BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF042J23

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797723.1|  PREDICTED: serine/threonine protein phosphat...    278   2e-87   Nicotiana sylvestris
ref|XP_006366869.1|  PREDICTED: serine/threonine protein phosphat...    277   9e-87   Solanum tuberosum [potatoes]
emb|CDP21530.1|  unnamed protein product                                265   8e-82   Coffea canephora [robusta coffee]
ref|XP_004251590.1|  PREDICTED: serine/threonine protein phosphat...    255   2e-78   Solanum lycopersicum
ref|XP_009630828.1|  PREDICTED: serine/threonine protein phosphat...    251   8e-77   Nicotiana tomentosiformis
ref|XP_007013281.1|  Serine/threonine protein phosphatase 2A 57 k...    226   3e-67   Theobroma cacao [chocolate]
ref|XP_010656380.1|  PREDICTED: serine/threonine protein phosphat...    226   5e-67   
ref|XP_007013280.1|  Serine/threonine protein phosphatase 2A 57 k...    226   9e-67   
gb|KDP32329.1|  hypothetical protein JCGZ_13254                         220   5e-65   Jatropha curcas
gb|KJB54144.1|  hypothetical protein B456_009G022600                    219   1e-64   Gossypium raimondii
gb|KEH32096.1|  protein phosphatase 2A regulatory B subunit famil...    215   3e-64   Medicago truncatula
gb|KJB64864.1|  hypothetical protein B456_010G068400                    217   9e-64   Gossypium raimondii
gb|AFK37737.1|  unknown                                                 216   3e-63   Medicago truncatula
ref|XP_003609196.1|  Serine/threonine protein phosphatase 2A 57 k...    216   3e-63   Medicago truncatula
gb|KHG08948.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    215   5e-63   Gossypium arboreum [tree cotton]
ref|XP_002515563.1|  protein phosphatase 2a, regulatory subunit, ...    214   2e-62   
ref|XP_003524519.1|  PREDICTED: serine/threonine protein phosphat...    214   2e-62   Glycine max [soybeans]
gb|KHG22084.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    211   1e-61   Gossypium arboreum [tree cotton]
ref|XP_006451050.1|  hypothetical protein CICLE_v10007952mg             212   2e-61   Citrus clementina [clementine]
ref|XP_010249885.1|  PREDICTED: serine/threonine protein phosphat...    210   4e-61   Nelumbo nucifera [Indian lotus]
ref|XP_003549794.1|  PREDICTED: serine/threonine protein phosphat...    210   4e-61   Glycine max [soybeans]
ref|XP_002324961.1|  hypothetical protein POPTR_0018s06320g             209   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_004508562.1|  PREDICTED: serine/threonine protein phosphat...    209   8e-61   Cicer arietinum [garbanzo]
ref|XP_011010867.1|  PREDICTED: serine/threonine protein phosphat...    210   8e-61   Populus euphratica
ref|XP_007155131.1|  hypothetical protein PHAVU_003G176100g             208   2e-60   Phaseolus vulgaris [French bean]
gb|KDO80420.1|  hypothetical protein CISIN_1g009349mg                   205   4e-60   Citrus sinensis [apfelsine]
ref|XP_006451049.1|  hypothetical protein CICLE_v10007952mg             206   2e-59   Citrus clementina [clementine]
gb|KCW82763.1|  hypothetical protein EUGRSUZ_C04140                     203   3e-59   Eucalyptus grandis [rose gum]
ref|XP_010098941.1|  Serine/threonine protein phosphatase 2A 57 k...    209   3e-59   
ref|XP_010049936.1|  PREDICTED: serine/threonine protein phosphat...    203   2e-58   Eucalyptus grandis [rose gum]
gb|KJB83138.1|  hypothetical protein B456_013G231300                    202   5e-58   Gossypium raimondii
ref|XP_007138335.1|  hypothetical protein PHAVU_009G200100g             199   4e-57   Phaseolus vulgaris [French bean]
ref|XP_010254226.1|  PREDICTED: serine/threonine protein phosphat...    198   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_008242686.1|  PREDICTED: serine/threonine protein phosphat...    195   2e-55   Prunus mume [ume]
ref|XP_007204385.1|  hypothetical protein PRUPE_ppa004572mg             195   2e-55   Prunus persica
ref|XP_008337354.1|  PREDICTED: serine/threonine protein phosphat...    195   2e-55   
ref|XP_004287389.1|  PREDICTED: serine/threonine protein phosphat...    193   9e-55   Fragaria vesca subsp. vesca
ref|XP_009371422.1|  PREDICTED: serine/threonine protein phosphat...    193   9e-55   Pyrus x bretschneideri [bai li]
ref|XP_008386225.1|  PREDICTED: serine/threonine protein phosphat...    193   1e-54   
ref|XP_009374054.1|  PREDICTED: serine/threonine protein phosphat...    192   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_004163599.1|  PREDICTED: serine/threonine protein phosphat...    186   3e-52   
ref|XP_008458023.1|  PREDICTED: serine/threonine protein phosphat...    186   3e-52   Cucumis melo [Oriental melon]
ref|XP_004139334.1|  PREDICTED: serine/threonine protein phosphat...    186   4e-52   Cucumis sativus [cucumbers]
ref|XP_010109039.1|  Serine/threonine protein phosphatase 2A 57 k...    181   2e-49   
ref|XP_008811587.1|  PREDICTED: serine/threonine protein phosphat...    178   5e-49   Phoenix dactylifera
ref|XP_010533199.1|  PREDICTED: serine/threonine protein phosphat...    177   7e-49   Tarenaya hassleriana [spider flower]
ref|XP_009377509.1|  PREDICTED: serine/threonine protein phosphat...    177   1e-48   
ref|XP_007223260.1|  hypothetical protein PRUPE_ppa004440mg             177   1e-48   Prunus persica
ref|XP_010541630.1|  PREDICTED: serine/threonine protein phosphat...    176   2e-48   
ref|XP_006394804.1|  hypothetical protein EUTSA_v10004060mg             175   5e-48   Eutrema salsugineum [saltwater cress]
ref|XP_007013747.1|  Phosphatase 2A regulatory B subunit family p...    175   7e-48   
ref|XP_009377393.1|  PREDICTED: serine/threonine protein phosphat...    175   9e-48   Pyrus x bretschneideri [bai li]
ref|XP_006287577.1|  hypothetical protein CARUB_v10000786mg             174   9e-48   Capsella rubella
ref|XP_009372941.1|  PREDICTED: serine/threonine protein phosphat...    175   9e-48   Pyrus x bretschneideri [bai li]
ref|XP_008383627.1|  PREDICTED: serine/threonine protein phosphat...    174   1e-47   
ref|XP_006476190.1|  PREDICTED: serine/threonine protein phosphat...    174   2e-47   
ref|XP_009385620.1|  PREDICTED: serine/threonine protein phosphat...    174   2e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006450560.1|  hypothetical protein CICLE_v10008015mg             174   2e-47   Citrus clementina [clementine]
ref|XP_006476191.1|  PREDICTED: serine/threonine protein phosphat...    174   2e-47   Citrus sinensis [apfelsine]
ref|XP_002874266.1|  hypothetical protein ARALYDRAFT_489409             173   4e-47   
ref|NP_197933.1|  protein phosphatase 2A regulatory B subunit           172   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389489.1|  PREDICTED: serine/threonine protein phosphat...    172   6e-47   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG19967.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    171   2e-46   Gossypium arboreum [tree cotton]
ref|XP_003544625.1|  PREDICTED: serine/threonine protein phosphat...    170   3e-46   Glycine max [soybeans]
ref|XP_004138753.1|  PREDICTED: serine/threonine protein phosphat...    171   3e-46   Cucumis sativus [cucumbers]
gb|KJB07811.1|  hypothetical protein B456_001G045700                    170   4e-46   Gossypium raimondii
ref|XP_010493808.1|  PREDICTED: serine/threonine protein phosphat...    170   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_009407446.1|  PREDICTED: serine/threonine protein phosphat...    170   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008394018.1|  PREDICTED: serine/threonine protein phosphat...    170   6e-46   
gb|KDP32288.1|  hypothetical protein JCGZ_13213                         169   7e-46   Jatropha curcas
gb|KCW80467.1|  hypothetical protein EUGRSUZ_C018111                    165   4e-45   Eucalyptus grandis [rose gum]
ref|XP_010913433.1|  PREDICTED: serine/threonine protein phosphat...    167   5e-45   Elaeis guineensis
ref|XP_010925115.1|  PREDICTED: serine/threonine protein phosphat...    167   7e-45   Elaeis guineensis
ref|XP_010456709.1|  PREDICTED: serine/threonine protein phosphat...    166   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008445128.1|  PREDICTED: serine/threonine protein phosphat...    166   1e-44   Cucumis melo [Oriental melon]
ref|XP_010421407.1|  PREDICTED: serine/threonine protein phosphat...    166   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_004961286.1|  PREDICTED: serine/threonine protein phosphat...    166   2e-44   Setaria italica
ref|XP_010048263.1|  PREDICTED: serine/threonine protein phosphat...    166   2e-44   Eucalyptus grandis [rose gum]
ref|XP_007161261.1|  hypothetical protein PHAVU_001G055500g             164   4e-44   Phaseolus vulgaris [French bean]
ref|XP_004498632.1|  PREDICTED: serine/threonine protein phosphat...    164   6e-44   Cicer arietinum [garbanzo]
ref|XP_006654758.1|  PREDICTED: serine/threonine protein phosphat...    164   6e-44   Oryza brachyantha
emb|CDX80521.1|  BnaC07g29230D                                          164   9e-44   
emb|CDX88186.1|  BnaA06g27770D                                          163   1e-43   
ref|XP_009151080.1|  PREDICTED: serine/threonine protein phosphat...    163   1e-43   Brassica rapa
ref|XP_010670759.1|  PREDICTED: serine/threonine protein phosphat...    163   1e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001148974.1|  transposon protein                                 162   2e-43   
gb|ACN30940.1|  unknown                                                 162   2e-43   Zea mays [maize]
ref|XP_008647861.1|  PREDICTED: transposon protein isoform X1           162   2e-43   
ref|XP_002440213.1|  hypothetical protein SORBIDRAFT_09g027870          162   3e-43   Sorghum bicolor [broomcorn]
ref|XP_002308635.2|  hypothetical protein POPTR_0006s26320g             160   3e-43   
ref|XP_011019731.1|  PREDICTED: serine/threonine protein phosphat...    162   3e-43   Populus euphratica
ref|XP_008785874.1|  PREDICTED: serine/threonine protein phosphat...    162   3e-43   Phoenix dactylifera
ref|XP_009415355.1|  PREDICTED: serine/threonine protein phosphat...    162   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAY98962.1|  hypothetical protein OsI_20919                          162   4e-43   Oryza sativa Indica Group [Indian rice]
gb|KFK27832.1|  hypothetical protein AALP_AA8G435800                    162   4e-43   Arabis alpina [alpine rockcress]
emb|CAC85920.1|  protein phosphatase 2A B'kappa subunit                 162   4e-43   Oryza sativa Japonica Group [Japonica rice]
gb|KJB27047.1|  hypothetical protein B456_004G274600                    160   6e-43   Gossypium raimondii
ref|XP_003567932.1|  PREDICTED: serine/threonine protein phosphat...    161   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_002516615.1|  protein phosphatase 2a, regulatory subunit, ...    160   1e-42   Ricinus communis
ref|XP_004292963.1|  PREDICTED: serine/threonine protein phosphat...    160   2e-42   Fragaria vesca subsp. vesca
ref|XP_003588682.1|  Serine/threonine protein phosphatase 2A 57 k...    160   2e-42   Medicago truncatula
gb|KJB27048.1|  hypothetical protein B456_004G274600                    160   3e-42   Gossypium raimondii
ref|XP_008785883.1|  PREDICTED: serine/threonine protein phosphat...    159   8e-42   Phoenix dactylifera
gb|AFW81037.1|  hypothetical protein ZEAMMB73_275381                    158   1e-41   
ref|XP_011026522.1|  PREDICTED: serine/threonine protein phosphat...    158   1e-41   Populus euphratica
ref|XP_002458327.1|  hypothetical protein SORBIDRAFT_03g031350          157   2e-41   Sorghum bicolor [broomcorn]
emb|CDP18419.1|  unnamed protein product                                157   2e-41   Coffea canephora [robusta coffee]
ref|XP_008809266.1|  PREDICTED: serine/threonine protein phosphat...    157   3e-41   Phoenix dactylifera
ref|XP_011087131.1|  PREDICTED: serine/threonine protein phosphat...    156   5e-41   Sesamum indicum [beniseed]
ref|XP_004969559.1|  PREDICTED: serine/threonine protein phosphat...    156   5e-41   Setaria italica
ref|XP_003550157.1|  PREDICTED: serine/threonine protein phosphat...    156   5e-41   Glycine max [soybeans]
ref|NP_001056272.1|  Os05g0555100                                       155   7e-41   
ref|XP_007137075.1|  hypothetical protein PHAVU_009G097600g             155   8e-41   Phaseolus vulgaris [French bean]
gb|EYU21914.1|  hypothetical protein MIMGU_mgv1a005231mg                155   1e-40   Erythranthe guttata [common monkey flower]
emb|CDY54903.1|  BnaC02g48620D                                          155   1e-40   Brassica napus [oilseed rape]
ref|XP_003603467.1|  Serine/threonine protein phosphatase 2A 57 k...    154   3e-40   Medicago truncatula
ref|XP_010925297.1|  PREDICTED: serine/threonine protein phosphat...    153   7e-40   Elaeis guineensis
emb|CDY05497.1|  BnaA02g31940D                                          152   1e-39   
ref|XP_009129957.1|  PREDICTED: serine/threonine protein phosphat...    152   1e-39   Brassica rapa
ref|XP_002284526.1|  PREDICTED: serine/threonine protein phosphat...    152   1e-39   Vitis vinifera
ref|XP_011081886.1|  PREDICTED: serine/threonine protein phosphat...    152   2e-39   Sesamum indicum [beniseed]
ref|XP_004241801.1|  PREDICTED: serine/threonine protein phosphat...    149   1e-38   
ref|XP_009619322.1|  PREDICTED: serine/threonine protein phosphat...    149   3e-38   Nicotiana tomentosiformis
ref|XP_006353657.1|  PREDICTED: serine/threonine protein phosphat...    147   1e-37   Solanum tuberosum [potatoes]
ref|XP_009798807.1|  PREDICTED: serine/threonine protein phosphat...    146   2e-37   Nicotiana sylvestris
gb|KHN10390.1|  Serine/threonine protein phosphatase 2A 57 kDa re...    144   6e-37   Glycine soja [wild soybean]
ref|XP_003522642.1|  PREDICTED: serine/threonine protein phosphat...    145   7e-37   Glycine max [soybeans]
ref|XP_004501280.1|  PREDICTED: serine/threonine protein phosphat...    144   1e-36   
gb|EPS62004.1|  hypothetical protein M569_12788                         144   1e-36   Genlisea aurea
gb|EPS70113.1|  hypothetical protein M569_04647                         142   3e-36   Genlisea aurea
ref|XP_003526435.1|  PREDICTED: serine/threonine protein phosphat...    143   3e-36   Glycine max [soybeans]
dbj|BAK03510.1|  predicted protein                                      142   4e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146050.1|  uncharacterized protein LOC100279581               142   5e-36   Zea mays [maize]
gb|EPS71240.1|  hypothetical protein M569_03516                         140   3e-35   Genlisea aurea
ref|XP_002448078.1|  hypothetical protein SORBIDRAFT_06g020625          126   1e-30   
emb|CDY38628.1|  BnaA05g19590D                                          125   6e-30   Brassica napus [oilseed rape]
ref|XP_004976008.1|  PREDICTED: serine/threonine protein phosphat...    124   2e-29   Setaria italica
ref|XP_006830091.1|  hypothetical protein AMTR_s00123p00060730          124   2e-29   Amborella trichopoda
ref|NP_001053130.1|  Os04g0485100                                       123   3e-29   
ref|XP_011042316.1|  PREDICTED: serine/threonine protein phosphat...    124   3e-29   Populus euphratica
ref|XP_011021363.1|  PREDICTED: serine/threonine protein phosphat...    124   3e-29   Populus euphratica
ref|XP_009145466.1|  PREDICTED: serine/threonine protein phosphat...    122   6e-29   Brassica rapa
emb|CAC09487.2|  H0811E11.3                                             122   6e-29   Oryza sativa [red rice]
ref|XP_008669249.1|  PREDICTED: serine/threonine protein phosphat...    122   7e-29   Zea mays [maize]
ref|NP_001183245.1|  hypothetical protein                               122   8e-29   Zea mays [maize]
gb|EYU29254.1|  hypothetical protein MIMGU_mgv1a005961mg                121   1e-28   Erythranthe guttata [common monkey flower]
ref|XP_001782778.1|  predicted protein                                  121   2e-28   
ref|XP_002311732.2|  hypothetical protein POPTR_0008s18020g             120   2e-28   
gb|KDO82045.1|  hypothetical protein CISIN_1g010504mg                   121   2e-28   Citrus sinensis [apfelsine]
gb|KJB40702.1|  hypothetical protein B456_007G074200                    121   2e-28   Gossypium raimondii
ref|XP_008797311.1|  PREDICTED: serine/threonine protein phosphat...    121   2e-28   Phoenix dactylifera
