ref|XP_011042102.1| PREDICTED: uncharacterized protein LOC105137881 isoform X1 [Populus 
euphratica]
Length=234

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 113/163 (69%), Gaps = 12/163 (7%)
 Frame = +3

Query  135  KMEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  314
            KM+DGE+E S+  +L           +  +DS L+E+LK+T  CTH HTCNPPGPD  HT
Sbjct  5    KMDDGEVEVSDHVLLPDPGASGSLQCSGSVDSLLDELLKNTRTCTHTHTCNPPGPDAIHT  64

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGNreavrkyrekkkaraaLL  488
            HTCYH HT+++   SEED  P        D +E  +KRP GNREAVRKYREKKKA  A L
Sbjct  65   HTCYHTHTQVI--ASEEDVNP--------DNREHSRKRPAGNREAVRKYREKKKAHTAYL  114

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            E+ + +L  LNQQL+K++Q QA+LEAEV RL+ +LVD+RG+I+
Sbjct  115  EEEIKKLHLLNQQLVKKIQRQAILEAEVLRLRSILVDLRGKID  157



>gb|AEX11140.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11141.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11143.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11145.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11146.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11148.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11149.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11150.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11151.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11152.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11153.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11154.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
Length=135

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +3

Query  282  CNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyre  461
            CNPPG D  HTHTCYH HT+     S E +     T ES+ K  +KRP GNREAV+KYRE
Sbjct  10   CNPPGRDKPHTHTCYHSHTQFF---STEQEDQLGGTPESLAK--RKRPSGNREAVKKYRE  64

Query  462  kkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            K+KA  A LED V +LR+LNQQL +++Q Q  LEAE  RL+ +L + +G+I+
Sbjct  65   KQKAHTAYLEDKVQKLRSLNQQLWRKVQDQVALEAEAERLRSILFEFKGKID  116



>ref|XP_010279543.1| PREDICTED: uncharacterized protein LOC104613430 [Nelumbo nucifera]
Length=300

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 114/160 (71%), Gaps = 5/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+Q +L           ++ +D+FL+E  K T  CTH HTCNPPG D +HTH
Sbjct  29   MDDGEVEVSDQVLLPDIYAAGDIQGSTSVDNFLDEFSKITRTCTHTHTCNPPGHDAAHTH  88

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TC+H HT++    SEED  P +   +SV K   +RP GNREAVRKYREKKKA+ A LE+ 
Sbjct  89   TCFHTHTQVF--ASEEDDTP-NHKQQSVTK--SRRPSGNREAVRKYREKKKAQTAYLEEE  143

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +LR LNQQL+++LQGQA+LE EV RLK LL+D+RG+I+
Sbjct  144  VKKLRLLNQQLIRKLQGQAILETEVLRLKTLLIDLRGKID  183



>gb|AEX11155.1| hypothetical protein 0_12104_01, partial [Pinus radiata]
Length=135

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +3

Query  282  CNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyre  461
            CNPPG D  HTHTCYH HT+     S E +     T ES+ K  +KRP GNREAV+KYRE
Sbjct  10   CNPPGRDKPHTHTCYHSHTQFF---STEQEDQLGGTPESLAK--RKRPSGNREAVKKYRE  64

Query  462  kkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            K+KA  A LED V +LR+LNQQL +++Q Q  LEAE  RL+ +L + +G+I+
Sbjct  65   KQKAHTAYLEDKVQKLRSLNQQLWRKVQDQVALEAEAERLRSILFEFKGKID  116



>gb|AEX11142.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
 gb|AEX11147.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
Length=135

 Score = 86.7 bits (213),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +3

Query  282  CNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyre  461
            CNPPG D  HTHTCYH HT+      E+    + D+       ++KRP GNREAV+KYRE
Sbjct  10   CNPPGRDKPHTHTCYHSHTQFFSTEQEDQLGGTPDSLA-----KRKRPSGNREAVKKYRE  64

Query  462  kkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            K+KA  A LED V +LR+LNQQL +++Q Q  LEAE  RL+ +L + +G+I+
Sbjct  65   KQKAHTAYLEDKVQKLRSLNQQLWRKVQDQVALEAEAERLRSILFEFKGKID  116



>gb|AEX11144.1| hypothetical protein 0_12104_01, partial [Pinus taeda]
Length=135

 Score = 86.3 bits (212),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 77/112 (69%), Gaps = 5/112 (4%)
 Frame = +3

Query  282  CNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyre  461
            CNPPG D  HTHTCYH HT+     S E +     T +S+ K  +KRP GNREAV+KYRE
Sbjct  10   CNPPGRDKPHTHTCYHSHTQFF---STEQEDQLGGTPQSLAK--RKRPSGNREAVKKYRE  64

Query  462  kkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            K+KA  A LED V +LR+LNQQL +++Q Q  LEAE  RL+ +L + +G+I+
Sbjct  65   KQKAHTAYLEDKVQKLRSLNQQLWRKVQDQVALEAEAERLRSILFEFKGKID  116



>ref|XP_011042103.1| PREDICTED: uncharacterized protein LOC105137881 isoform X2 [Populus 
euphratica]
Length=229

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 112/162 (69%), Gaps = 12/162 (7%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+  +L           +  +DS L+E+LK+T  CTH HTCNPPGPD  HTH
Sbjct  1    MDDGEVEVSDHVLLPDPGASGSLQCSGSVDSLLDELLKNTRTCTHTHTCNPPGPDAIHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGNreavrkyrekkkaraaLLE  491
            TCYH HT+++   SEED  P        D +E  +KRP GNREAVRKYREKKKA  A LE
Sbjct  61   TCYHTHTQVI--ASEEDVNP--------DNREHSRKRPAGNREAVRKYREKKKAHTAYLE  110

Query  492  DGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            + + +L  LNQQL+K++Q QA+LEAEV RL+ +LVD+RG+I+
Sbjct  111  EEIKKLHLLNQQLVKKIQRQAILEAEVLRLRSILVDLRGKID  152



>ref|XP_007008741.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007008742.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17551.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17552.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
Length=245

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 117/166 (70%), Gaps = 17/166 (10%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYM------DSFLNEILKDTHACTHAHTCNPPGP  299
            M+DGE+E S+  +LS+      PDS+S +      D  ++E  K+T  CTH HTCNPPGP
Sbjct  1    MDDGEVELSDHVLLSN------PDSSSNLLDSTSVDLIIDEFFKNTRTCTHTHTCNPPGP  54

Query  300  DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkara  479
            D +HTHTCYH HT+++   SEED   ++  + S+   + +RP GNREAVRKYREKKKA  
Sbjct  55   DTAHTHTCYHTHTQVI--TSEEDDHQNNKNSSSL---KPRRPSGNREAVRKYREKKKAHT  109

Query  480  aLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            A LE+ V +LR LNQQL+++LQGQ +LEAEV RL+ LLVD+R +I+
Sbjct  110  AYLEEEVKKLRLLNQQLVRKLQGQTILEAEVLRLRSLLVDLRAKID  155



>ref|XP_010269693.1| PREDICTED: uncharacterized protein LOC104606282 [Nelumbo nucifera]
Length=285

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 112/160 (70%), Gaps = 5/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DG ++ S+Q   S+ +       ++ +D  L+EILK T  CTH HTCN PGPD +HTH
Sbjct  14   MDDGGVDTSDQVFPSNPDVSTDIQGSTSLDVLLDEILKSTRTCTHTHTCNLPGPDAAHTH  73

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT++    SEED  P +   +SV K   KR  GNREAVRKYR KKKA  A LE+ 
Sbjct  74   TCYHTHTQVF--ASEEDDTP-NHKQQSVTK--SKRSSGNREAVRKYRAKKKAHTAYLEEE  128

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +LR LNQQL++RLQGQA+LEAEV RL+ LL+D+RG+I+
Sbjct  129  VKKLRLLNQQLIRRLQGQAMLEAEVLRLRSLLIDLRGKID  168



>ref|XP_009117143.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103842271 
[Brassica rapa]
Length=163

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 82/119 (69%), Gaps = 14/119 (12%)
 Frame = +3

Query  267  THAHTCNPPGPDN-SHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPLGNre  440
            +H H+CNPPG D+ SH+HTC+H HT  I+P P E D +            + KR  GNRE
Sbjct  17   SHTHSCNPPGRDDASHSHTCFHTHTHLIIPDPQENDNS------------DXKRSCGNRE  64

Query  441  avrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            A RKYREKKKAR A LED V RL++LN+ LL++LQ Q ++E E+ +L+ LLV+++ +I+
Sbjct  65   AARKYREKKKARTAYLEDEVKRLQSLNEYLLRKLQSQRMVETEIIKLRALLVEMQVKID  123



>ref|XP_002303896.2| hypothetical protein POPTR_0003s20320g [Populus trichocarpa]
 gb|ABK94687.1| unknown [Populus trichocarpa]
 gb|EEE78875.2| hypothetical protein POPTR_0003s20320g [Populus trichocarpa]
Length=237

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 113/163 (69%), Gaps = 12/163 (7%)
 Frame = +3

Query  135  KMEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  314
            +M+DGE+E S+  +L           +  +DS L+E+LK+T  CTH HTCNP GPD  HT
Sbjct  5    RMDDGEVELSDHVLLPDPGTSGSLQCSGSVDSLLDELLKNTRTCTHTHTCNPHGPDAIHT  64

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGNreavrkyrekkkaraaLL  488
            HTCYH HT+++   SEED  P        D +E  +KRP GNREAVRKYREKKKA  A L
Sbjct  65   HTCYHTHTQVI--ASEEDDNP--------DNREHSRKRPAGNREAVRKYREKKKAHTAYL  114

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            E+ V +L  LNQQL++++Q QA+LEAEV+RL+ +LVD+RG+I+
Sbjct  115  EEEVKKLHLLNQQLVRKIQRQAILEAEVSRLRSILVDLRGKID  157



>ref|XP_004303083.1| PREDICTED: uncharacterized protein LOC101298723 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466840.1| PREDICTED: uncharacterized protein LOC101298723 [Fragaria vesca 
subsp. vesca]
 ref|XP_011466841.1| PREDICTED: uncharacterized protein LOC101298723 [Fragaria vesca 
subsp. vesca]
Length=255

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 103/160 (64%), Gaps = 11/160 (7%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E  +  ++        P SNS  +      +     C H HTCN PGPD +HTH
Sbjct  1    MDDGEVETLDHAVI--------PKSNSSGNFHTPTSIDTLRTCLHTHTCNLPGPDAAHTH  52

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT+++P+   +     +D    V K +++RP GNREAVRKYREKKKA  A LE+ 
Sbjct  53   TCYHTHTQVLPSEENDGDHSKEDL---VLKPKRRRPSGNREAVRKYREKKKAHTAYLEEE  109

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +L+ LNQQL+++LQGQA LEAE  RL+ LL+D RG+I+
Sbjct  110  VKKLQLLNQQLVRKLQGQASLEAEFLRLRNLLLDFRGKID  149



>ref|NP_001237285.1| uncharacterized protein LOC100527780 [Glycine max]
 gb|ACU16954.1| unknown [Glycine max]
Length=199

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 88/118 (75%), Gaps = 9/118 (8%)
 Frame = +3

Query  264  CTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNrea  443
            CTH HTCNPPGPD +HTHTCYH HT++         AP DD  +  + K+ KRP GNREA
Sbjct  37   CTHTHTCNPPGPDAAHTHTCYHTHTQVF--------APEDDGRKHSNSKQ-KRPSGNREA  87