emb|CDY44320.1|  BnaC05g30730D                                          120   3e-28   Brassica napus [oilseed rape]
ref|XP_011029624.1|  PREDICTED: serine/threonine protein phosphat...    120   3e-28   Populus euphratica
ref|XP_002314559.1|  serine/threonine protein phosphatase 2A regu...    120   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_007222857.1|  hypothetical protein PRUPE_ppa004253mg             120   4e-28   Prunus persica
ref|XP_006438131.1|  hypothetical protein CICLE_v10031285mg             120   5e-28   Citrus clementina [clementine]
ref|XP_002301608.1|  serine/threonine protein phosphatase 2A regu...    120   5e-28   
gb|KJB11609.1|  hypothetical protein B456_001G268200                    120   5e-28   Gossypium raimondii
gb|KHG13833.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...    120   5e-28   Gossypium arboreum [tree cotton]
gb|KJB11611.1|  hypothetical protein B456_001G268200                    119   6e-28   Gossypium raimondii
ref|XP_007222861.1|  hypothetical protein PRUPE_ppa004258mg             119   7e-28   Prunus persica
ref|XP_006652431.1|  PREDICTED: serine/threonine protein phosphat...    119   7e-28   Oryza brachyantha
gb|KHN03104.1|  Serine/threonine protein phosphatase 2A 57 kDa re...    118   1e-27   Glycine soja [wild soybean]
ref|XP_011097329.1|  PREDICTED: serine/threonine protein phosphat...    119   1e-27   Sesamum indicum [beniseed]
ref|XP_008222035.1|  PREDICTED: serine/threonine protein phosphat...    119   1e-27   Prunus mume [ume]
ref|XP_001766093.1|  predicted protein                                  118   1e-27   
gb|KHN10406.1|  Serine/threonine protein phosphatase 2A 57 kDa re...    117   2e-27   Glycine soja [wild soybean]
gb|KHF99622.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...    118   2e-27   Gossypium arboreum [tree cotton]
ref|XP_010025360.1|  PREDICTED: serine/threonine protein phosphat...    118   2e-27   Eucalyptus grandis [rose gum]
ref|XP_002266932.1|  PREDICTED: serine/threonine protein phosphat...    118   2e-27   Vitis vinifera
ref|XP_006852143.1|  hypothetical protein AMTR_s00049p00063500          118   2e-27   Amborella trichopoda
ref|XP_008340161.1|  PREDICTED: serine/threonine protein phosphat...    118   3e-27   
ref|XP_002970708.1|  hypothetical protein SELMODRAFT_171686             117   3e-27   
ref|XP_002969377.1|  hypothetical protein SELMODRAFT_267276             117   3e-27   
ref|NP_172803.1|  protein phosphatase 2A B'theta                        117   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61625.1|  B regulatory subunit of protein phosphatase 2A, p...    117   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010044751.1|  PREDICTED: serine/threonine protein phosphat...    117   4e-27   
ref|XP_010089442.1|  Serine/threonine protein phosphatase 2A 59 k...    117   4e-27   Morus notabilis
ref|XP_004231808.1|  PREDICTED: serine/threonine protein phosphat...    117   4e-27   Solanum lycopersicum
gb|KCW62001.1|  hypothetical protein EUGRSUZ_H04680                     117   4e-27   Eucalyptus grandis [rose gum]
ref|XP_009370310.1|  PREDICTED: serine/threonine protein phosphat...    117   4e-27   
ref|XP_009371715.1|  PREDICTED: serine/threonine protein phosphat...    117   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_006417120.1|  hypothetical protein EUTSA_v10007450mg             117   5e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010531427.1|  PREDICTED: serine/threonine protein phosphat...    117   5e-27   Tarenaya hassleriana [spider flower]
ref|XP_007031734.1|  Serine/threonine protein phosphatase 2A 59 k...    116   5e-27   
ref|XP_010660818.1|  PREDICTED: serine/threonine protein phosphat...    116   6e-27   
ref|NP_001051871.1|  Os03g0844500                                       117   6e-27   
ref|XP_007031732.1|  Serine/threonine protein phosphatase 2A 59 k...    117   7e-27   
ref|XP_011470807.1|  PREDICTED: serine/threonine protein phosphat...    116   8e-27   Fragaria vesca subsp. vesca
ref|XP_008222034.1|  PREDICTED: serine/threonine protein phosphat...    116   9e-27   Prunus mume [ume]
ref|XP_009402720.1|  PREDICTED: serine/threonine protein phosphat...    116   9e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG26982.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...    116   1e-26   Gossypium arboreum [tree cotton]
ref|XP_006414514.1|  hypothetical protein EUTSA_v10024939mg             116   1e-26   Eutrema salsugineum [saltwater cress]
ref|XP_010252513.1|  PREDICTED: serine/threonine protein phosphat...    116   1e-26   
ref|XP_008648421.1|  PREDICTED: serine/threonine protein phosphat...    116   1e-26   Zea mays [maize]
ref|XP_009359296.1|  PREDICTED: serine/threonine protein phosphat...    116   1e-26   Pyrus x bretschneideri [bai li]
emb|CDP16651.1|  unnamed protein product                                115   2e-26   Coffea canephora [robusta coffee]
ref|XP_010551033.1|  PREDICTED: serine/threonine protein phosphat...    115   2e-26   
gb|KJB10684.1|  hypothetical protein B456_001G216400                    115   2e-26   Gossypium raimondii
gb|KHG18630.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...    115   3e-26   Gossypium arboreum [tree cotton]
gb|AFW74402.1|  hypothetical protein ZEAMMB73_323247                    115   3e-26   
ref|XP_010927329.1|  PREDICTED: serine/threonine protein phosphat...    115   3e-26   Elaeis guineensis
gb|KDP26745.1|  hypothetical protein JCGZ_17903                         115   3e-26   Jatropha curcas
gb|KJB33914.1|  hypothetical protein B456_006G038500                    114   4e-26   Gossypium raimondii
ref|XP_004169443.1|  PREDICTED: serine/threonine protein phosphat...    115   4e-26   
ref|XP_009590023.1|  PREDICTED: serine/threonine protein phosphat...    115   4e-26   Nicotiana tomentosiformis
ref|XP_002870241.1|  hypothetical protein ARALYDRAFT_329973             117   4e-26   
ref|XP_004310036.1|  PREDICTED: serine/threonine protein phosphat...    114   4e-26   Fragaria vesca subsp. vesca
ref|XP_002890006.1|  hypothetical protein ARALYDRAFT_471504             114   5e-26   
ref|XP_009148646.1|  PREDICTED: serine/threonine protein phosphat...    114   5e-26   Brassica rapa
gb|KJB33915.1|  hypothetical protein B456_006G038500                    114   5e-26   Gossypium raimondii
gb|KHG16605.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...    113   5e-26   Gossypium arboreum [tree cotton]
gb|KDP26746.1|  hypothetical protein JCGZ_17904                         114   7e-26   Jatropha curcas
ref|XP_004142950.1|  PREDICTED: serine/threonine protein phosphat...    114   7e-26   Cucumis sativus [cucumbers]
ref|XP_011047218.1|  PREDICTED: serine/threonine protein phosphat...    114   8e-26   Populus euphratica
ref|XP_006307325.1|  hypothetical protein CARUB_v10008945mg             113   9e-26   Capsella rubella
gb|KDO52091.1|  hypothetical protein CISIN_1g0107851mg                  112   9e-26   Citrus sinensis [apfelsine]
gb|AHE76186.1|  protein phosphatase 2a                                  113   9e-26   Chrysanthemum indicum
ref|XP_004304704.1|  PREDICTED: serine/threonine protein phosphat...    114   1e-25   Fragaria vesca subsp. vesca
ref|XP_008441374.1|  PREDICTED: serine/threonine protein phosphat...    114   1e-25   Cucumis melo [Oriental melon]
ref|XP_004138464.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    113   1e-25   
gb|KGN45729.1|  hypothetical protein Csa_6G008600                       113   1e-25   Cucumis sativus [cucumbers]
ref|XP_006650885.1|  PREDICTED: serine/threonine protein phosphat...    113   1e-25   Oryza brachyantha
ref|NP_001059361.1|  Os07g0274800                                       113   1e-25   
ref|XP_006469972.1|  PREDICTED: serine/threonine protein phosphat...    113   1e-25   Citrus sinensis [apfelsine]
gb|EPS71994.1|  hypothetical protein M569_02763                         112   1e-25   Genlisea aurea
ref|NP_001146165.1|  hypothetical protein                               113   1e-25   Zea mays [maize]
gb|KDO52090.1|  hypothetical protein CISIN_1g0107851mg                  112   1e-25   Citrus sinensis [apfelsine]
ref|XP_010228178.1|  PREDICTED: serine/threonine protein phosphat...    112   1e-25   
ref|XP_010228176.1|  PREDICTED: serine/threonine protein phosphat...    113   1e-25   Brachypodium distachyon [annual false brome]
ref|XP_002514974.1|  protein phosphatase 2a, regulatory subunit, ...    113   2e-25   
ref|XP_009772668.1|  PREDICTED: serine/threonine protein phosphat...    113   2e-25   Nicotiana sylvestris
ref|XP_010111637.1|  Serine/threonine protein phosphatase 2A 59 k...    113   2e-25   Morus notabilis
ref|XP_006447169.1|  hypothetical protein CICLE_v10014898mg             113   2e-25   
gb|KJB42861.1|  hypothetical protein B456_007G171000                    113   2e-25   Gossypium raimondii
ref|XP_001758786.1|  predicted protein                                  113   2e-25   
ref|XP_004239176.1|  PREDICTED: serine/threonine protein phosphat...    112   2e-25   Solanum lycopersicum
gb|AFW58632.1|  hypothetical protein ZEAMMB73_760675                    112   2e-25   
emb|CDX98102.1|  BnaA06g08530D                                          112   2e-25   
emb|CDX90593.1|  BnaA03g41880D                                          112   2e-25   
ref|XP_008230444.1|  PREDICTED: serine/threonine protein phosphat...    112   2e-25   Prunus mume [ume]
ref|XP_007215087.1|  hypothetical protein PRUPE_ppa004318mg             112   3e-25   Prunus persica
ref|XP_006338659.1|  PREDICTED: serine/threonine protein phosphat...    112   3e-25   Solanum tuberosum [potatoes]
ref|XP_010100283.1|  Serine/threonine protein phosphatase 2A 59 k...    112   3e-25   Morus notabilis
ref|XP_009411828.1|  PREDICTED: serine/threonine protein phosphat...    112   3e-25   
ref|XP_009411830.1|  PREDICTED: serine/threonine protein phosphat...    112   3e-25   
ref|XP_006386782.1|  hypothetical protein POPTR_0002s21550g             112   3e-25   Populus trichocarpa [western balsam poplar]
ref|XP_009411832.1|  PREDICTED: serine/threonine protein phosphat...    112   4e-25   
emb|CDY48287.1|  BnaC01g31410D                                          112   4e-25   Brassica napus [oilseed rape]
ref|XP_008799952.1|  PREDICTED: serine/threonine protein phosphat...    112   4e-25   Phoenix dactylifera
ref|XP_006375538.1|  hypothetical protein POPTR_0014s15530g             110   4e-25   
ref|XP_007044972.1|  Serine/threonine protein phosphatase 2A 59 k...    112   5e-25   
emb|CAN66032.1|  hypothetical protein VITISV_019650                     112   5e-25   Vitis vinifera
emb|CDY30030.1|  BnaC05g09900D                                          111   5e-25   Brassica napus [oilseed rape]
ref|XP_008444411.1|  PREDICTED: serine/threonine protein phosphat...    111   5e-25   Cucumis melo [Oriental melon]
ref|XP_010440315.1|  PREDICTED: serine/threonine protein phosphat...    111   6e-25   Camelina sativa [gold-of-pleasure]
dbj|BAJ97460.1|  predicted protein                                      111   6e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006406248.1|  hypothetical protein EUTSA_v10020525mg             111   6e-25   Eutrema salsugineum [saltwater cress]
ref|XP_002514975.1|  protein phosphatase 2a, regulatory subunit, ...    111   6e-25   Ricinus communis
ref|XP_003580003.1|  PREDICTED: serine/threonine protein phosphat...    111   6e-25   Brachypodium distachyon [annual false brome]
ref|XP_004981072.1|  PREDICTED: serine/threonine protein phosphat...    111   6e-25   Setaria italica
ref|XP_010250854.1|  PREDICTED: serine/threonine protein phosphat...    111   7e-25   Nelumbo nucifera [Indian lotus]
dbj|BAB02360.1|  protein phosphatase 2A B' regulatory subunit           111   7e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003555155.1|  PREDICTED: serine/threonine protein phosphat...    111   7e-25   Glycine max [soybeans]
gb|AGT16585.1|  hypothetical protein SHCRBa_109_M04_F_40                111   8e-25   Saccharum hybrid cultivar R570
ref|XP_010458797.1|  PREDICTED: serine/threonine protein phosphat...    110   8e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010476343.1|  PREDICTED: serine/threonine protein phosphat...    111   8e-25   Camelina sativa [gold-of-pleasure]
gb|EPS70490.1|  protein phosphatase 2a                                  111   8e-25   Genlisea aurea
ref|XP_009412705.1|  PREDICTED: serine/threonine protein phosphat...    110   9e-25   
ref|XP_002466111.1|  hypothetical protein SORBIDRAFT_01g001550          110   1e-24   
ref|XP_010244149.1|  PREDICTED: serine/threonine protein phosphat...    111   1e-24   Nelumbo nucifera [Indian lotus]
gb|KJB78043.1|  hypothetical protein B456_012G174400                    110   1e-24   Gossypium raimondii
gb|EMT26962.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    110   1e-24   
ref|XP_010660823.1|  PREDICTED: serine/threonine protein phosphat...    110   1e-24   
ref|XP_009414678.1|  PREDICTED: serine/threonine protein phosphat...    110   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS59388.1|  hypothetical protein M569_15419                         110   1e-24   Genlisea aurea
ref|XP_009412704.1|  PREDICTED: serine/threonine protein phosphat...    110   1e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008649345.1|  PREDICTED: protein phosphatase 2A regulatory...    110   2e-24   
ref|NP_001105904.1|  protein phosphatase 2A regulatory subunit B'       110   2e-24   
gb|KJB31018.1|  hypothetical protein B456_005G172800                    110   2e-24   
gb|EMT15241.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    110   2e-24   
dbj|BAK05777.1|  predicted protein                                      110   2e-24   
emb|CAB10320.1|  phosphatase like protein                               112   2e-24   
ref|XP_011098818.1|  PREDICTED: serine/threonine protein phosphat...    110   2e-24   
ref|XP_010660814.1|  PREDICTED: serine/threonine protein phosphat...    109   2e-24   
ref|XP_010932304.1|  PREDICTED: serine/threonine protein phosphat...    110   2e-24   
ref|XP_002444972.1|  hypothetical protein SORBIDRAFT_07g002150          110   2e-24   
gb|KDP30791.1|  hypothetical protein JCGZ_13734                         110   2e-24   
ref|XP_002314558.1|  hypothetical protein POPTR_0010s06450g             109   2e-24   
ref|XP_006341761.1|  PREDICTED: serine/threonine protein phosphat...    109   2e-24   
ref|XP_010556177.1|  PREDICTED: serine/threonine protein phosphat...    109   3e-24   
ref|XP_010449943.1|  PREDICTED: serine/threonine protein phosphat...    109   3e-24   
ref|XP_011021368.1|  PREDICTED: serine/threonine protein phosphat...    109   3e-24   
gb|EYU34778.1|  hypothetical protein MIMGU_mgv1a004809mg                109   3e-24   
gb|KHG03259.1|  Serine/threonine phosphatase 2A 59 kDa regulatory...    108   3e-24   
emb|CBI40091.3|  unnamed protein product                                108   4e-24   
ref|XP_009786927.1|  PREDICTED: serine/threonine protein phosphat...    109   4e-24   
ref|XP_009606776.1|  PREDICTED: serine/threonine protein phosphat...    109   4e-24   
ref|XP_003545564.1|  PREDICTED: serine/threonine protein phosphat...    109   4e-24   
ref|XP_010317069.1|  PREDICTED: serine/threonine protein phosphat...    109   4e-24   
ref|XP_009780032.1|  PREDICTED: serine/threonine protein phosphat...    108   4e-24   
ref|XP_009359306.1|  PREDICTED: serine/threonine protein phosphat...    108   5e-24   
ref|XP_006283548.1|  hypothetical protein CARUB_v10004601mg             108   5e-24   
ref|XP_011098814.1|  PREDICTED: serine/threonine protein phosphat...    108   5e-24   
ref|XP_011005899.1|  PREDICTED: serine/threonine protein phosphat...    108   6e-24   
gb|KHN38476.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    108   6e-24   
ref|XP_003519459.1|  PREDICTED: serine/threonine protein phosphat...    108   6e-24   
ref|XP_010248839.1|  PREDICTED: serine/threonine protein phosphat...    108   6e-24   
ref|XP_006484025.1|  PREDICTED: serine/threonine protein phosphat...    108   6e-24   
ref|XP_006438130.1|  hypothetical protein CICLE_v10031228mg             108   6e-24   
ref|XP_009620794.1|  PREDICTED: serine/threonine protein phosphat...    108   7e-24   
emb|CDP13292.1|  unnamed protein product                                108   7e-24   
ref|XP_011071183.1|  PREDICTED: serine/threonine protein phosphat...    108   7e-24   
ref|XP_008389801.1|  PREDICTED: serine/threonine protein phosphat...    108   8e-24   
ref|XP_008340163.1|  PREDICTED: serine/threonine protein phosphat...    108   8e-24   
ref|XP_007141624.1|  hypothetical protein PHAVU_008G211700g             108   8e-24   
ref|XP_007049146.1|  Phosphatase 2A regulatory B subunit family p...    108   9e-24   
ref|XP_003553878.1|  PREDICTED: serine/threonine protein phosphat...    108   9e-24   
ref|XP_010907768.1|  PREDICTED: serine/threonine protein phosphat...    107   9e-24   
gb|AAM10385.1|  AT4g15410/dl3750w                                       108   1e-23   
ref|XP_010537569.1|  PREDICTED: serine/threonine protein phosphat...    107   1e-23   
ref|NP_567464.1|  protein phosphatase 2A B'gamma                        108   1e-23   
ref|XP_010434994.1|  PREDICTED: serine/threonine protein phosphat...    108   1e-23   
ref|XP_010907766.1|  PREDICTED: serine/threonine protein phosphat...    107   1e-23   
gb|EMS66139.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    108   1e-23   
ref|XP_009129571.1|  PREDICTED: serine/threonine protein phosphat...    107   1e-23   
emb|CDY09766.1|  BnaC07g32950D                                          107   1e-23   
gb|KHN30494.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    107   2e-23   
ref|XP_002455079.1|  hypothetical protein SORBIDRAFT_03g003950          107   2e-23   
gb|KHM99097.1|  Serine/threonine protein phosphatase 2A 59 kDa re...    107   2e-23   
ref|XP_010907764.1|  PREDICTED: serine/threonine protein phosphat...    107   2e-23   
ref|XP_003573322.1|  PREDICTED: serine/threonine protein phosphat...    107   2e-23   
ref|XP_010554220.1|  PREDICTED: serine/threonine protein phosphat...    107   2e-23   
emb|CDX83578.1|  BnaC07g23180D                                          107   2e-23   
ref|XP_010510456.1|  PREDICTED: serine/threonine protein phosphat...    107   2e-23   
emb|CDY13605.1|  BnaA06g33180D                                          107   2e-23   
ref|XP_009137092.1|  PREDICTED: serine/threonine protein phosphat...    108   2e-23   
ref|XP_010100284.1|  Serine/threonine protein phosphatase 2A 59 k...    107   2e-23   
ref|XP_008379151.1|  PREDICTED: serine/threonine protein phosphat...    107   2e-23   
ref|XP_010440316.1|  PREDICTED: serine/threonine protein phosphat...    107   2e-23   
ref|NP_001141673.1|  uncharacterized protein LOC100273799               107   2e-23   
ref|XP_006395602.1|  hypothetical protein EUTSA_v10004020mg             107   2e-23   
ref|XP_011086721.1|  PREDICTED: serine/threonine protein phosphat...    107   3e-23   
ref|XP_003524485.1|  PREDICTED: serine/threonine protein phosphat...    107   3e-23   
ref|XP_009152091.1|  PREDICTED: serine/threonine protein phosphat...    107   3e-23   
ref|XP_010029046.1|  PREDICTED: serine/threonine protein phosphat...    107   3e-23   
ref|XP_009147392.1|  PREDICTED: serine/threonine protein phosphat...    106   3e-23   
emb|CDY22925.1|  BnaA01g18630D                                          106   3e-23   
ref|XP_002311731.1|  hypothetical protein POPTR_0008s18010g             106   4e-23   
gb|KDP46344.1|  hypothetical protein JCGZ_10184                         106   4e-23   
ref|XP_010495328.1|  PREDICTED: serine/threonine protein phosphat...    106   4e-23   
ref|XP_006657611.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    106   4e-23   
gb|EPS61839.1|  hypothetical protein M569_12952                         105   4e-23   
ref|XP_006428448.1|  hypothetical protein CICLE_v10011941mg             105   4e-23   
ref|XP_010466418.1|  PREDICTED: serine/threonine protein phosphat...    106   5e-23   
emb|CDY40986.1|  BnaA02g27760D                                          108   5e-23   
dbj|BAD67828.1|  putative serine/threonine protein phosphatase 2A...    105   5e-23   
ref|XP_011457446.1|  PREDICTED: serine/threonine protein phosphat...    106   5e-23   
ref|XP_006838709.1|  hypothetical protein AMTR_s00002p00250530          105   6e-23   
ref|XP_011029625.1|  PREDICTED: serine/threonine protein phosphat...    105   7e-23   
ref|XP_002885457.1|  protein phosphatase 2A B                           106   7e-23   
gb|KDO40519.1|  hypothetical protein CISIN_1g011191mg                   105   8e-23   
ref|NP_001154647.1|  protein phosphatase 2A regulatory subunit B'...    105   9e-23   
ref|NP_189231.1|  protein phosphatase 2A regulatory subunit B' eta      105   9e-23   
ref|XP_006491669.1|  PREDICTED: serine/threonine protein phosphat...    105   9e-23   
ref|NP_001154648.1|  protein phosphatase 2A regulatory subunit B'...    105   9e-23   
ref|XP_004968416.1|  PREDICTED: serine/threonine protein phosphat...    105   9e-23   
ref|XP_001767940.1|  predicted protein                                  104   9e-23   
ref|XP_001768015.1|  predicted protein                                  104   1e-22   
ref|XP_010682883.1|  PREDICTED: serine/threonine protein phosphat...    105   1e-22   
ref|XP_006357177.1|  PREDICTED: serine/threonine protein phosphat...    105   1e-22   
ref|XP_008351065.1|  PREDICTED: serine/threonine protein phosphat...    104   1e-22   
ref|XP_008230000.1|  PREDICTED: serine/threonine protein phosphat...    105   1e-22   
ref|XP_007217254.1|  hypothetical protein PRUPE_ppa003902mg             105   1e-22   
ref|XP_009407773.1|  PREDICTED: serine/threonine protein phosphat...    105   1e-22   
ref|XP_002323997.1|  serine/threonine protein phosphatase 2A regu...    105   1e-22   
ref|XP_007044975.1|  Phosphatase 2A regulatory B subunit family p...    105   1e-22   
ref|XP_002956177.1|  hypothetical protein VOLCADRAFT_107119             105   1e-22   
ref|XP_010234950.1|  PREDICTED: serine/threonine protein phosphat...    105   1e-22   
ref|XP_009365093.1|  PREDICTED: serine/threonine protein phosphat...    105   1e-22   
emb|CDX99733.1|  BnaC02g35870D                                          106   1e-22   
ref|XP_002459695.1|  hypothetical protein SORBIDRAFT_02g008950          104   1e-22   
gb|KJB36484.1|  hypothetical protein B456_006G161400                    103   2e-22   
ref|XP_009625334.1|  PREDICTED: serine/threonine protein phosphat...    105   2e-22   
ref|XP_001693445.1|  PP2A-widerborst subunit                            104   2e-22   
ref|XP_011012347.1|  PREDICTED: serine/threonine protein phosphat...    104   2e-22   
ref|XP_011010241.1|  PREDICTED: serine/threonine protein phosphat...    104   2e-22   
ref|XP_010935325.1|  PREDICTED: serine/threonine protein phosphat...    104   2e-22   
gb|EYU44815.1|  hypothetical protein MIMGU_mgv1a005633mg                103   2e-22   
ref|XP_010514232.1|  PREDICTED: serine/threonine protein phosphat...    104   3e-22   
ref|XP_010488186.1|  PREDICTED: serine/threonine protein phosphat...    104   3e-22   
ref|XP_010653990.1|  PREDICTED: serine/threonine protein phosphat...    102   3e-22   
ref|XP_002525315.1|  protein phosphatase 2a, regulatory subunit, ...    104   3e-22   
ref|XP_010514230.1|  PREDICTED: serine/threonine protein phosphat...    103   3e-22   
ref|NP_188802.1|  protein phosphatase 2A B'zeta                         104   3e-22   
ref|XP_002875297.1|  hypothetical protein ARALYDRAFT_904782             103   3e-22   
ref|XP_008813321.1|  PREDICTED: serine/threonine protein phosphat...    103   4e-22   
ref|XP_004243528.1|  PREDICTED: serine/threonine protein phosphat...    104   4e-22   
ref|XP_003601840.1|  Serine/threonine protein phosphatase 2A 59 k...    103   4e-22   
ref|XP_006643825.1|  PREDICTED: serine/threonine protein phosphat...    103   4e-22   
gb|KJB36483.1|  hypothetical protein B456_006G161400                    103   4e-22   
ref|XP_004494078.1|  PREDICTED: serine/threonine protein phosphat...    103   4e-22   
ref|XP_003569694.1|  PREDICTED: serine/threonine protein phosphat...    103   5e-22   
ref|XP_011094501.1|  PREDICTED: serine/threonine protein phosphat...    102   6e-22   
ref|XP_006297394.1|  hypothetical protein CARUB_v10013418mg             103   7e-22   
ref|XP_002268629.1|  PREDICTED: serine/threonine protein phosphat...    102   7e-22   
ref|XP_010940226.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    102   7e-22   
ref|XP_006659077.1|  PREDICTED: serine/threonine protein phosphat...    102   8e-22   
ref|XP_010425263.1|  PREDICTED: serine/threonine protein phosphat...    102   9e-22   
ref|XP_010502490.1|  PREDICTED: serine/threonine protein phosphat...    102   9e-22   
ref|XP_009385575.1|  PREDICTED: serine/threonine protein phosphat...    102   1e-21   
ref|XP_009762462.1|  PREDICTED: serine/threonine protein phosphat...    101   1e-21   
ref|XP_006447619.1|  hypothetical protein CICLE_v10014856mg             102   1e-21   
ref|XP_009762457.1|  PREDICTED: serine/threonine protein phosphat...    102   1e-21   
ref|XP_010682885.1|  PREDICTED: serine/threonine protein phosphat...    102   1e-21   
ref|XP_009762455.1|  PREDICTED: serine/threonine protein phosphat...    102   1e-21   
ref|XP_010657226.1|  PREDICTED: serine/threonine protein phosphat...    102   1e-21   
ref|XP_008379655.1|  PREDICTED: serine/threonine protein phosphat...    102   2e-21   
ref|XP_008812431.1|  PREDICTED: serine/threonine protein phosphat...    102   2e-21   
ref|XP_001766428.1|  predicted protein                                  101   2e-21   
ref|XP_008363215.1|  PREDICTED: serine/threonine protein phosphat...    102   2e-21   
ref|XP_003535186.1|  PREDICTED: serine/threonine protein phosphat...    101   2e-21   
gb|KDP29180.1|  hypothetical protein JCGZ_16569                         101   2e-21   
gb|KHG23992.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...    101   3e-21   
ref|XP_004972977.1|  PREDICTED: serine/threonine protein phosphat...    101   3e-21   
ref|XP_007151564.1|  hypothetical protein PHAVU_004G057400g             101   3e-21   
ref|XP_003551893.1|  PREDICTED: serine/threonine protein phosphat...    101   3e-21   
ref|NP_001169040.1|  hypothetical protein                               101   4e-21   
ref|XP_010548887.1|  PREDICTED: serine/threonine protein phosphat...    100   4e-21   
gb|EYU39647.1|  hypothetical protein MIMGU_mgv1a005452mg                100   4e-21   
ref|XP_008389803.1|  PREDICTED: serine/threonine protein phosphat...    100   6e-21   
ref|XP_001774044.1|  predicted protein                                  100   6e-21   
ref|XP_009629305.1|  PREDICTED: serine/threonine protein phosphat...    100   6e-21   
ref|XP_003601378.1|  Serine/threonine protein phosphatase 2A 59 k...    100   7e-21   
ref|XP_006293086.1|  hypothetical protein CARUB_v10019373mg             100   8e-21   
gb|EYU44814.1|  hypothetical protein MIMGU_mgv1a004709mg                100   8e-21   
ref|XP_007163719.1|  hypothetical protein PHAVU_001G258400g           99.8    1e-20   
ref|XP_008350950.1|  PREDICTED: serine/threonine protein phosphat...  99.8    1e-20   
ref|XP_010932088.1|  PREDICTED: serine/threonine protein phosphat...  98.2    1e-20   
ref|XP_002973626.1|  hypothetical protein SELMODRAFT_149261           99.0    1e-20   
ref|XP_003542561.1|  PREDICTED: serine/threonine protein phosphat...  99.0    1e-20   
ref|XP_010932087.1|  PREDICTED: serine/threonine protein phosphat...  98.2    1e-20   
ref|XP_006357949.1|  PREDICTED: serine/threonine protein phosphat...  99.4    2e-20   
ref|XP_009409882.1|  PREDICTED: serine/threonine protein phosphat...  99.0    2e-20   
gb|EMS53921.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  99.4    2e-20   
tpg|DAA39803.1|  TPA: hypothetical protein ZEAMMB73_878468            99.0    2e-20   
ref|XP_010932086.1|  PREDICTED: serine/threonine protein phosphat...  97.8    2e-20   
gb|EMT31243.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  99.0    3e-20   
ref|XP_004489571.1|  PREDICTED: serine/threonine protein phosphat...  98.6    3e-20   
ref|XP_009418105.1|  PREDICTED: serine/threonine protein phosphat...  98.2    4e-20   
emb|CDP22081.1|  unnamed protein product                              96.7    4e-20   
ref|XP_008649389.1|  PREDICTED: serine/threonine protein phosphat...  97.8    4e-20   
ref|XP_004502334.1|  PREDICTED: serine/threonine protein phosphat...  98.2    4e-20   
ref|XP_002440704.1|  hypothetical protein SORBIDRAFT_09g005420        97.4    6e-20   
ref|XP_009377048.1|  PREDICTED: serine/threonine protein phosphat...  97.4    6e-20   
ref|XP_006287591.1|  hypothetical protein CARUB_v10000801mg           97.4    7e-20   
emb|CDY07942.1|  BnaC03g35810D                                        97.1    8e-20   
gb|KHG04678.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  97.1    8e-20   
ref|XP_009804411.1|  PREDICTED: serine/threonine protein phosphat...  97.1    8e-20   
gb|KHN44403.1|  Serine/threonine protein phosphatase 2A 59 kDa re...  97.1    1e-19   
ref|XP_003553562.1|  PREDICTED: serine/threonine protein phosphat...  96.3    1e-19   
ref|XP_010486565.1|  PREDICTED: serine/threonine protein phosphat...  96.7    1e-19   
ref|XP_006604586.1|  PREDICTED: serine/threonine protein phosphat...  96.3    1e-19   
gb|EMT28231.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  95.1    1e-19   
ref|XP_004955944.1|  PREDICTED: serine/threonine protein phosphat...  95.5    1e-19   
ref|XP_009370979.1|  PREDICTED: serine/threonine protein phosphat...  95.1    1e-19   
ref|XP_011402385.1|  Serine/threonine protein phosphatase 2A 59 k...  97.1    2e-19   
ref|XP_003538573.1|  PREDICTED: serine/threonine protein phosphat...  96.7    2e-19   
ref|NP_195967.1|  protein phosphatase 2A B' alpha                     96.3    2e-19   
ref|XP_008364197.1|  PREDICTED: serine/threonine protein phosphat...  96.3    2e-19   
ref|XP_010321335.1|  PREDICTED: serine/threonine protein phosphat...  94.7    2e-19   
gb|EYU38570.1|  hypothetical protein MIMGU_mgv1a005237mg              96.3    2e-19   
ref|XP_004955943.1|  PREDICTED: serine/threonine protein phosphat...  96.3    2e-19   
gb|KHG25533.1|  Serine/threonine phosphatase 2A 57 kDa regulatory...  96.3    2e-19   
gb|KJB46507.1|  hypothetical protein B456_007G372900                  95.5    2e-19   
ref|XP_006345841.1|  PREDICTED: serine/threonine protein phosphat...  95.5    2e-19   
ref|XP_008387532.1|  PREDICTED: serine/threonine protein phosphat...  95.9    2e-19   
ref|XP_003521415.1|  PREDICTED: serine/threonine protein phosphat...  95.5    2e-19   
gb|EEC82836.1|  hypothetical protein OsI_27645                        95.9    2e-19   
ref|XP_004156272.1|  PREDICTED: serine/threonine protein phosphat...  94.7    2e-19   
ref|XP_009604718.1|  PREDICTED: serine/threonine protein phosphat...  95.1    3e-19   
ref|XP_002871036.1|  hypothetical protein ARALYDRAFT_487124           95.5    3e-19   
gb|EYU32426.1|  hypothetical protein MIMGU_mgv1a005619mg              95.1    3e-19   
gb|KJB46506.1|  hypothetical protein B456_007G372900                  95.1    3e-19   
ref|XP_009768299.1|  PREDICTED: serine/threonine protein phosphat...  95.1    4e-19   
dbj|BAJ86218.1|  predicted protein                                    95.1    4e-19   
gb|EMT02137.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  95.1    4e-19   
gb|EMS68651.1|  Serine/threonine protein phosphatase 2A 57 kDa re...  95.1    4e-19   
ref|XP_010497141.1|  PREDICTED: serine/threonine protein phosphat...  94.4    4e-19   
ref|XP_004239706.1|  PREDICTED: serine/threonine protein phosphat...  94.7    4e-19   
ref|XP_002882642.1|  hypothetical protein ARALYDRAFT_478311           94.7    5e-19   
ref|XP_004502031.1|  PREDICTED: serine/threonine protein phosphat...  95.1    5e-19   
ref|XP_010267227.1|  PREDICTED: serine/threonine protein phosphat...  94.7    5e-19   
ref|XP_009358742.1|  PREDICTED: serine/threonine protein phosphat...  94.7    5e-19   
ref|XP_005852026.1|  hypothetical protein CHLNCDRAFT_55925            94.4    6e-19   
gb|KEH25427.1|  protein phosphatase 2A regulatory B subunit famil...  93.6    6e-19   
ref|XP_002519463.1|  protein phosphatase 2a, regulatory subunit, ...  94.7    6e-19   
ref|XP_010464647.1|  PREDICTED: serine/threonine protein phosphat...  94.7    6e-19   
ref|XP_010423705.1|  PREDICTED: serine/threonine protein phosphat...  94.7    6e-19   
ref|XP_010098803.1|  Serine/threonine protein phosphatase 2A 57 k...  94.7    6e-19   