Query  444  vrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VRKYREKKKA  A LE+ V +L  +NQQL+++LQGQA+LEAE+ARL+ +L  ++G+I+
Sbjct  88   VRKYREKKKAHTAYLEEEVKKLHMVNQQLVRKLQGQALLEAELARLRSILARLKGKID  145



>gb|EYU42976.1| hypothetical protein MIMGU_mgv1a023968mg [Erythranthe guttata]
Length=175

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 104/166 (63%), Gaps = 17/166 (10%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSN--FCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSH  311
            M+DGE++ SN     SS      F + +S++D+ L+ I  +   CTH H CNPPGPD  H
Sbjct  1    MDDGEIDLSNLPNPDSSRNIRASFSEDSSFLDN-LSRI--NAQVCTHTHICNPPGPDAPH  57

Query  312  THTCYHVHTKIVPAPSEEDKAPSDDTA----ESVDKKEKKRPLGNreavrkyrekkkara  479
            THTC+H HT  +P+        SDD A     +   K   RPLGNREAVRKYREKKKA+ 
Sbjct  58   THTCHHTHTNFIPS--------SDDIALHEKRTPVSKPSSRPLGNREAVRKYREKKKAQE  109

Query  480  aLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            A LE+ V +LR  N+ L+ +LQ   VLE EV RL+ LLV+IRG+I+
Sbjct  110  AYLEEEVRKLRDANKLLVAKLQRGPVLETEVLRLRRLLVEIRGKID  155



>gb|KHN22064.1| hypothetical protein glysoja_008976 [Glycine soja]
Length=240

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 88/118 (75%), Gaps = 9/118 (8%)
 Frame = +3

Query  264  CTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNrea  443
            CTH HTCNPPGPD +HTHTCYH HT++         AP DD  +  + K+ KRP GNREA
Sbjct  37   CTHTHTCNPPGPDAAHTHTCYHTHTQVF--------APEDDGRKHSNSKQ-KRPSGNREA  87

Query  444  vrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            VRKYREKKKA  A LE+ V +L  +NQQL+++LQGQA+LEAE+ARL+ +L  ++G+I+
Sbjct  88   VRKYREKKKAHTAYLEEEVKKLHMVNQQLVRKLQGQALLEAELARLRSILARLKGKID  145



>gb|EMS52399.1| hypothetical protein TRIUR3_11502 [Triticum urartu]
Length=259

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 84/166 (51%), Gaps = 49/166 (30%)
 Frame = +3

Query  129  ISKMEDGELEFSNQE-MLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGP  299
            ++ M+DG+L+FSN E  L S    + P     MDS+ + IL DT   ACTH HTCNPP  
Sbjct  23   VAAMDDGDLDFSNPEAYLCSDTGADLPGGGCSMDSYFDGILNDTEHLACTHTHTCNPP--  80

Query  300  DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkara  479
                                       DDT     +K+K                     
Sbjct  81   --------------------------VDDTVRKYREKKKAH------------------T  96

Query  480  aLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            ALLE+ VV+L+ALN+QLLK+LQ  A LEAE ARL+CLLVDIRGRI+
Sbjct  97   ALLEEEVVQLKALNKQLLKKLQNHAALEAEAARLRCLLVDIRGRID  142



>emb|CAN72907.1| hypothetical protein VITISV_033868 [Vitis vinifera]
Length=260

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 119/160 (74%), Gaps = 5/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+  +LS+ N       ++ +DSFL++ LK+T  CTH HTCNPPGPD +HTH
Sbjct  1    MDDGEVELSDHVLLSNPNSSSNFQGSTPIDSFLDDFLKNTRTCTHTHTCNPPGPDAAHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT++    SEED+ P ++    + K   +RP GNREAVRKYREKKKA  A LE+ 
Sbjct  61   TCYHTHTQVF--ASEEDEVP-NNKEHXISK--VRRPSGNREAVRKYREKKKAHTAYLEEE  115

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +LR LNQQL+K+LQGQAVLEAEV RL+ LL+D+RG+I+
Sbjct  116  VKKLRLLNQQLVKKLQGQAVLEAEVLRLRSLLLDLRGKID  155



>gb|EEE52735.1| hypothetical protein OsJ_35154 [Oryza sativa Japonica Group]
Length=226

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 97/159 (61%), Gaps = 14/159 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+Q M  +      P+  + +D FL  I       TH HTCNPPGP  +   
Sbjct  1    MDDGEIELSSQMMFPN------PEIPTSLDDFLPSIRTTC---THTHTCNPPGPSATEHT  51

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
               +     V   S +D +   D A+    K+ ++PLGNREAVRKYR+KKKA  A LE+ 
Sbjct  52   HTCYHTHTRVF--SSDDDSCGGDKAKP---KKSRKPLGNREAVRKYRQKKKAHTAHLEEE  106

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRI  614
            V RLR +NQQL+KRLQGQA LE EV RL+ LLVD+R RI
Sbjct  107  VKRLRVINQQLVKRLQGQAALEVEVVRLRSLLVDVRSRI  145



>ref|XP_003633543.1| PREDICTED: uncharacterized protein LOC100255414 [Vitis vinifera]
 ref|XP_010659259.1| PREDICTED: uncharacterized protein LOC100255414 [Vitis vinifera]
 ref|XP_010659260.1| PREDICTED: uncharacterized protein LOC100255414 [Vitis vinifera]
Length=260

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 120/160 (75%), Gaps = 5/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+  +LS+ N       ++ +DSFL++ LK+T  CTH HTCNPPGPD +HTH
Sbjct  1    MDDGEVELSDHVLLSNPNSSSNFQGSTPIDSFLDDFLKNTRTCTHTHTCNPPGPDAAHTH  60

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT++    SEED+ P++   E +  K  +RP GNREAVRKYREKKKA  A LE+ 
Sbjct  61   TCYHTHTQVF--ASEEDEVPNN--KEHLISK-VRRPSGNREAVRKYREKKKAHTAYLEEE  115