>ref|XP_009797723.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana sylvestris]
Length=507

 Score =   278 bits (712),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 158/186 (85%), Gaps = 2/186 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQILAK+PRKS K DS D+SG+  NSCN+ TNSGNG+ FTNSC VIA RLNVVKR+S+
Sbjct  1    MLKQILAKLPRKSSKCDSFDTSGS--NSCNNTTNSGNGIPFTNSCTVIATRLNVVKRMST  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            AIFP SIVAG ES++PH+ FKDVSNGEKQ L +SKLNLCCS+YDF DPDK+  EKDLKRQ
Sbjct  59   AIFPTSIVAGNESVAPHVPFKDVSNGEKQSLFISKLNLCCSIYDFNDPDKDLTEKDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
            VLLELNDFVASGS + TESAIAAVC+MCAVNLFR FPPK    AR ESEDEE  FDPAW 
Sbjct  119  VLLELNDFVASGSARFTESAIAAVCKMCAVNLFRTFPPKSYLSARSESEDEEPMFDPAWC  178

Query  629  HLQLVY  646
            HLQLVY
Sbjct  179  HLQLVY  184



>ref|XP_006366869.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum tuberosum]
Length=506

 Score =   277 bits (708),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 143/186 (77%), Positives = 163/186 (88%), Gaps = 3/186 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQILAK+PRKS K D+ DSSG+  NSCN+ +N GNG+QFTNSC VIANRLNVVKR+S+
Sbjct  1    MLKQILAKLPRKSSKCDTFDSSGS--NSCNNTSNLGNGIQFTNSCTVIANRLNVVKRMST  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            AIFPASIV+GGES++PH+ FKDVSN EKQ L VSKLNLCC++YDF DPDK++AEKDLKRQ
Sbjct  59   AIFPASIVSGGESVAPHVPFKDVSNAEKQSLFVSKLNLCCTIYDFNDPDKDSAEKDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
            VLLELN+FVASGS + TESAIAAVC+MC VN+FR FPPK  S ARGESEDEE  FDPAW 
Sbjct  119  VLLELNEFVASGSARFTESAIAAVCKMCGVNMFRTFPPKYFS-ARGESEDEEPMFDPAWC  177

Query  629  HLQLVY  646
            HLQLVY
Sbjct  178  HLQLVY  183



>emb|CDP21530.1| unnamed protein product [Coffea canephora]
Length=519

 Score =   265 bits (676),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 157/194 (81%), Gaps = 3/194 (2%)
 Frame = +2

Query  68   IHWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLN  247
            + W  ATMLKQILAK+PRK LKSDSL S G+  +SCN   NS NG+QFTN+C+VI++RLN
Sbjct  7    VDWRPATMLKQILAKLPRKPLKSDSLTSVGS--DSCNTSPNSDNGIQFTNTCSVISSRLN  64

Query  248  VVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAA  427
            VVKR S AIFPASI+AGG+ + PH+ FKDV N +KQ L VSKLNLCC VYDF DP KN  
Sbjct  65   VVKRKSWAIFPASIIAGGDLVEPHVPFKDVPNADKQSLFVSKLNLCCLVYDFSDPGKNTK  124

Query  428  EKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHA-RGESEDEE  604
            EKDLK Q+LLEL DFVASGS K TESAIAA+C+MCAVNLFRDFPP+  SH  RGESE+EE
Sbjct  125  EKDLKHQILLELGDFVASGSAKFTESAIAAICKMCAVNLFRDFPPRYHSHVPRGESEEEE  184

Query  605  LFFDPAWYHLQLVY  646
              FDPAW HLQLVY
Sbjct  185  PLFDPAWSHLQLVY  198



>ref|XP_004251590.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313712.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313713.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313714.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
 ref|XP_010313715.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum lycopersicum]
Length=506

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 160/186 (86%), Gaps = 3/186 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQILAK+PRKS K D+ DSSG+  ++    +N GNG+QFTNSC VIANRLNVVKR+S+
Sbjct  1    MLKQILAKLPRKSSKCDTFDSSGSNSSNNT--SNLGNGIQFTNSCTVIANRLNVVKRMST  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            AIFPASIVAGGES++PH+ FKDVSN EKQ L VSKLNLCC++YDF DPDK++AEKDLKRQ
Sbjct  59   AIFPASIVAGGESVAPHVPFKDVSNAEKQSLFVSKLNLCCTIYDFNDPDKDSAEKDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
            VLLELN+FVASGS + TESAIAAVC+MC VN+FR FPPK  S ARGESEDEE  FDPAW 
Sbjct  119  VLLELNEFVASGSARFTESAIAAVCKMCGVNMFRTFPPKYFS-ARGESEDEEPMFDPAWC  177

Query  629  HLQLVY  646
            HLQLVY
Sbjct  178  HLQLVY  183



>ref|XP_009630828.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana tomentosiformis]
 ref|XP_009630829.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nicotiana tomentosiformis]
Length=507

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQILAK+PRKS K DS D+SG+   + N  TNSGNG+ F NSC VIA RLNVVKR+S+
Sbjct  1    MLKQILAKLPRKSSKCDSFDTSGSNSCNNN--TNSGNGIPFANSCTVIATRLNVVKRMST  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            AIFP SIVAGGES++PH+ FKDVSN EKQ L VSKLNLCCS+YDF DPDK++AEKDLKRQ
Sbjct  59   AIFPTSIVAGGESVAPHIPFKDVSNAEKQSLFVSKLNLCCSIYDFNDPDKDSAEKDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
            VLLELNDFVASGS + TE+AIAAVC+MCAVNLFR FPPK    ARGESEDEE  FDPAW 
Sbjct  119  VLLELNDFVASGSARFTETAIAAVCKMCAVNLFRTFPPKSYLSARGESEDEEPMFDPAWC  178

Query  629  HLQLVY  646
            HLQLVY
Sbjct  179  HLQLVY  184



>ref|XP_007013281.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 2 [Theobroma cacao]
 gb|EOY30900.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 2 [Theobroma cacao]
Length=506

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 151/187 (81%), Gaps = 3/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G   +S N  +NSGNG+Q TN  N I++RL+VVKRVSS
Sbjct  1    MLKQILSKLPRKSQKSDSLDSAGI--DSGNQTSNSGNGVQCTNIGNSISSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+AG E++ P+L FKDVSN +KQ L +SKLNLCC V DF DPDK  AE+DLKRQ
Sbjct  59   AVFPASIMAGVEAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSDPDKTNAEQDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDPAW  625
             L+EL DFV+SGS K  E AIAA+C+MCA+NLFR FPPK  S++  GE+EDEE  FDPAW
Sbjct  119  TLIELVDFVSSGSAKFNEPAIAAMCKMCAINLFRVFPPKYRSNSTSGEAEDEEPMFDPAW  178

Query  626  YHLQLVY  646
             +LQLVY
Sbjct  179  SNLQLVY  185



>ref|XP_010656380.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 ref|XP_010656381.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 emb|CBI28127.3| unnamed protein product [Vitis vinifera]
Length=534

 Score =   226 bits (576),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 148/199 (74%), Gaps = 11/199 (6%)
 Frame = +2

Query  53   RFDLYIHWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI  232
            RF    HW  ATM+KQIL+K+PRKS KSD+L S+G+     N+ TN G+ +Q +N     
Sbjct  24   RFPSVQHWGIATMIKQILSKLPRKSSKSDTLASAGS---DSNNNTNLGSSIQCSNG----  76

Query  233  ANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDP  412
               LNVV+R+SSA+FP+ + AG E++ PHL FKDV N EKQ L VSKLNLCC VY F DP
Sbjct  77   ---LNVVRRMSSAVFPSMVAAGAEAVEPHLSFKDVPNTEKQKLFVSKLNLCCVVYHFNDP  133

Query  413  DKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GE  589
            DK+ AEKD KRQ L+EL DFVASGS K +E+AIAA C+MCA+NLFRDFPPK  S++  GE
Sbjct  134  DKDQAEKDSKRQALIELVDFVASGSAKFSEAAIAATCKMCAINLFRDFPPKYRSNSTGGE  193

Query  590  SEDEELFFDPAWYHLQLVY  646
            +EDEE  FDPAW HLQ+VY
Sbjct  194  TEDEEPMFDPAWSHLQIVY  212



>ref|XP_007013280.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 1 [Theobroma cacao]
 gb|EOY30899.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform 1 [Theobroma cacao]
Length=545

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 152/189 (80%), Gaps = 3/189 (2%)
 Frame = +2

Query  83   ATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRV  262
            + MLKQIL+K+PRKS KSDSLDS+G   +S N  +NSGNG+Q TN  N I++RL+VVKRV
Sbjct  38   SIMLKQILSKLPRKSQKSDSLDSAGI--DSGNQTSNSGNGVQCTNIGNSISSRLSVVKRV  95

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPASI+AG E++ P+L FKDVSN +KQ L +SKLNLCC V DF DPDK  AE+DLK
Sbjct  96   SSAVFPASIMAGVEAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSDPDKTNAEQDLK  155

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDP  619
            RQ L+EL DFV+SGS K  E AIAA+C+MCA+NLFR FPPK  S++  GE+EDEE  FDP
Sbjct  156  RQTLIELVDFVSSGSAKFNEPAIAAMCKMCAINLFRVFPPKYRSNSTSGEAEDEEPMFDP  215