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +LR LNQQL+K+LQGQAVLEAEV RL+ LL+D+RG+I+
Sbjct  116  VKKLRLLNQQLVKKLQGQAVLEAEVLRLRSLLLDLRGKID  155



>ref|XP_006664845.1| PREDICTED: uncharacterized protein LOC102716091 [Oryza brachyantha]
 emb|CBX25258.1| hypothetical_protein [Oryza brachyantha]
Length=185

 Score = 80.1 bits (196),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 99/159 (62%), Gaps = 14/159 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+Q M  +      P++ + +D F+  I      CTH HTCNPPGP  S   
Sbjct  1    MDDGEIELSSQMMFPN------PETPTSLDDFMPSI---RTTCTHTHTCNPPGP--SAIT  49

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
              +  +       S +D +  DD  +   +K+  +PLGNREAVRKYR+KKKA  A LE+ 
Sbjct  50   HTHTCYHTHTQVLSTDDDSCGDDKTK---RKKASKPLGNREAVRKYRQKKKAHTAQLEEE  106

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRI  614
            V +LRA+NQQL+KRLQGQ  LEAEV  L+ LLVD+R +I
Sbjct  107  VKKLRAINQQLVKRLQGQDALEAEVVWLRSLLVDVRAKI  145



>gb|KHN25468.1| hypothetical protein glysoja_010385 [Glycine soja]
Length=247

 Score = 80.1 bits (196),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 78/109 (72%), Gaps = 5/109 (5%)
 Frame = +3

Query  306  SHTHTCYHVHTKI-VPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraa  482
            S T T     T++ +PAP       + ++AE      KKR LGN+EAVRKYREKKKARAA
Sbjct  35   SRTRTPAPTPTRVTLPAPISPTLTRATESAEKKSSSSKKRSLGNKEAVRKYREKKKARAA  94

Query  483  LLEDGVVRLRALNQQLLKRLQGQAV----LEAEVARLKCLLVDIRGRIE  617
             LED VV+LRALNQ L+K+L+GQA     LEAE+ARLKCLLVDIRGRIE
Sbjct  95   SLEDEVVKLRALNQHLMKKLKGQAAGQAALEAEIARLKCLLVDIRGRIE  143



>ref|XP_006663805.1| PREDICTED: uncharacterized protein LOC102722911 [Oryza brachyantha]
 emb|CBX25355.1| hypothetical_protein [Oryza brachyantha]
Length=185

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 99/159 (62%), Gaps = 14/159 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+Q M  +      P++ + +D F+  I      CTH HTCN PGP  S T 
Sbjct  1    MDDGEIELSSQMMFPN------PETPTSLDDFMPSI---RTTCTHTHTCNAPGP--SATA  49

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
              +  +       S +D +  DD      +K+  +PLGNREAVRKYR+KKKA  A LE+ 
Sbjct  50   HTHTCYHTHTQVLSTDDDSCGDDKTR---RKKASKPLGNREAVRKYRQKKKAHTAQLEEE  106

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRI  614
            V +LRA+NQQL+KRLQGQ  LEAEV RL+ LLVD+R +I
Sbjct  107  VKKLRAINQQLVKRLQGQDALEAEVVRLRSLLVDVRAKI  145



>ref|XP_011037808.1| PREDICTED: uncharacterized protein LOC105134916 [Populus euphratica]
 ref|XP_011037809.1| PREDICTED: uncharacterized protein LOC105134916 [Populus euphratica]
Length=266

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 113/160 (71%), Gaps = 5/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+  +L + +      S++ +DS L+E LK+T  CTH HTCNP GPD +HTH
Sbjct  6    MDDGEIELSDHVLLPNPDSSGILQSSASVDSLLDEFLKNTRTCTHTHTCNPLGPDITHTH  65

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT+++ +  E+D   + + + S    + KRP GNREAVRKYREKKKA  A LE+ 
Sbjct  66   TCYHTHTQVITS-EEDDHVNNREHSNS----KAKRPAGNREAVRKYREKKKAHTAYLEEE  120

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +LR  NQQL++++Q Q +LEAEV RL+ +L+ +RG+I+
Sbjct  121  VKKLRISNQQLVRKIQQQVILEAEVLRLRSILMGLRGKID  160



>ref|XP_002299223.2| hypothetical protein POPTR_0001s05750g [Populus trichocarpa]
 gb|EEE84028.2| hypothetical protein POPTR_0001s05750g [Populus trichocarpa]
Length=266

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 5/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+  +L + +      S++ +DS L+E LK+T  CTH HTCNP GPD +HTH
Sbjct  6    MDDGEIELSDHVLLPNPDSSGSLQSSASVDSLLDEFLKNTRTCTHTHTCNPLGPDITHTH  65

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT+++ +  ++D    + +   V     KRP GNREAVRKYR+KKKA  A LE+ 
Sbjct  66   TCYHTHTQVITSEEDDDVNNREHSNSKV-----KRPAGNREAVRKYRQKKKAHTAYLEEE  120

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +LR  NQQL++++Q Q +LEAEV RL+ +L+ +RG+I+
Sbjct  121  VKKLRISNQQLVRKIQQQVILEAEVLRLRSILMGLRGKID  160



>dbj|BAJ85954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=199

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 100/166 (60%), Gaps = 21/166 (13%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMD-SFLNEILKDTHACTHAHTCNPPGPDNSHT  314
            M+DG+L+FS+                SY D   L +  +    CTH HTCNPP   +   
Sbjct  1    MDDGDLDFSSM--------------GSYFDLDVLGDTAEHLARCTHTHTCNPPAHHHHPH  46

Query  315  HT-CYHVHTKIVPAPSEEDKA---PSD-DTAESVDKKEKKRPLGNreavrkyrekkkara  479
               C HVH+K  PAP+  D     P++ + A +  + +++RP GNR AVRKYREKKK   
Sbjct  47   THTCLHVHSKF-PAPASPDAGAETPAEFEDAHATSRTKRRRPSGNRAAVRKYREKKKEHT  105