Query  620  AWYHLQLVY  646
            AW +LQLVY
Sbjct  216  AWSNLQLVY  224



>gb|KDP32329.1| hypothetical protein JCGZ_13254 [Jatropha curcas]
Length=503

 Score =   220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 143/187 (76%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+KIPRKS KSD         +S N  TN GNG+  TNS N  ++RLNVVKRVSS
Sbjct  1    MLKQILSKIPRKSSKSD-----PLDSDSGNSSTNWGNGIPCTNSGNSFSSRLNVVKRVSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI++G E++ PHL FKDVSN +KQ L VSKLN CC V DF DPDK AA+++LKRQ
Sbjct  56   AVFPASIMSGAEAVEPHLSFKDVSNMQKQNLFVSKLNFCCEVCDFSDPDKLAAQQELKRQ  115

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS-HARGESEDEELFFDPAW  625
             L++L DFV+SGS K TESA+AA+C+MC++NLFR FPPKC S +  GE+EDEE  FDP W
Sbjct  116  TLMDLVDFVSSGSAKFTESAMAAMCKMCSMNLFRVFPPKCRSNNTGGETEDEEPIFDPDW  175

Query  626  YHLQLVY  646
             +LQ VY
Sbjct  176  SYLQCVY  182



>gb|KJB54144.1| hypothetical protein B456_009G022600 [Gossypium raimondii]
 gb|KJB54145.1| hypothetical protein B456_009G022600 [Gossypium raimondii]
Length=507

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G   +S N  +NS NG+Q TN  N I +RL+VVKRVSS
Sbjct  1    MLKQILSKLPRKSQKSDSLDSAGL--DSGNHTSNSSNGVQCTNIGNSITSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+AG E++ P+L FKDVSN +KQ L +SKLNLCC V DF DP+K ++E+DLKRQ
Sbjct  59   AVFPASIMAGVEAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSDPEKASSEQDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGESEDEELFFDPAW  625
             L+EL DFV+SGS K  E A+AA+C+MCAVNLFR FPPK  S+ + GE+ED+E  FDPAW
Sbjct  119  TLIELVDFVSSGSAKFNEPAVAAMCKMCAVNLFRVFPPKYRSNTSSGEAEDDEPMFDPAW  178

Query  626  YHLQLVY  646
             +LQLVY
Sbjct  179  SNLQLVY  185



>gb|KEH32096.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=391

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 141/186 (76%), Gaps = 2/186 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     N  T+ GN  Q TN  + I+++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKLPKSDSSDSAKSDSG--NSTTSFGNVFQCTNVGSTISSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC VYD  DPDKN  E+D+KRQ
Sbjct  59   VVFPASMNAGVEAVDPSLSFKDVSNTQKQSLFISKLNLCCKVYDMSDPDKNCTEQDVKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
             LL+L DFV+SGSVK TE AIAA+C+MCA NLFR FPPK  S + GE+EDEE  FDPAW 
Sbjct  119  TLLDLVDFVSSGSVKFTEPAIAALCKMCATNLFRVFPPKFRSSSGGETEDEEPMFDPAWS  178

Query  629  HLQLVY  646
            HLQ+VY
Sbjct  179  HLQVVY  184



>gb|KJB64864.1| hypothetical protein B456_010G068400 [Gossypium raimondii]
Length=496

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 145/187 (78%), Gaps = 3/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL K+PRK  KSD LDSSG+  +S N  +NSGNG+Q TN  N I++RL+VVKRVSS
Sbjct  1    MLKQILIKLPRKLQKSDLLDSSGS--DSGNHTSNSGNGVQCTNIGNSISSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+ G E++ P+L F DVS  +KQ L +SKLNLCC V DF DPDK +AE+DLK Q
Sbjct  59   AVFPASIMVGVEAVEPYLSFTDVSILQKQSLFISKLNLCCEVSDFSDPDKTSAEQDLKHQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHA-RGESEDEELFFDPAW  625
             L+EL DFV++GS K  E AIAA+C+MCAVNLFR FPPK  S++  GE EDEE  FDP+W
Sbjct  119  TLIELVDFVSTGSAKFNEPAIAAMCKMCAVNLFRVFPPKYRSNSISGEVEDEEPMFDPSW  178

Query  626  YHLQLVY  646
             +LQLVY
Sbjct  179  SNLQLVY  185



>gb|AFK37737.1| unknown [Medicago truncatula]
Length=510

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 141/186 (76%), Gaps = 2/186 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     N  T+ GN  Q TN  + I+++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKLPKSDSSDSAKSDSG--NSTTSFGNVFQCTNVGSTISSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC VYD  DPDKN  E+D+KRQ
Sbjct  59   VVFPASMNAGVEAVDPSLSFKDVSNTQKQSLFISKLNLCCKVYDMSDPDKNCTEQDVKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
             LL+L DFV+SGSVK TE AIAA+C+MCA NLFR FPPK  S + GE+EDEE  FDPAW 
Sbjct  119  TLLDLVDFVSSGSVKFTEPAIAALCKMCATNLFRVFPPKFRSSSGGETEDEEPMFDPAWS  178

Query  629  HLQLVY  646
            HLQ+VY
Sbjct  179  HLQVVY  184



>ref|XP_003609196.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES91393.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=510

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 141/186 (76%), Gaps = 2/186 (1%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     N  T+ GN  Q TN  + I+++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKLPKSDSSDSAKSDSG--NSTTSFGNVFQCTNVGSTISSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC VYD  DPDKN  E+D+KRQ
Sbjct  59   VVFPASMNAGVEAVDPSLSFKDVSNTQKQSLFISKLNLCCKVYDMSDPDKNCTEQDVKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
             LL+L DFV+SGSVK TE AIAA+C+MCA NLFR FPPK  S + GE+EDEE  FDPAW 
Sbjct  119  TLLDLVDFVSSGSVKFTEPAIAALCKMCATNLFRVFPPKFRSSSGGETEDEEPMFDPAWS  178

Query  629  HLQLVY  646
            HLQ+VY
Sbjct  179  HLQVVY  184



>gb|KHG08948.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=507

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 148/187 (79%), Gaps = 3/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G   +S N  +N  NG+Q TN  N I +RL+VVKRVSS
Sbjct  1    MLKQILSKLPRKSQKSDSLDSAGL--DSGNHTSNLSNGVQCTNIGNSITSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+AG E++ P+L FKDVSN +KQ L +SKLNLCC V DF DP+K ++E+DLKRQ
Sbjct  59   AVFPASIMAGVEAVEPNLSFKDVSNPQKQNLFISKLNLCCEVSDFSDPEKASSEQDLKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGESEDEELFFDPAW  625
             L+EL DFV+SGS K  E A+AA+C+MCA+NLFR FPPK  S+ + GE+ED+E  FDPAW
Sbjct  119  TLIELVDFVSSGSAKFNEPAVAAMCKMCALNLFRVFPPKYRSNTSSGEAEDDEPIFDPAW  178

Query  626  YHLQLVY  646
              LQLVY
Sbjct  179  SSLQLVY  185



>ref|XP_002515563.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF47012.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=543

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 144/189 (76%), Gaps = 4/189 (2%)
 Frame = +2

Query  83   ATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRV  262
             TMLKQIL+KIPRKS KS+S DS+G +  S N+ +N GNG+  TN  N  ++RLNVVKRV
Sbjct  39   GTMLKQILSKIPRKSSKSESFDSAGIE--SGNNSSNWGNGVPCTNGGNSFSSRLNVVKRV  96

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPASI+AG E++ PHL FKDVSN +KQ L +SKLN CC   DF DPDKNAA++DLK
Sbjct  97   SSAVFPASIMAGVEAVEPHLSFKDVSNVQKQSLFISKLNFCCE-SDFSDPDKNAAQQDLK  155

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS-HARGESEDEELFFDP  619
             Q L+EL DFV+SG  K  E A+AA+C++CA+NLFR FPPK  S +  GE+EDEE  FDP
Sbjct  156  GQTLIELVDFVSSGGAKFNEPAMAAMCKLCAINLFRVFPPKYRSANTAGETEDEEPMFDP  215

Query  620  AWYHLQLVY  646
             W HLQ VY
Sbjct  216  DWSHLQCVY  224



>ref|XP_003524519.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Glycine max]
 ref|XP_006579740.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Glycine max]
 gb|KHN15139.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Glycine soja]
Length=515

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 142/187 (76%), Gaps = 4/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     ++ T  GN  Q TN  + I+++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKVPKSDSSDSARS---DSSNTTTFGNVFQCTNVGSTISSKLNVVKRVSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC +YD  DPDKN AE+DLKRQ
Sbjct  58   VVFPASMSAGVEAVDPGLSFKDVSNTQKQSLFISKLNLCCKLYDMSDPDKNTAEQDLKRQ  117

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC-ASHARGESEDEELFFDPAW  625
             LLEL DFV+SGSVK TE AIAA+C+MCA NLFR FPPK   S + GE+EDEE  FDPAW
Sbjct  118  TLLELVDFVSSGSVKFTEPAIAALCKMCATNLFRVFPPKFRTSTSGGETEDEEPMFDPAW  177

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  178  SHLQVVY  184



>gb|KHG22084.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=496

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL K+PRK  KSD LDSSG+  +S N  +N GNG++ TN  N +++RL+VVKRVSS
Sbjct  1    MLKQILIKLPRKLQKSDLLDSSGS--DSGNHTSNLGNGVECTNIGNSMSSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+ G E++ P+L F DVS  +KQ L +SKLNLCC V DF DPDK +AE+DLK Q
Sbjct  59   AVFPASIMVGVEAVEPNLSFTDVSILQKQSLFISKLNLCCEVSDFSDPDKTSAEQDLKHQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHA-RGESEDEELFFDPAW  625
             L+EL DFV++GS K  E AIAA+C+MCAVNLFR FPPK  S++  GE EDEE  FDP+W
Sbjct  119  TLIELVDFVSTGSTKFNEPAIAAMCKMCAVNLFRVFPPKYWSNSISGEVEDEEPMFDPSW  178

Query  626  YHLQLVY  646
             +LQLVY
Sbjct  179  SNLQLVY  185



>ref|XP_006451050.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 ref|XP_006475756.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Citrus sinensis]
 gb|ESR64290.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 gb|KDO80417.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=537

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 147/194 (76%), Gaps = 5/194 (3%)
 Frame = +2

Query  68   IHWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLN  247
            +H  F TMLKQIL+K+PRKS KSD LD   +  N+    +N  NG Q TN  N +++RL+
Sbjct  27   LHSQFPTMLKQILSKLPRKSPKSDQLDEINSGSNN----SNFSNGSQCTNGGNGLSSRLS  82

Query  248  VVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAA  427
            VVKRVSSA+FP+SI+AG E++ PHL FKDVSN +KQ L VSKLNLCC V DF D DK  A
Sbjct  83   VVKRVSSAVFPSSIMAGVEAVEPHLSFKDVSNTQKQNLFVSKLNLCCEVSDFSDSDKVTA  142

Query  428  EKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEE  604
            E+DLKRQ L+EL DFV+SGS K TE AI+ +C+MC++NLFR FPPKC S+   GE+EDEE
Sbjct  143  EQDLKRQTLIELADFVSSGSAKFTEPAISGMCKMCSLNLFRVFPPKCRSNGTGGETEDEE  202

Query  605  LFFDPAWYHLQLVY  646
              FDPAW HLQ+VY
Sbjct  203  PMFDPAWSHLQIVY  216



>ref|XP_010249885.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
Length=503

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 141/187 (75%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQ L+++PRKS KSD+ D++G+  NS N+   +GNG+Q TNS N  + R + VK++SS
Sbjct  1    MLKQFLSRLPRKSAKSDAADTAGS--NSVNNAATTGNGIQRTNSGNASSGRSSAVKKMSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS++AG   I P L FKDV N EKQ L +SKLNLCC V+DF DP+KN AEKDLKRQ
Sbjct  59   AVFPASVIAG---IEPLLSFKDVPNPEKQNLFISKLNLCCVVFDFNDPNKNTAEKDLKRQ  115

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDPAW  625
             L+EL +FV SGS K  E AI+A+C+M AVNLFR FPP   S++  GE+EDEE  FDPAW
Sbjct  116  TLIELVEFVGSGSAKFNEPAISAICKMTAVNLFRVFPPNYRSNSTGGETEDEEPMFDPAW  175

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  176  SHLQIVY  182



>ref|XP_003549794.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoformX1 [Glycine max]
 ref|XP_006600772.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Glycine max]
 ref|XP_006600773.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X3 [Glycine max]
Length=514

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 140/187 (75%), Gaps = 4/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     ++ T  GN  Q TN  + I+++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKVPKSDSSDSARS---DSSNTTTFGNVFQCTNVGSTISSKLNVVKRVSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC VYD  DPDKN  E+DLKR+
Sbjct  58   VVFPASMSAGVEAVDPCLSFKDVSNTQKQSLFISKLNLCCKVYDMSDPDKNTTEQDLKRK  117

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC-ASHARGESEDEELFFDPAW  625
             LLEL D+V+SGSVK TE AIAA+C+MCA NLFR FPPK   S   GE+EDEE  FDPAW
Sbjct  118  TLLELVDYVSSGSVKFTEPAIAALCKMCATNLFRAFPPKFRTSTTGGETEDEEPIFDPAW  177

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  178  SHLQVVY  184



>ref|XP_002324961.1| hypothetical protein POPTR_0018s06320g [Populus trichocarpa]
 gb|EEF03526.1| hypothetical protein POPTR_0018s06320g [Populus trichocarpa]
Length=497

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 141/187 (75%), Gaps = 6/187 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+KIPRK  KSD LDS+G   +  ND T SG     TN  N  ++RLNVVKRVSS
Sbjct  1    MLKQILSKIPRKFPKSDPLDSTGI--DCGNDSTCSGPP---TNGGNSFSSRLNVVKRVSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+AG E++ PHL FKDVSN +KQ L VSKLNLCC V D  DPDKNA ++DLK Q
Sbjct  56   AVFPASIMAGMEAVDPHLSFKDVSNLQKQNLFVSKLNLCCEVSDCSDPDKNAVQQDLKHQ  115

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS-HARGESEDEELFFDPAW  625
            VL++L DFV+SGS K TE AIAA+C+MCA NLFR FPPK  + +  GE+EDEE  FDPAW
Sbjct  116  VLIDLVDFVSSGSAKFTEPAIAAICKMCANNLFRVFPPKYRTVNTGGETEDEEPMFDPAW  175

Query  626  YHLQLVY  646
             HLQ VY
Sbjct  176  SHLQSVY  182



>ref|XP_004508562.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cicer arietinum]
Length=511

 Score =   209 bits (533),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 141/187 (75%), Gaps = 3/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DS+ +     N  T  GN  Q TN  + I+++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKLPKSDSSDSARSDSG--NSTTTFGNVFQCTNVGSTISSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC VYD  DPDKN  E+D+KRQ
Sbjct  59   VVFPASMSAGVEAVDPSLSFKDVSNTQKQNLFISKLNLCCKVYDMSDPDKNCTEQDVKRQ  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC-ASHARGESEDEELFFDPAW  625
             LL+L DFV+SGSVK TE AIAA+C+MC+ NLFR FPPK  +S + GE+ED+E  FDPAW
Sbjct  119  TLLDLVDFVSSGSVKFTEPAIAALCKMCSTNLFRVFPPKFRSSTSGGETEDDEPMFDPAW  178

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  179  SHLQVVY  185



>ref|XP_011010867.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like, partial [Populus euphratica]
Length=557

 Score =   210 bits (535),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 141/190 (74%), Gaps = 6/190 (3%)
 Frame = +2