Query  480  aLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            A+L++   RLRALN QL++++Q  A LEAE ARL+CLLVD+RGRIE
Sbjct  106  AVLQEEAARLRALNDQLVRKVQDHAALEAEAARLRCLLVDVRGRIE  151



>ref|NP_001055929.1| Os05g0495200 [Oryza sativa Japonica Group]
 gb|AAU44046.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17843.1| Os05g0495200 [Oryza sativa Japonica Group]
 dbj|BAG92906.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97063.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE62453.1| hypothetical protein OsJ_17245 [Oryza sativa Japonica Group]
Length=224

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 87/140 (62%), Gaps = 13/140 (9%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            E PDS    D FLN I      CTH HTCNPPGP  +            V A    +   
Sbjct  14   EVPDS---FDDFLNNI----TTCTHTHTCNPPGPSATMHTHTCLHTHTQVFASGSGE---  63

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
             DD  E + K   +RPLGNREAVRKYREKKKA AA LE+ V +LRA NQQLLKRLQG A 
Sbjct  64   -DDIKEDLTKT--RRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLKRLQGHAA  120

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LEAEV RL+ +L+D+RG+I+
Sbjct  121  LEAEVIRLRSILLDVRGKID  140



>ref|XP_006368575.1| hypothetical protein POPTR_0001s05750g [Populus trichocarpa]
 gb|ERP65144.1| hypothetical protein POPTR_0001s05750g [Populus trichocarpa]
Length=253

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 111/160 (69%), Gaps = 5/160 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE+E S+  +L + +      S++ +DS L+E LK+T  CTH HTCNP GPD +HTH
Sbjct  6    MDDGEIELSDHVLLPNPDSSGSLQSSASVDSLLDEFLKNTRTCTHTHTCNPLGPDITHTH  65

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
            TCYH HT+++ +  ++D    + +   V     KRP GNREAVRKYR+KKKA  A LE+ 
Sbjct  66   TCYHTHTQVITSEEDDDVNNREHSNSKV-----KRPAGNREAVRKYRQKKKAHTAYLEEE  120

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +LR  NQQL++++Q Q +LEAEV RL+ +L+ +RG+I+
Sbjct  121  VKKLRISNQQLVRKIQQQVILEAEVLRLRSILMGLRGKID  160



>gb|EAY98546.1| hypothetical protein OsI_20459 [Oryza sativa Indica Group]
Length=223

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 87/140 (62%), Gaps = 13/140 (9%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            E PDS    D FLN I      CTH HTCNPPGP  +            V A    +   
Sbjct  14   EVPDS---FDDFLNNI----TTCTHTHTCNPPGPSATMHTHTCLHTHTQVFASGSGE---  63

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
             DD  E + K   +RPLGNREAVRKYREKKKA AA LE+ V +LRA NQQLLKRLQG A 
Sbjct  64   -DDIKEDLTKT--RRPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLKRLQGHAA  120

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LEAEV RL+ +L+D+RG+I+
Sbjct  121  LEAEVIRLRSILLDVRGKID  140



>ref|XP_002456496.1| hypothetical protein SORBIDRAFT_03g037300 [Sorghum bicolor]
 gb|EES01616.1| hypothetical protein SORBIDRAFT_03g037300 [Sorghum bicolor]
Length=176

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 13/103 (13%)
 Frame = +3

Query  309  HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  488
            HTH C H H + + + SEE + P             ++PLGNREAVRKYREKKKA AA L
Sbjct  2    HTHRCLHTHRQFIASSSEELRTP-------------RKPLGNREAVRKYREKKKAHAAFL  48

Query  489  EDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            E+ V +LRA NQ LL+RLQ  A LEAEV RL+ LL D++G+I+
Sbjct  49   EEEVKKLRATNQHLLRRLQRHAALEAEVVRLRGLLFDVQGKID  91



>ref|XP_008364717.1| PREDICTED: uncharacterized protein LOC103428389 [Malus domestica]
Length=245

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSN-FCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  314
            M+DG +  S+   L + N    FP S S +D+F +EIL +T  CTH HTCNPPGPD +HT
Sbjct  1    MDDGXVVASDHAXLPNPNCXSNFPGSTS-VDTFFDEIL-NTQTCTHTHTCNPPGPDAAHT  58

Query  315  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  494
            HTCYH HT+++   SE+D   S +   S+ K  ++RPLGNREAVRKYR+KKKA AA LE+
Sbjct  59   HTCYHTHTQVL--SSEDDDDDSKNKERSIXKPRRRRPLGNREAVRKYRDKKKAHAAYLEE  116

Query  495  GVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             + +L+ LNQQL+ ++Q QA LEAE  +LK L++++R  I+
Sbjct  117  EIRKLQVLNQQLVGKIQAQATLEAEFLKLKGLVLELRRMID  157



>ref|XP_006654590.1| PREDICTED: uncharacterized protein LOC102713546 [Oryza brachyantha]
Length=222

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 85/140 (61%), Gaps = 15/140 (11%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            E PDS    D FLN I      CTH HTCNP GP  +            + A  EED   
Sbjct  14   EVPDS---FDDFLNNI----TTCTHTHTCNPAGPSAATHTHTCLHTHTQLYASGEEDMKE  66

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
                    D  + +RPLGNREAVRKYREKKKA AA LE+ V +LRA NQQLL+RLQG A 
Sbjct  67   --------DLAKPRRPLGNREAVRKYREKKKAHAAFLEEEVKKLRATNQQLLRRLQGHAA  118

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LEAEV RL+ +L+D+RG+I+
Sbjct  119  LEAEVIRLRSILLDVRGKID  138



>ref|XP_003577077.2| PREDICTED: uncharacterized protein LOC100844010 [Brachypodium 
distachyon]
Length=234

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 12/160 (8%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M++GE++ S++ +  +      P++ + +D FL          TH HTCNPPGP  S   
Sbjct  1    MDEGEIDLSSEMLFPN------PETPTSIDDFLRNTTTTC---THTHTCNPPGPLASAHT  51

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
               H         S +D +   D    V  K+ + PLGNR AVRKYR+KKKA  A LE+ 
Sbjct  52   HTCHHTHSHSHVFSTDDDSCGSD---KVVPKKTREPLGNRVAVRKYRQKKKAHTAHLEEE  108

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V RLRA+NQQL+KRLQGQA L+AEV RL+ LLVD+R +I+
Sbjct  109  VRRLRAINQQLVKRLQGQAALKAEVVRLRTLLVDVRAKID  148



>ref|XP_007219551.1| hypothetical protein PRUPE_ppa019868mg [Prunus persica]
 gb|EMJ20750.1| hypothetical protein PRUPE_ppa019868mg [Prunus persica]
Length=217

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 103/140 (74%), Gaps = 3/140 (2%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            E   S+  +D+F++E LK+T  CTH HTCNPPGPD +HTHTCYH HT+++P+   ED   
Sbjct  5    EVGTSDQAVDTFVDEFLKNTRTCTHTHTCNPPGPDAAHTHTCYHTHTQVLPS---EDDDG  61

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
            + +   SV +  ++RP  NREAVRKYREKKKA  A LE+ V +LR LNQQL++++QGQA+
Sbjct  62   AKNKEHSVPRPRRRRPSRNREAVRKYREKKKAHTAYLEEEVKKLRLLNQQLVRKIQGQAI  121

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LE E  RLK + +D+RG+I+
Sbjct  122  LETEFLRLKSVFLDLRGKID  141



>ref|XP_008231529.1| PREDICTED: uncharacterized protein LOC103330700 isoform X2 [Prunus 
mume]
Length=153

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 103/140 (74%), Gaps = 3/140 (2%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            E   S+  +D+F++E LK+T  CTH HTCNPPGPD +HTHTCYH HT+++P+   ED   
Sbjct  5    EVGTSDQAVDTFVDEFLKNTRTCTHTHTCNPPGPDAAHTHTCYHTHTQVLPS---EDDDG  61

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
            + +   SV +  ++RP  NREAVRKYREKKKA  A LE+ V +LR LNQQL++++QGQA+
Sbjct  62   AKNKEHSVPRPRRRRPSRNREAVRKYREKKKAHTAYLEEEVKKLRLLNQQLVRKIQGQAI  121

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LE E  RL+ + +D+RG+I+
Sbjct  122  LETEFLRLRSVFLDLRGKID  141



>gb|EAY79873.1| hypothetical protein OsI_35035 [Oryza sativa Indica Group]
Length=1181

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +3

Query  378   SDDTAESVDK---KEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQG  548
             SDD +   DK   K+ ++PLGNREAVRKYR+KKKA  A LE+ V RLRA+NQQL+KRLQG
Sbjct  1019  SDDDSCGGDKAKPKKGRKPLGNREAVRKYRQKKKAHTAHLEEEVKRLRAINQQLVKRLQG  1078

Query  549   QAVLEAEVARLKCLLVDIRGRI  614
             QA LEAEV RL+ LLVD+R RI
Sbjct  1079  QAALEAEVVRLRSLLVDVRSRI  1100



>ref|XP_009395944.1| PREDICTED: uncharacterized protein LOC103981078 [Musa acuminata 
subsp. malaccensis]
Length=227

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 97/160 (61%), Gaps = 16/160 (10%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DG+++ S+  ++S       P+ N   D FL    + T  CTH HTCN PGP  +   
Sbjct  1    MDDGDVDLSSHLLVSD------PEINQSFDEFL----RSTSTCTHTHTCNLPGPAAATHT  50

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
               +     V A      A   ++    + K  ++PLGN+EAVRKYREKKKA AA LE+ 
Sbjct  51   HTCYHTHTQVFA------AGEGESVGEEEPKRYRKPLGNKEAVRKYREKKKAHAAFLEEE  104

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +LR +NQQLL+RLQGQA LEAEV RL+ LLVD RG+I+
Sbjct  105  VKKLRLVNQQLLRRLQGQAALEAEVIRLRNLLVDFRGKID  144



>gb|AFW82390.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=235

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 73/113 (65%), Gaps = 10/113 (9%)
 Frame = +3

Query  279  TCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyr  458
            +C+PPGP  +            V     ED    D +A+       +RPLGNREAVRKYR
Sbjct  40   SCDPPGPSAAMHTHTCLHTHTQVLGSGGED----DGSAK------PRRPLGNREAVRKYR  89

Query  459  ekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            EKKKARAA LE  V +LRA NQQL++RLQ  A LEAEVARL+ LL+D+RGRI+
Sbjct  90   EKKKARAAFLEGEVKKLRAANQQLVRRLQDHAALEAEVARLRGLLLDVRGRID  142



>ref|NP_001130683.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|ACF78997.1| unknown [Zea mays]
 gb|AFW82391.1| putative bZIP transcription factor superfamily protein [Zea mays]
 gb|AIB05090.1| bZIP transcription factor, partial [Zea mays]
Length=225

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 73/113 (65%), Gaps = 10/113 (9%)
 Frame = +3

Query  279  TCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyr  458
            +C+PPGP  +            V     ED    D +A+       +RPLGNREAVRKYR
Sbjct  40   SCDPPGPSAAMHTHTCLHTHTQVLGSGGED----DGSAKP------RRPLGNREAVRKYR  89

Query  459  ekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            EKKKARAA LE  V +LRA NQQL++RLQ  A LEAEVARL+ LL+D+RGRI+
Sbjct  90   EKKKARAAFLEGEVKKLRAANQQLVRRLQDHAALEAEVARLRGLLLDVRGRID  142