Query  80   FATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKR  259
               MLKQIL+KIPRK  KSD LDS+G   +  ND T SG     TN  N  ++RLNVVKR
Sbjct  58   ITAMLKQILSKIPRKFPKSDPLDSTGI--DCGNDSTCSGPS---TNGGNSFSSRLNVVKR  112

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
            VSSA+FPASI+AG E++ PHL FKDVSN +KQ L VSKLNLCC V D  DPDKNA ++DL
Sbjct  113  VSSAVFPASIMAGMEAVDPHLSFKDVSNLQKQNLFVSKLNLCCEVSDCSDPDKNAVQQDL  172

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS-HARGESEDEELFFD  616
            K QVL++L DFV+SGS K TE AIAA+C+MCA NLFR FPPK  + +  GE+EDEE  FD
Sbjct  173  KHQVLIDLVDFVSSGSAKFTEPAIAAICKMCANNLFRVFPPKYRTVNTGGETEDEEPMFD  232

Query  617  PAWYHLQLVY  646
            PAW HLQ VY
Sbjct  233  PAWSHLQSVY  242



>ref|XP_007155131.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 ref|XP_007155132.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 gb|ESW27125.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
 gb|ESW27126.1| hypothetical protein PHAVU_003G176100g [Phaseolus vulgaris]
Length=509

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 4/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL+K+P+K  KSDS DSS +  ++    T+ GN  Q TN  + I+++LNVVKRVSS
Sbjct  1    MIKQILSKLPKKVPKSDSSDSSRSDSSNS---TSFGNVFQCTNVGSTISSKLNVVKRVSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+ AG E++ P L FKDVSN +KQ L +SKLNLCC +YD  DPDK+++E+DLKRQ
Sbjct  58   VVFPASMSAGVEAVDPCLSFKDVSNTQKQSLFISKLNLCCKIYDMSDPDKSSSEQDLKRQ  117

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC-ASHARGESEDEELFFDPAW  625
             LLEL DFV+SGSVK TE AIAA+C+MCA NLFR FPPK   S A GE+EDEE  FDPAW
Sbjct  118  TLLELVDFVSSGSVKFTEPAIAALCKMCATNLFRVFPPKFRTSTAGGETEDEEPMFDPAW  177

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  178  SHLQVVY  184



>gb|KDO80420.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=402

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 145/187 (78%), Gaps = 5/187 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KSD LD    + NS ++ +N  NG Q TN  N +++RL+VVKRVSS
Sbjct  1    MLKQILSKLPRKSPKSDQLD----EINSGSNNSNFSNGSQCTNGGNGLSSRLSVVKRVSS  56

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI+AG E++ PHL FKDVSN +KQ L VSKLNLCC V DF D DK  AE+DLKRQ
Sbjct  57   AVFPSSIMAGVEAVEPHLSFKDVSNTQKQNLFVSKLNLCCEVSDFSDSDKVTAEQDLKRQ  116

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDPAW  625
             L+EL DFV+SGS K TE AI+ +C+MC++NLFR FPPKC S+   GE+EDEE  FDPAW
Sbjct  117  TLIELADFVSSGSAKFTEPAISGMCKMCSLNLFRVFPPKCRSNGTGGETEDEEPMFDPAW  176

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  177  SHLQIVY  183



>ref|XP_006451049.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 ref|XP_006475757.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Citrus sinensis]
 gb|ESR64289.1| hypothetical protein CICLE_v10007952mg [Citrus clementina]
 gb|KDO80418.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
 gb|KDO80419.1| hypothetical protein CISIN_1g009349mg [Citrus sinensis]
Length=504

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 143/187 (76%), Gaps = 5/187 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KSD LD   +  N+    +N  NG Q TN  N +++RL+VVKRVSS
Sbjct  1    MLKQILSKLPRKSPKSDQLDEINSGSNN----SNFSNGSQCTNGGNGLSSRLSVVKRVSS  56

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI+AG E++ PHL FKDVSN +KQ L VSKLNLCC V DF D DK  AE+DLKRQ
Sbjct  57   AVFPSSIMAGVEAVEPHLSFKDVSNTQKQNLFVSKLNLCCEVSDFSDSDKVTAEQDLKRQ  116

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDPAW  625
             L+EL DFV+SGS K TE AI+ +C+MC++NLFR FPPKC S+   GE+EDEE  FDPAW
Sbjct  117  TLIELADFVSSGSAKFTEPAISGMCKMCSLNLFRVFPPKCRSNGTGGETEDEEPMFDPAW  176

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  177  SHLQIVY  183



>gb|KCW82763.1| hypothetical protein EUGRSUZ_C04140 [Eucalyptus grandis]
Length=405

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 132/187 (71%), Gaps = 7/187 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL KIPRKS K        +Q  + NDP ++ NG Q        ++R NVVKRVSS
Sbjct  1    MLKQILNKIPRKSPKG------DSQDTAGNDPGDNSNGFQCMIGGGTFSSRFNVVKRVSS  54

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS++ G +++ P + FKDVSN +KQ L VSKLN CC VYDF DPDKN  E + K +
Sbjct  55   AVFPASMMTGLDAVEPFMSFKDVSNSQKQNLFVSKLNFCCKVYDFNDPDKNCTEINSKHE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDPAW  625
            +L+EL +FV+SGS K  E AIAA+C+MCA+NLFR FPPK  S+   GE+ED+E  FDPAW
Sbjct  115  ILVELVEFVSSGSAKFNEMAIAAMCKMCAINLFRVFPPKYRSNGSGGETEDDEPMFDPAW  174

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  175  SHLQIVY  181



>ref|XP_010098941.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
 gb|EXB76243.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
Length=736

 Score =   209 bits (532),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 143/191 (75%), Gaps = 7/191 (4%)
 Frame = +2

Query  77   SFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVK  256
            S ATMLKQIL+K+PRKS KSD LD  GA  +S ++ +  GNG Q T   + ++++LNVVK
Sbjct  220  SIATMLKQILSKLPRKSPKSDLLD--GAGSDSGSNSSKLGNGFQCTIGGSSLSSKLNVVK  277

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            RVSSA+FPASI AG E + PHL FKDVSN +KQ L +SKLNLCC V D+ D    + ++D
Sbjct  278  RVSSAVFPASITAGAEVVEPHLSFKDVSNPQKQNLFISKLNLCCEVVDYND----SVKQD  333

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC-ASHARGESEDEELFF  613
            LKR  L+EL DFV+SGS K TESAI+A+C+MCA NLFR FPPK  +S   GE+EDEE  F
Sbjct  334  LKRDTLIELVDFVSSGSAKLTESAISAMCKMCAANLFRVFPPKYRSSSTGGETEDEEPVF  393

Query  614  DPAWYHLQLVY  646
            DPAW HLQ+VY
Sbjct  394  DPAWSHLQIVY  404



>ref|XP_010049936.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Eucalyptus grandis]
 gb|KCW82762.1| hypothetical protein EUGRSUZ_C04140 [Eucalyptus grandis]
Length=505

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 132/187 (71%), Gaps = 7/187 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL KIPRKS K        +Q  + NDP ++ NG Q        ++R NVVKRVSS
Sbjct  1    MLKQILNKIPRKSPKG------DSQDTAGNDPGDNSNGFQCMIGGGTFSSRFNVVKRVSS  54

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS++ G +++ P + FKDVSN +KQ L VSKLN CC VYDF DPDKN  E + K +
Sbjct  55   AVFPASMMTGLDAVEPFMSFKDVSNSQKQNLFVSKLNFCCKVYDFNDPDKNCTEINSKHE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDPAW  625
            +L+EL +FV+SGS K  E AIAA+C+MCA+NLFR FPPK  S+   GE+ED+E  FDPAW
Sbjct  115  ILVELVEFVSSGSAKFNEMAIAAMCKMCAINLFRVFPPKYRSNGSGGETEDDEPMFDPAW  174

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  175  SHLQIVY  181



>gb|KJB83138.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83139.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83140.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
 gb|KJB83141.1| hypothetical protein B456_013G231300 [Gossypium raimondii]
Length=506

 Score =   202 bits (514),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL K+PRKS KSDSLDS+G   +S N  +NS +G+Q TN  N I++RL VVKRVSS
Sbjct  1    MIKQILRKLPRKSQKSDSLDSAGN--DSDNHASNSDDGVQCTNFGNKISSRLRVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+AG E++ P+L F +VSN +K  L +SKLNLCC   +  DPDK  AE+DLKR+
Sbjct  59   AVFPASIMAGVEAVEPNLSFNNVSNPQKPNLFISKLNLCCEACNSSDPDKGTAEQDLKRR  118

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGESEDEELFFDPAW  625
             L+EL DFV+SGS K  E+AIAA+C+MCA+NLFR FPPK  S+ A GE++DEE  FDPAW
Sbjct  119  TLIELVDFVSSGSAKFNEAAIAAMCKMCAINLFRVFPPKYRSNTASGEADDEEPMFDPAW  178

Query  626  YHLQLVY  646
              LQLVY
Sbjct  179  SSLQLVY  185



>ref|XP_007138335.1| hypothetical protein PHAVU_009G200100g [Phaseolus vulgaris]
 gb|ESW10329.1| hypothetical protein PHAVU_009G200100g [Phaseolus vulgaris]
Length=506

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 138/187 (74%), Gaps = 4/187 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+P+K  KSD+ D   AQ +S    T   N  Q TN    I+N+LN VKRVSS
Sbjct  1    MLKQILSKLPKKVPKSDTSD--SAQSDS-GSATTFANVFQCTNVGVAISNKLNAVKRVSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+ AG E++ PH+ FKDVSN +K  L +SKLNLCCSVY+   PDKN  E+D+K Q
Sbjct  58   AVFPASLSAGVEAVDPHVSFKDVSNIQKHNLFISKLNLCCSVYNINYPDKNCKEEDVKHQ  117

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC-ASHARGESEDEELFFDPAW  625
             L+EL DFV+SGS K TE +IAA+C+MCA NLFR FPPK  AS + GE+EDEEL FDP+W
Sbjct  118  TLVELVDFVSSGSAKFTEPSIAAMCKMCASNLFRVFPPKFRASASGGETEDEELMFDPSW  177

Query  626  YHLQLVY  646
             +L++VY
Sbjct  178  SNLKIVY  184



>ref|XP_010254226.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
 ref|XP_010254227.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Nelumbo nucifera]
Length=507

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 139/191 (73%), Gaps = 10/191 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNG----MQFTNSCNVIANRLNVVK  256
            MLKQ L+++PRKS KSD+ D++G+  NS N+   +GNG    +Q TNS N  + R N VK
Sbjct  1    MLKQFLSRLPRKSFKSDAADTAGS--NSGNNTAAAGNGASNGIQRTNSGNAASGRSNAVK  58

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            ++SSA+FPAS+VAG   I P L FKDV N EKQ L +SKLNLCC V+DF DP +++AEKD
Sbjct  59   KMSSAVFPASVVAG---IEPLLSFKDVPNQEKQNLFISKLNLCCVVFDFNDPIQDSAEKD  115

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFF  613
            LKRQ LLEL +FV SGS +  E AIAAVC+M   NLFR FPP   S++  GE+EDEE  F
Sbjct  116  LKRQTLLELVEFVGSGSARLNEPAIAAVCKMVVANLFRVFPPNYRSNSTGGENEDEEPMF  175

Query  614  DPAWYHLQLVY  646
            DPAW HLQ+VY
Sbjct  176  DPAWSHLQVVY  186



>ref|XP_008242686.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
 ref|XP_008242687.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
 ref|XP_008242688.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Prunus mume]
Length=502

 Score =   195 bits (496),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 140/187 (75%), Gaps = 7/187 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G+   S N P N GNG Q T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSPKSDSLDSAGSDSGS-NTP-NLGNGFQCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFIDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGESEDEELFFDPAW  625
             L+EL DFV+SGS K +E AI+A+C+MCA+NLFR FPPK  S+   GE++DEE  FDPAW
Sbjct  115  TLIELVDFVSSGSAKFSEPAISALCKMCAMNLFRVFPPKYRSNFTGGETDDEEPLFDPAW  174

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  175  SHLQIVY  181



>ref|XP_007204385.1| hypothetical protein PRUPE_ppa004572mg [Prunus persica]
 gb|EMJ05584.1| hypothetical protein PRUPE_ppa004572mg [Prunus persica]
Length=502

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 140/187 (75%), Gaps = 7/187 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G+   S N P N GNG Q T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSPKSDSLDSAGSDSGS-NTP-NLGNGFQCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFIDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGESEDEELFFDPAW  625
             L+EL DFV+SGS K +E AI+A+C+MCA+NLFR FPPK  S+   GE++DEE  FDPAW
Sbjct  115  TLIELVDFVSSGSAKFSEPAISALCKMCAMNLFRVFPPKYRSNFTGGETDDEEPLFDPAW  174

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  175  SHLQIVY  181



>ref|XP_008337354.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=502

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 142/187 (76%), Gaps = 7/187 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G+  +S N+  N G+G Q T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSSKSDSLDSAGS--DSGNNTPNLGSGFQCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHSLFISKLNLCCEFVDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGESEDEELFFDPAW  625
             L+EL D+V+SG+VK TE AI+AVC+MCAVNLFR FPPK  S+   GE++DEE  FDP+W
Sbjct  115  TLIELVDYVSSGTVKFTEPAISAVCKMCAVNLFRVFPPKYRSNFTGGETDDEEPMFDPSW  174

Query  626  YHLQLVY  646
             +LQ+VY
Sbjct  175  SYLQIVY  181



>ref|XP_004287389.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Fragaria vesca subsp. 
vesca]
Length=502

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 129/187 (69%), Gaps = 8/187 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K PRK           A  +S N+    G+G Q T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKFPRKPKSESLD---SAGSDSGNNSPILGSGFQCTIGGSSLTSKLNVVKRVSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI AG E + PHL FK+VSN +KQ L +SKLN+CC + D  DP K    +DLKR+
Sbjct  58   AVFPASIAAGAEVVEPHLSFKEVSNPQKQNLFISKLNVCCEIIDSSDPVK----QDLKRE  113

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGESEDEELFFDPAW  625
             L+EL DFV+SGS K TE AI+A+C+MCA NLFR FPPK  S+   GE+EDEE  FDPAW
Sbjct  114  TLIELVDFVSSGSAKFTEPAISAMCKMCATNLFRVFPPKYRSNFTGGETEDEEPMFDPAW  173

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  174  SHLQIVY  180



>ref|XP_009371422.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=502

 Score =   193 bits (491),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 141/187 (75%), Gaps = 7/187 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS G+  +S ++ +N G+G   T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSSKSDSLDSIGS--DSGSNTSNLGSGFPCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFVDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGESEDEELFFDPAW  625
             L+EL D+V+SG+VK TE AI+AVC+MCAVNLFR FPPK  S+   GE+EDEE  FDPAW
Sbjct  115  TLIELVDYVSSGTVKFTEPAISAVCKMCAVNLFRVFPPKYRSNFTGGETEDEEPMFDPAW  174

Query  626  YHLQLVY  646
             +LQ+VY
Sbjct  175  SYLQIVY  181



>ref|XP_008386225.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
 ref|XP_008343968.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
 ref|XP_008362926.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=502

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 140/187 (75%), Gaps = 7/187 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS K DSLDS G+  +S ++ +N G+G   T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSSKCDSLDSIGS--DSGSNTSNLGSGFPCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHNLFISKLNLCCEFVDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGESEDEELFFDPAW  625
             L+EL D+V+SG+VK TE AI+AVC+MCAVNLFR FPPK  S+   GE+EDEE  FDPAW
Sbjct  115  TLIELVDYVSSGTVKFTEPAISAVCKMCAVNLFRVFPPKYRSNFTGGETEDEEPMFDPAW  174