>ref|XP_008231525.1| PREDICTED: uncharacterized protein LOC103330700 isoform X1 [Prunus 
mume]
 ref|XP_008231526.1| PREDICTED: uncharacterized protein LOC103330700 isoform X1 [Prunus 
mume]
 ref|XP_008231527.1| PREDICTED: uncharacterized protein LOC103330700 isoform X1 [Prunus 
mume]
 ref|XP_008231528.1| PREDICTED: uncharacterized protein LOC103330700 isoform X1 [Prunus 
mume]
Length=244

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 103/140 (74%), Gaps = 3/140 (2%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            E   S+  +D+F++E LK+T  CTH HTCNPPGPD +HTHTCYH HT+++P+   ED   
Sbjct  5    EVGTSDQAVDTFVDEFLKNTRTCTHTHTCNPPGPDAAHTHTCYHTHTQVLPS---EDDDG  61

Query  378  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAV  557
            + +   SV +  ++RP  NREAVRKYREKKKA  A LE+ V +LR LNQQL++++QGQA+
Sbjct  62   AKNKEHSVPRPRRRRPSRNREAVRKYREKKKAHTAYLEEEVKKLRLLNQQLVRKIQGQAI  121

Query  558  LEAEVARLKCLLVDIRGRIE  617
            LE E  RL+ + +D+RG+I+
Sbjct  122  LETEFLRLRSVFLDLRGKID  141



>emb|CBI28617.3| unnamed protein product [Vitis vinifera]
Length=363

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 115/155 (74%), Gaps = 5/155 (3%)
 Frame = +3

Query  153  LEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHV  332
            +E S+  +LS+ N       ++ +DSFL++ LK+T  CTH HTCNPPGPD +HTHTCYH 
Sbjct  107  VELSDHVLLSNPNSSSNFQGSTPIDSFLDDFLKNTRTCTHTHTCNPPGPDAAHTHTCYHT  166

Query  333  HTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLR  512
            HT++    SEED+ P++   E +  K  +RP GNREAVRKYREKKKA  A LE+ V +LR
Sbjct  167  HTQVF--ASEEDEVPNNK--EHLISK-VRRPSGNREAVRKYREKKKAHTAYLEEEVKKLR  221

Query  513  ALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             LNQQL+K+LQGQAVLEAEV RL+ LL+D+RG+I+
Sbjct  222  LLNQQLVKKLQGQAVLEAEVLRLRSLLLDLRGKID  256



>ref|XP_008786882.1| PREDICTED: uncharacterized protein LOC103705064 [Phoenix dactylifera]
Length=213

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 87/136 (64%), Gaps = 12/136 (9%)
 Frame = +3

Query  213  NSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHT-KIVPAPSEEDKAPSDDT  389
            N  M +  +E L+ T  CTH HTCN PGP  +      +    ++ P    E+       
Sbjct  17   NPEMTNSFDEYLRKTRTCTHTHTCNSPGPAAATHTHTCYHTHTRMFPTAGGEE-------  69

Query  390  AESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAE  569
                ++K+ ++PLGNREAVRKYR+KKKA AA LE+ V +LR +NQQLL+RLQGQA LEAE
Sbjct  70   ----EQKKSQKPLGNREAVRKYRQKKKAHAAYLEEEVKKLRLVNQQLLRRLQGQAALEAE  125

Query  570  VARLKCLLVDIRGRIE  617
            V RL+ LLVD+R +I+
Sbjct  126  VVRLRSLLVDLRAKID  141



>ref|XP_002441312.1| hypothetical protein SORBIDRAFT_09g024290 [Sorghum bicolor]
 gb|EES19742.1| hypothetical protein SORBIDRAFT_09g024290 [Sorghum bicolor]
Length=217

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  417  KRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLV  596
            ++PLGNREAVRKYREKKKA AA LE+ V +LRA NQQLL+RLQG A LEAEVARL+ LL+
Sbjct  82   RKPLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLLRRLQGHAALEAEVARLRSLLL  141

Query  597  DIRGRIE  617
            D+RG+I+
Sbjct  142  DVRGKID  148



>gb|EAY82198.1| hypothetical protein OsI_37401 [Oryza sativa Indica Group]
Length=783

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 86/142 (61%), Gaps = 17/142 (12%)
 Frame = +3

Query  198  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  377
            E P S   +D FL  I      CTH HTCNPPGP  +      +     V +        
Sbjct  575  EIPTS---LDDFLPSI---RTTCTHTHTCNPPGPSATEHTHTCYHTHTRVFS--------  620

Query  378  SDDTAESVDK---KEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQG  548
            SDD +   DK   K+ ++PLGNREAVRKYR+KKKA  A LE+ V RLR +NQQL+KRLQG
Sbjct  621  SDDDSCGGDKAKPKKSRKPLGNREAVRKYRQKKKAHTAHLEEEVKRLRVINQQLVKRLQG  680

Query  549  QAVLEAEVARLKCLLVDIRGRI  614
            QA LE EV RL+ LLVD+R RI
Sbjct  681  QAALEVEVVRLRSLLVDVRSRI  702



>dbj|BAJ84101.1| RNA-dependent RNA polymerase, partial [Bat coronavirus M.ful/Japan/02/2010]
Length=108

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = +1

Query  169  RRCYPVRISANFQTVTPIWIAF*MKSSRILMHALMLTPATRLALITPTPTLVTMCTPK*Y  348
            +RC  V+I    Q V  +WIAF MK SRI M AL+ TPAT  ALI    TLV MCTPK Y
Sbjct  11   KRCSRVQIWVISQVVA-LWIAFSMKFSRIHMPALIPTPATHPALIYRIRTLVFMCTPKLY  69

Query  349  LLPVK-KIRPPVMILQNLWIRKKRNGLSAIGKLSASTGR  462
            L  ++  IR P+M L +L  R +RN    I K  AST R
Sbjct  70   LAQLRTTIRLPLMTLPSLPKRNQRNAHRVIVKQFASTER  108