Query  626  YHLQLVY  646
             +LQ+VY
Sbjct  175  SYLQIVY  181



>ref|XP_009374054.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=502

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 142/187 (76%), Gaps = 7/187 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KSDSLDS+G++  S N P N G+G Q T   + + ++LNVVKRVSS
Sbjct  1    MLKQILSKLPRKSSKSDSLDSAGSESGS-NTP-NLGSGFQCTIGGSSLTSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+SI AG E++ PHL FK+VSN +K  L +SKLNLCC   D  DP K    +DLKR+
Sbjct  59   AVFPSSIAAGAEAVEPHLSFKEVSNPQKHSLFISKLNLCCEFVDSSDPVK----QDLKRE  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGESEDEELFFDPAW  625
             L+EL D+V+SG+VK TE AI+A+C+MCAVNLFR FPPK  S+   GE++DEE  FDP+W
Sbjct  115  TLIELVDYVSSGTVKFTEPAISALCKMCAVNLFRVFPPKYRSNFTGGETDDEEPMFDPSW  174

Query  626  YHLQLVY  646
             +LQ+VY
Sbjct  175  SYLQIVY  181



>ref|XP_004163599.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
Length=500

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 135/187 (72%), Gaps = 9/187 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+P+K  KS+++D   A   S N+ +  G+  Q TN  +  +++LNVVKRVSS
Sbjct  1    MLKQILSKLPKKLQKSETVD--SATNESGNNTSRLGHVFQCTNVGSAFSSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI A  E++ PHL FKDV N +KQ L VSKLN CC V+D  D +K    +DLKRQ
Sbjct  59   AVFPASIAA--EAVDPHLSFKDVPNPQKQNLFVSKLNYCCEVFDLNDMEK----QDLKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDPAW  625
            +L+++ DFV SGS K TE+AI++VC++CA NLFR FPPK  S +  GE+EDEE  FDPAW
Sbjct  113  MLIDVVDFVTSGSAKFTETAISSVCKLCAANLFRVFPPKSRSTSTGGETEDEEPIFDPAW  172

Query  626  YHLQLVY  646
             HLQ VY
Sbjct  173  SHLQNVY  179



>ref|XP_008458023.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis melo]
 ref|XP_008458029.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis melo]
Length=500

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 135/187 (72%), Gaps = 9/187 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+P+K  KS+++D   A   S N+ +  G+  Q TN  +  +++LNVVKRVSS
Sbjct  1    MLKQILSKLPKKLQKSETVD--SATNESGNNTSRLGHVFQCTNVGSAFSSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI A  E++ PHL FKDV N +KQ L VSKLN CC V+D  D +K    +DLKRQ
Sbjct  59   AVFPASIAA--EAVDPHLSFKDVPNPQKQNLFVSKLNYCCEVFDLNDMEK----QDLKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDPAW  625
            +L+++ DFV SGS K TE+AI++VC++CA NLFR FPPK  S +  GE+EDEE  FDPAW
Sbjct  113  MLIDVVDFVTSGSAKFTETAISSVCKLCAANLFRVFPPKSRSTSTGGETEDEEPIFDPAW  172

Query  626  YHLQLVY  646
             HLQ VY
Sbjct  173  SHLQNVY  179



>ref|XP_004139334.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 gb|KGN60641.1| hypothetical protein Csa_2G005870 [Cucumis sativus]
Length=500

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 135/187 (72%), Gaps = 9/187 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+P+K  KSD++D   A   S N+ +  G+  Q TN  +  +++LNVVKRVSS
Sbjct  1    MLKQILSKLPKKLQKSDTVD--SATNESGNNTSRLGHVFQCTNVGSAFSSKLNVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI A  E++ PHL FKDV N +KQ L VSKLN CC V+D  D +K    +DLKRQ
Sbjct  59   AVFPASIAA--EAVDPHLSFKDVPNPQKQNLFVSKLNYCCEVFDLNDMEK----QDLKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDPAW  625
            +L+++ DFV SGS K TE+AI++VC++CA NLFR FPPK  S +  GE+EDEE  FDPAW
Sbjct  113  MLIDVVDFVTSGSAKFTETAISSVCKLCAANLFRVFPPKSRSTSTGGETEDEEPIFDPAW  172

Query  626  YHLQLVY  646
             HLQ VY
Sbjct  173  SHLQNVY  179



>ref|XP_010109039.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
 gb|EXC20791.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Morus notabilis]
Length=668

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 130/188 (69%), Gaps = 5/188 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNV--VKRV  262
            M KQIL+K+PRKS KS+S  SS  +  S +   +SG+G++ + S    +        KR+
Sbjct  1    MFKQILSKLPRKSSKSESPRSSSPRSQSNSRAGSSGSGLENSKSNGGNSGSSRSNSTKRM  60

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SS +FPAS+VAG E + P   FKDV N EK  L VSK++LCC  +DF DP+KN  EKD+K
Sbjct  61   SSVVFPASMVAGIEPLVP---FKDVPNAEKMNLFVSKVSLCCVTFDFTDPNKNTVEKDVK  117

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPA  622
            RQ LLEL DFVAS  +K TE AI A+CRMCAVNLFRDFPP C S   GE++D+E  FDPA
Sbjct  118  RQTLLELVDFVASRPMKFTEPAILAMCRMCAVNLFRDFPPNCRSSGGGENDDDEPMFDPA  177

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  178  WPHLQLVY  185



>ref|XP_008811587.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Phoenix dactylifera]
Length=509

 Score =   178 bits (451),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 131/192 (68%), Gaps = 14/192 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNG----MQFTNSCNVIANRLNVVK  256
            M KQ L+K+PRKS KSD      A  ++ N P ++ +     +Q TNS N    R   VK
Sbjct  1    MWKQFLSKLPRKSSKSDC-----ASDSAHNHPGSNASSSGNSIQRTNSGNAGPGRSTSVK  55

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSA+FP+S+VAG   I P L FKDVSN EKQ L +SKLNLC  V+DF DP+KN+ EKD
Sbjct  56   RMSSAVFPSSVVAG---IEPLLSFKDVSNTEKQNLFISKLNLCSVVFDFSDPNKNSTEKD  112

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR--GESEDEELF  610
            +KRQ LL+L DFV SG+ + TE  I+A C+M A+NLFR FPP   S++   GE+E+EE  
Sbjct  113  MKRQALLDLIDFVNSGTSRFTEPMISASCKMFAINLFRGFPPNYRSNSSCGGETEEEEPR  172

Query  611  FDPAWYHLQLVY  646
            FDPAW HLQLVY
Sbjct  173  FDPAWSHLQLVY  184



>ref|XP_010533199.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Tarenaya hassleriana]
Length=500

 Score =   177 bits (450),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 129/188 (69%), Gaps = 11/188 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQ L+K+P+KS + D   +SG   N  N  ++ G   Q TN  NV+ +RL+VVKRVSS
Sbjct  1    MLKQFLSKLPKKSTRIDQFHTSGIDSN--NQSSSHGIATQCTNVGNVLTSRLSVVKRVSS  58

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPASI+ G +S+ P L FKD+S+ ++Q L +SKLN CC      D D  ++E D+KRQ
Sbjct  59   AVFPASIMGGSDSVDPSLSFKDISSPQRQNLFISKLNFCCQ-----DVDSMSSE-DVKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPK--CASHARGESEDEELFFDPA  622
            VL EL DFV+SG  K +E AIAA CRMCA NLFR FPPK  C+S   GE ED+E  FDPA
Sbjct  113  VLAELVDFVSSGLAKFSEQAIAATCRMCAANLFRVFPPKIRCSSTG-GEGEDDEPVFDPA  171

Query  623  WYHLQLVY  646
            W  LQ+VY
Sbjct  172  WSSLQIVY  179



>ref|XP_009377509.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=503

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 128/191 (67%), Gaps = 14/191 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCND-PTNSGNGMQFTNSCNVIA-NRLNVVKRV  262
            MLKQ L+K+PRK+LKS        +P+S    P+  G G   +N  N     + N  KR+
Sbjct  1    MLKQFLSKLPRKALKS------DERPDSPRTGPSGLGGGTPRSNGGNSSGPGKANAPKRM  54

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EKD+K
Sbjct  55   SSAVFPASVVAGIEPLVP---FKDVPTPEKMNLFVSKVSLCCVTFDFTDPSKNSIEKDVK  111

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR---GESEDEELFF  613
            RQ LLEL DFVA+GS++ +E AI A CRMCA+NLFR FPP   SH+    GE++D+E  F
Sbjct  112  RQTLLELVDFVATGSMRFSEPAILATCRMCAINLFRVFPPNYRSHSNGGAGENDDDEPMF  171

Query  614  DPAWYHLQLVY  646
            DPAW HLQ+VY
Sbjct  172  DPAWPHLQIVY  182



>ref|XP_007223260.1| hypothetical protein PRUPE_ppa004440mg [Prunus persica]
 ref|XP_008219855.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Prunus mume]
 gb|EMJ24459.1| hypothetical protein PRUPE_ppa004440mg [Prunus persica]
Length=509

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 130/191 (68%), Gaps = 8/191 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslks----dsldssGAQPNSCNDPTNSGNGMQFTNSC-NVIANRLNVV  253
            MLKQ L+K+PRK+LKS    +S  +S  + +S   P+  G G   +N   N+   R N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTSTPRSSSRTGPSGVGGGTPRSNGGGNLGPVRSNGP  60

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  61   KRMSSAVFPASVVAGIEPLVP---FKDVPTSEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  117

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFF  613
            D+KRQ LLEL DFVASGS++ +E AI A CRMCA+NLFR FPP   +   GE++D+E  F
Sbjct  118  DVKRQTLLELVDFVASGSMRFSEPAILATCRMCAINLFRVFPPNYRNGGGGENDDDEPMF  177

Query  614  DPAWYHLQLVY  646
            DPAW HLQ+VY
Sbjct  178  DPAWPHLQIVY  188



>ref|XP_010541630.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Tarenaya hassleriana]
 ref|XP_010541631.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Tarenaya hassleriana]
Length=504

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 128/193 (66%), Gaps = 17/193 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGM-----QFTNSCNVIANRLNVV  253
            M KQ L+K PR+S K+DS + +          + SG+G+     Q + +      R N  
Sbjct  1    MFKQFLSKFPRRSSKADSGELTRTS-------SGSGSGLVPSPGQRSVTSGSAPARSNSA  53

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FP S+VAG E + P   FKDV N EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  54   KRMSSAVFPTSVVAGIEPLVP---FKDVPNTEKMNLFVSKVSLCCVTFDFSDPSKNSIEK  110

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR--GESEDEEL  607
            D+KRQ LLEL +F+ASGS+K TE AI A+CRMCAVNLFR FPP C S A   GE++D+E 
Sbjct  111  DVKRQTLLELLEFLASGSLKFTEPAILAMCRMCAVNLFRVFPPNCRSSASGGGENDDDEP  170

Query  608  FFDPAWYHLQLVY  646
             FDPAW HLQ+VY
Sbjct  171  MFDPAWPHLQIVY  183



>ref|XP_006394804.1| hypothetical protein EUTSA_v10004060mg [Eutrema salsugineum]
 gb|ESQ32090.1| hypothetical protein EUTSA_v10004060mg [Eutrema salsugineum]
Length=500

 Score =   175 bits (444),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 127/188 (68%), Gaps = 11/188 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTN-SGNGMQFTNSCNVIANRLNVVKRVS  265
            M KQ L+K+PRKS K+DS + + +       P   SG G     S  V   R N  KR+S
Sbjct  1    MFKQFLSKLPRKSSKADSGELTRSSSGPVPSPAQRSGTG---GGSAPV---RSNSGKRMS  54

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+VAG E + P   FKDV N EK  L VSK++LCC  +DF DP KN+ EKD+KR
Sbjct  55   SAVFPASVVAGIEPLVP---FKDVPNSEKLNLFVSKVSLCCVTFDFSDPSKNSIEKDVKR  111

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC-ASHARGESEDEELFFDPA  622
            Q LLEL DFVASGSV+ TE AI A+CRMCAVNLFR FPP   +S   GE++D+E  FDPA
Sbjct  112  QTLLELLDFVASGSVRFTEPAILAMCRMCAVNLFRVFPPNYRSSGVGGENDDDEPMFDPA  171

Query  623  WYHLQLVY  646
            W HLQ+VY
Sbjct  172  WPHLQIVY  179



>ref|XP_007013747.1| Phosphatase 2A regulatory B subunit family protein [Theobroma 
cacao]
 gb|EOY31366.1| Phosphatase 2A regulatory B subunit family protein [Theobroma 
cacao]
Length=503

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 131/190 (69%), Gaps = 12/190 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQF--TNSCNVIANRLNVVKRV  262
            ML+Q L+K+PRKS KSDS +   A+ NSC   T +G+  Q   +NS N  + R    KR 
Sbjct  1    MLRQFLSKLPRKSGKSDSPEL--ARSNSC---TTAGSTPQTHRSNSLNSGSVRPCAAKRT  55

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPAS+VAG   I P L FKDV N EK  L VSK++LCC  +DF DP K++ EKD+K
Sbjct  56   SSAVFPASVVAG---IEPLLPFKDVPNSEKMNLFVSKVSLCCVTFDFTDPAKSSIEKDVK  112

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR--GESEDEELFFD  616
            RQ LLEL DFVASGSV+ +E AI A+CRMCAVNLFR FPP   S      E++D+E  FD
Sbjct  113  RQTLLELLDFVASGSVRFSEPAILAMCRMCAVNLFRVFPPNYRSSVSNGAENDDDEPMFD  172

Query  617  PAWYHLQLVY  646
            PAW HLQ+VY
Sbjct  173  PAWPHLQIVY  182



>ref|XP_009377393.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
 ref|XP_009377396.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=512

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 129/194 (66%), Gaps = 11/194 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslks----dsldssGAQPNSCNDPTNSGNGMQFTNSCNVIA-NRLNVV  253
            MLKQ L+K+PRK+LKS    +S  ++  +  S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTNTPRSGSRTGPSGLGGGTPRSNGANSSGPGKANAP  60

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  61   KRMSSAVFPASVVAGIEPLVP---FKDVPTSEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  117

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR---GESEDEE  604
            D+KRQ LLEL DFVA+GS++ +E AI A CRMCA+NLFR FPP   S +    GE++D+E
Sbjct  118  DVKRQTLLELVDFVATGSMRFSEPAILATCRMCAINLFRVFPPNYRSRSNGGAGENDDDE  177

Query  605  LFFDPAWYHLQLVY  646
              FDPAW HLQ+VY
Sbjct  178  PMFDPAWPHLQIVY  191



>ref|XP_006287577.1| hypothetical protein CARUB_v10000786mg [Capsella rubella]
 gb|EOA20475.1| hypothetical protein CARUB_v10000786mg [Capsella rubella]
Length=501

 Score =   174 bits (442),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 123/186 (66%), Gaps = 6/186 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ+L+K+PRKS KSDS    G    S +    S       +       R N  KR+SS
Sbjct  1    MFKQLLSKLPRKSSKSDSG---GELNRSSSGQIASPVQRSGASGGGSGPVRSNSGKRMSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV + EK  L VSK++LCC  +DF DP KN+ EKD+KRQ
Sbjct  58   AVFPASVVAGIEPLVP---FKDVPSSEKLNLFVSKVSLCCVTFDFSDPGKNSIEKDVKRQ  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
             LLEL DFVASGSVK TE AI A+CRMCAVNLFR FPP   S   GE++D+E  FDPAW 
Sbjct  115  TLLELLDFVASGSVKFTEPAILAMCRMCAVNLFRVFPPNYRSSGGGENDDDEPMFDPAWP  174