>gb|EMS45371.1| hypothetical protein TRIUR3_18393 [Triticum urartu]
Length=178

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  417  KRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLV  596
            +RPLGNREAVRKYREKKKA AA LE+ V +LRA NQQL +RLQG A LEAEVARL+ LL 
Sbjct  21   RRPLGNREAVRKYREKKKAHAAFLEEEVKQLRAANQQLQRRLQGHATLEAEVARLRGLLF  80

Query  597  DIRGRIE  617
            D+R +I+
Sbjct  81   DVRAKID  87



>ref|XP_010931563.1| PREDICTED: uncharacterized protein LOC105052451 [Elaeis guineensis]
Length=225

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 85/135 (63%), Gaps = 6/135 (4%)
 Frame = +3

Query  213  NSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTA  392
            N  M +  +E  + T  CTH HTCNPPGP  +      +     + A +       ++  
Sbjct  16   NPEMSNTFDEFFRKTRTCTHTHTCNPPGPAAATHTHTCYHTHTQMFATA------EEERE  69

Query  393  ESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEV  572
               ++K+ ++P GNREAVRKYREKKKA  A LE+ V +LR +NQQLL+RLQGQA LEAEV
Sbjct  70   GEKEQKKPRKPFGNREAVRKYREKKKAHVAYLEEEVKKLRLVNQQLLRRLQGQAALEAEV  129

Query  573  ARLKCLLVDIRGRIE  617
             RL+ LLVD+R +I+
Sbjct  130  VRLRSLLVDLRAKID  144



>gb|EAZ13857.1| hypothetical protein OsJ_03780 [Oryza sativa Japonica Group]
Length=163

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +3

Query  408  KEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKC  587
            ++ ++PLGNREAVRKYREKKKA AA LE+ V +LR  NQQLL+RLQG   LEAEV RL+ 
Sbjct  13   RKTRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRTTNQQLLRRLQGHISLEAEVVRLRA  72

Query  588  LLVDIRGRIE  617
            LL DIRG+I+
Sbjct  73   LLFDIRGKID  82



>gb|EAY76169.1| hypothetical protein OsI_04102 [Oryza sativa Indica Group]
Length=163

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = +3

Query  408  KEKKRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKC  587
            ++ ++PLGNREAVRKYREKKKA AA LE+ V +LR  NQQLL+RLQG   LEAEV RL+ 
Sbjct  13   RKTRKPLGNREAVRKYREKKKAHAAFLEEEVKKLRTTNQQLLRRLQGHISLEAEVVRLRA  72

Query  588  LLVDIRGRIE  617
            LL DIRG+I+
Sbjct  73   LLFDIRGKID  82



>ref|XP_004961638.1| PREDICTED: uncharacterized protein LOC101767291 [Setaria italica]
Length=228

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/67 (69%), Positives = 57/67 (85%), Gaps = 0/67 (0%)
 Frame = +3

Query  417  KRPLGNreavrkyrekkkaraaLLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLV  596
            ++PLGNR AVRKYREKKKA AA LE+ V +LRA NQQLL+R+Q  AVLEAEV RL+ LL+
Sbjct  79   RKPLGNRVAVRKYREKKKAHAAFLEEEVKKLRAANQQLLRRVQDHAVLEAEVVRLRTLLL  138

Query  597  DIRGRIE  617
            D+RG+I+
Sbjct  139  DVRGKID  145



>ref|XP_010692028.1| PREDICTED: uncharacterized protein LOC104905249 [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 107/165 (65%), Gaps = 11/165 (7%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSN-----SYMDSFLNEILKDTHACTHAHTCNPPGPD  302
            M++GE E ++   L +S+     +       + +D  L++ LK T  CTH HTCNPPGPD
Sbjct  1    MDEGEAEPADPAFLQTSSPANSTNDTVSGGLTSVDYILDQFLKHTKTCTHTHTCNPPGPD  60

Query  303  NSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraa  482
             +HTHTCYH HT+++   SEED     DT+      + ++ LGNREAVRKYREKKKA  A
Sbjct  61   AAHTHTCYHTHTQLI--SSEEDVKNRCDTS----SLKPRKSLGNREAVRKYREKKKAHTA  114

Query  483  LLEDGVVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
             LE+ V +LR +NQ L+ +LQ QA+ EAE+ RL+ LL+  RG+I+
Sbjct  115  YLEEEVKKLRLVNQDLVGKLQNQAIFEAEILRLRGLLIHFRGKID  159



>gb|ABP88241.1| transcription factor bZIP120, partial [Glycine max]
Length=118

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/26 (88%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  540  LQGQAVLEAEVARLKCLLVDIRGRIE  617
            L+GQA LEAE+ARLKCLLVDIRGRIE
Sbjct  1    LKGQAALEAEIARLKCLLVDIRGRIE  26



>ref|XP_009395145.1| PREDICTED: uncharacterized protein LOC103980446 [Musa acuminata 
subsp. malaccensis]
Length=204

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 78/160 (49%), Positives = 97/160 (61%), Gaps = 15/160 (9%)
 Frame = +3

Query  138  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  317
            M+DGE++ S+  +L S            M    +E L+ T  CTH HTCNPPGP  +   
Sbjct  1    MDDGEVDLSSHLLLPSPE----------MTQSFDEFLRRTTTCTHTHTCNPPGPAAAAHT  50

Query  318  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  497
               +     V A  EE+        E    K ++RPLGNREAVRKYREKKKA AA LE+ 
Sbjct  51   HTCYHTHTQVFATGEEEG-----PGEEEPNKSRRRPLGNREAVRKYREKKKAHAAFLEEE  105

Query  498  VVRLRALNQQLLKRLQGQAVLEAEVARLKCLLVDIRGRIE  617
            V +LR LNQQLL+RLQGQA LEAEV RL+ LL D+RG+I+
Sbjct  106  VKKLRLLNQQLLRRLQGQAALEAEVVRLRDLLADLRGKID  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090