Query  629  HLQLVY  646
            HLQ+VY
Sbjct  175  HLQIVY  180



>ref|XP_009372941.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Pyrus x bretschneideri]
Length=512

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 129/194 (66%), Gaps = 11/194 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslks----dsldssGAQPNSCNDPTNSGNGMQFTNSCNVIA-NRLNVV  253
            MLKQ L+K+PRK+LKS    +S  ++  +  S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTNTPRSGSRTGPSGLGGGTPRSNGANSSGPGKANAP  60

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  61   KRMSSAVFPASVVAGIEPLVP---FKDVPTSEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  117

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR---GESEDEE  604
            D+KRQ LLEL DFVA+GS++ +E AI A CRMCA+NLFR FPP   S +    GE++D+E
Sbjct  118  DVKRQTLLELVDFVATGSMRFSEPAILATCRMCAINLFRVFPPNYRSRSNGGAGENDDDE  177

Query  605  LFFDPAWYHLQLVY  646
              FDPAW HLQ+VY
Sbjct  178  PMFDPAWPHLQIVY  191



>ref|XP_008383627.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=512

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 128/194 (66%), Gaps = 11/194 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslks----dsldssGAQPNSCNDPTNSGNGMQFTNSCNVIA-NRLNVV  253
            MLKQ L+K+PRK+LKS    +S   +  +  S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRXNTPRSGSRTGPSGLGGGTPRSNGANSSGPGKANAP  60

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  61   KRMSSAVFPASVVAGIEPLVP---FKDVPTSEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  117

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR---GESEDEE  604
            D+KRQ LLEL DFVA+GS++ +E AI A CRMCA+NLFR FPP   S +    GE++D+E
Sbjct  118  DVKRQTLLELVDFVATGSMRFSEPAILATCRMCAINLFRVFPPNYRSRSNGGAGENDDDE  177

Query  605  LFFDPAWYHLQLVY  646
              FDPAW HLQ+VY
Sbjct  178  PMFDPAWPHLQIVY  191



>ref|XP_006476190.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Citrus sinensis]
Length=539

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 5/133 (4%)
 Frame = +2

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR SSA+FPAS+VAG   I P L FKDV NGEK  L VSK++LCC  +DF DP KN  EK
Sbjct  89   KRTSSAVFPASVVAG---IEPLLPFKDVPNGEKMNLFVSKVSLCCVTFDFTDPTKNCVEK  145

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESEDEEL  607
            D+K+Q L+EL DFVA+GS+K +E AI A+CRMCAVNLFR FPP  +C+SH  GE++D+E 
Sbjct  146  DVKKQTLIELLDFVAAGSMKFSEPAILAMCRMCAVNLFRVFPPNYRCSSHTTGENDDDEP  205

Query  608  FFDPAWYHLQLVY  646
             FDP+W HLQ+VY
Sbjct  206  MFDPSWPHLQIVY  218



>ref|XP_009385620.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009385621.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=509

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 128/188 (68%), Gaps = 6/188 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQP-NSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            M KQ L+K+PRKS KSD+   S + P N C  P N GN +Q T+S NV+ +R   VKR +
Sbjct  1    MWKQFLSKLPRKSSKSDASSGSDSHPSNDCTGPLN-GNPIQRTSSGNVVPSRSTTVKRTA  59

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SAIFP+S+V    SI P L FKDV N +KQ L +SKLNLCC V+DF DP+KN+ EKD+KR
Sbjct  60   SAIFPSSVVT---SIEPLLLFKDVPNSQKQNLFISKLNLCCVVFDFSDPNKNSTEKDMKR  116

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL-FFDPA  622
            Q LL L D+V +G+ + TE  I+A C+M AVNLFR FPP   S   G   +EE   FDPA
Sbjct  117  QALLGLIDYVDAGASRFTEPMISACCKMFAVNLFRAFPPNTRSCTGGGENEEEEPIFDPA  176

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  177  WCHLQLVY  184



>ref|XP_006450560.1| hypothetical protein CICLE_v10008015mg [Citrus clementina]
 gb|ESR63800.1| hypothetical protein CICLE_v10008015mg [Citrus clementina]
Length=518

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 5/133 (4%)
 Frame = +2

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR SSA+FPAS+VAG   I P L FKDV NGEK  L VSK++LCC  +DF DP KN  EK
Sbjct  68   KRTSSAVFPASVVAG---IEPLLPFKDVPNGEKMNLFVSKVSLCCVTFDFTDPTKNCVEK  124

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESEDEEL  607
            D+K+Q L+EL DFVA+GS+K +E AI A+CRMCAVNLFR FPP  +C+SH  GE++D+E 
Sbjct  125  DVKKQTLIELLDFVAAGSMKFSEPAILAMCRMCAVNLFRVFPPNYRCSSHTTGENDDDEP  184

Query  608  FFDPAWYHLQLVY  646
             FDP+W HLQ+VY
Sbjct  185  MFDPSWPHLQIVY  197



>ref|XP_006476191.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Citrus sinensis]
 gb|KDO79624.1| hypothetical protein CISIN_1g010120mg [Citrus sinensis]
Length=518

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 5/133 (4%)
 Frame = +2

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR SSA+FPAS+VAG   I P L FKDV NGEK  L VSK++LCC  +DF DP KN  EK
Sbjct  68   KRTSSAVFPASVVAG---IEPLLPFKDVPNGEKMNLFVSKVSLCCVTFDFTDPTKNCVEK  124

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESEDEEL  607
            D+K+Q L+EL DFVA+GS+K +E AI A+CRMCAVNLFR FPP  +C+SH  GE++D+E 
Sbjct  125  DVKKQTLIELLDFVAAGSMKFSEPAILAMCRMCAVNLFRVFPPNYRCSSHTTGENDDDEP  184

Query  608  FFDPAWYHLQLVY  646
             FDP+W HLQ+VY
Sbjct  185  MFDPSWPHLQIVY  197



>ref|XP_002874266.1| hypothetical protein ARALYDRAFT_489409 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50525.1| hypothetical protein ARALYDRAFT_489409 [Arabidopsis lyrata subsp. 
lyrata]
Length=499

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 123/186 (66%), Gaps = 8/186 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ L+K+PRKS KSD       + N  +    S    +   S      R N  KR+SS
Sbjct  1    MFKQFLSKLPRKSSKSD-----SGELNRSSSGPVSSPVQRSGTSAGSGPVRSNSGKRMSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV + EK  L VSK++LCC  +DF +P KN+ EKD+KRQ
Sbjct  56   AVFPASVVAGIEPLVP---FKDVPSSEKLNLFVSKVSLCCVTFDFSEPGKNSIEKDVKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
             LLEL DFVASGSVK TE AI A+CRMCAVNLFR FPP   S + GE++D+E  FDPAW 
Sbjct  113  TLLELLDFVASGSVKFTEPAILAMCRMCAVNLFRVFPPNYRSSSGGENDDDEPMFDPAWP  172

Query  629  HLQLVY  646
            HLQ+VY
Sbjct  173  HLQIVY  178



>ref|NP_197933.1| protein phosphatase 2A regulatory B subunit [Arabidopsis thaliana]
 sp|Q93YV6.1|2A5I_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 57 kDa 
regulatory subunit B' iota isoform; Short=AtB' iota; Short=PP2A, 
B' subunit, iota isoform [Arabidopsis thaliana]
 gb|AAL24096.1| putative AtBgamma protein [Arabidopsis thaliana]
 gb|AAN13126.1| putative AtBgamma protein [Arabidopsis thaliana]
 gb|AED93456.1| protein phosphatase 2A regulatory B subunit [Arabidopsis thaliana]
Length=500

 Score =   172 bits (437),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 103/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
            R N  KR+SSA+FPAS+VAG E + P   FKDV + EK  L VSK++LCC  +DF DP K
Sbjct  47   RSNSGKRMSSAVFPASVVAGIEPLVP---FKDVPSSEKLNLFVSKVSLCCVTFDFSDPGK  103

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESED  598
            N+ EKD+KRQ LLEL DFVASGSVK TE AI A+CRMCAVNLFR FPP   S + GE++D
Sbjct  104  NSIEKDVKRQTLLELLDFVASGSVKFTEPAILAMCRMCAVNLFRVFPPNYRSSSGGENDD  163

Query  599  EELFFDPAWYHLQLVY  646
            +E  FDPAW HLQ+VY
Sbjct  164  DEPMFDPAWPHLQIVY  179



>ref|XP_009389489.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score =   172 bits (437),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 130/188 (69%), Gaps = 5/188 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsld-ssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            M KQ L+K+PRKS KSD+   ++ + P +    + +GN +Q T+S NV+ +R   VKR +
Sbjct  1    MWKQFLSKLPRKSSKSDASSGTTRSHPINNGTTSMNGNPIQRTSSGNVVPSRSTAVKRTA  60

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SAIFP+S+V    SI P L FKDV N EKQ L +SKLNLCC V+DF DP+KN+ EKD+KR
Sbjct  61   SAIFPSSVVT---SIEPLLLFKDVPNTEKQNLFISKLNLCCVVFDFSDPNKNSTEKDMKR  117

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL-FFDPA  622
            Q LL+L D+V +GS + TE  I+A C+M A+NLFR FPP   S A G   +EE   F+PA
Sbjct  118  QALLDLIDYVDAGSSRFTEPMISASCKMFAMNLFRAFPPNNRSSAGGGETEEEEPMFEPA  177

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  178  WSHLQLVY  185



>gb|KHG19967.1| Serine/threonine phosphatase 2A 57 kDa regulatory subunit B' 
iota-like protein [Gossypium arboreum]
Length=502

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 128/190 (67%), Gaps = 13/190 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQ--FTNSCNVIANRLNVVKRV  262
            ML+Q L+K+PRKS KSDS +    +  SC   T +G+  Q   +NS N+ + R    KR 
Sbjct  1    MLRQFLSKLPRKSGKSDSPEL--TRSTSC---TTAGSSPQPHRSNSLNLGSGRPCAPKRT  55

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPAS+VAG   I P L FKDV N EK  L VSK++LCC  +DF DP KN  EKD+K
Sbjct  56   SSAVFPASVVAG---IEPLLPFKDVPNSEKMNLFVSKVSLCCVTFDFTDPTKNLIEKDVK  112

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR--GESEDEELFFD  616
            RQ LLEL DFV SGSV+ +E AI A CRMCAVNLFR FPP   S     GE++DEE  FD
Sbjct  113  RQTLLELLDFV-SGSVRFSEPAILATCRMCAVNLFRVFPPNYRSVVSNGGENDDEEPMFD  171

Query  617  PAWYHLQLVY  646
            PAW HLQ+VY
Sbjct  172  PAWPHLQIVY  181



>ref|XP_003544625.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Glycine max]
Length=492

 Score =   170 bits (431),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 9/187 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslk-sdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            MLKQIL+K+PRKSLK      + G    S + P  +G   +     +  A R +     S
Sbjct  1    MLKQILSKLPRKSLKPDSDELTRGDSARSADSPRAAGRSYKLHGVSSSTAKRAS-----S  55

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+V+G E + P   FKDV N EK  L VSKL+LCC  +DF DP K+ A+KD+KR
Sbjct  56   SAVFPASMVSGIEPLVP---FKDVPNAEKMNLFVSKLSLCCVTFDFTDPGKSIADKDVKR  112

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAW  625
            + L+EL DFVA G+++ +E AI A+CRMCA+NLFR FPP   +   GE++D+E  FDPAW
Sbjct  113  KTLVELVDFVACGTMRFSEPAILAMCRMCAINLFRVFPPNYRASGGGENDDDEPMFDPAW  172

Query  626  YHLQLVY  646
             HLQLVY
Sbjct  173  PHLQLVY  179



>ref|XP_004138753.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 ref|XP_004173408.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cucumis sativus]
 gb|KGN62895.1| Protein phosphatase 2a, regulatory subunit [Cucumis sativus]
Length=515

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 128/196 (65%), Gaps = 13/196 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksd----sldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVK  256
            MLKQIL+K+PRKS  S     +  SS  + +  N  T+SG+G   ++     + R N  K
Sbjct  1    MLKQILSKLPRKSSDSSDSPRTPRSSSNRASPRNSTTSSGHGTPRSSGGASASGRSNATK  60

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            + SSA+FPAS+VAG E + P   FKDV + EK  L VSKL+LCC  +DF DP KN+ EK 
Sbjct  61   KTSSAVFPASLVAGIEPLVP---FKDVPSSEKMNLFVSKLSLCCVTFDFTDPSKNSIEKG  117

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH------ARGESED  598
            +KRQ L+EL DFV +G++K  E AI A+C+MCAVNLFR FPP   ++        GE++D
Sbjct  118  VKRQTLIELVDFVGAGTMKFNEPAIHALCKMCAVNLFRVFPPNYRANMIGGGSTGGENDD  177

Query  599  EELFFDPAWYHLQLVY  646
            +E  FDPAW HLQLVY
Sbjct  178  DEPTFDPAWPHLQLVY  193



>gb|KJB07811.1| hypothetical protein B456_001G045700 [Gossypium raimondii]
Length=502

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 130/190 (68%), Gaps = 13/190 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQ--FTNSCNVIANRLNVVKRV  262
            ML+Q L+K+PRKS KSDS +    +  SC   T +G+  Q   +NS N+ + R    KR 
Sbjct  1    MLRQFLSKLPRKSGKSDSPEL--TRSTSC---TTAGSTPQPHRSNSLNLGSGRPCAPKRT  55

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FPAS+VAG   I P L FKDV N EK  L VSK++LCC  +DF DP KN  EKD+K
Sbjct  56   SSAVFPASVVAG---IEPLLPFKDVPNSEKMNLFVSKVSLCCVTFDFTDPTKNLIEKDVK  112

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESEDEELFFD  616
            RQ LLEL DFV SGSV+ +E AI A+CRMCAVNLFR FPP  + A    GE++D+E  FD
Sbjct  113  RQTLLELLDFV-SGSVRFSEPAILAMCRMCAVNLFRVFPPNYRSAVSNGGENDDDEPMFD  171

Query  617  PAWYHLQLVY  646
            PAW HLQ+VY
Sbjct  172  PAWPHLQIVY  181



>ref|XP_010493808.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Camelina sativa]
Length=506

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 129/192 (67%), Gaps = 13/192 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIAN---RLNVVKR  259
            M KQ L+K+PRKS KS+S      + +S   P+     +Q + + +V+ +   R N  KR
Sbjct  1    MFKQFLSKLPRKSSKSESGGGELNRSSSGQVPS----PVQRSGAGSVVGSGPVRSNSGKR  56

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
            +SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EKD+
Sbjct  57   MSSAVFPASVVAGIEPLVP---FKDVPTSEKLNLFVSKVSLCCVTFDFSDPGKNSIEKDV  113

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH---ARGESEDEELF  610
            KRQ LLEL DFVASGSVK TE AI A+CRMCAVNLFR FPP   S      GE++D+E  
Sbjct  114  KRQTLLELLDFVASGSVKFTEPAILAMCRMCAVNLFRVFPPNYRSSGGGGGGENDDDEPM  173

Query  611  FDPAWYHLQLVY  646
            FDPAW HLQ+VY
Sbjct  174  FDPAWPHLQIVY  185



>ref|XP_009407446.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407448.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score =   170 bits (430),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 5/188 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS-GNGMQFTNSCNVIANRLNVVKRVS  265
            M KQ L+K+PRKS KSD+   S     S N   ++ GN +Q T+S NV+++R   VKR +
Sbjct  1    MWKQFLSKLPRKSSKSDASSGSAHSHLSNNGMASANGNPIQRTSSGNVVSSRSATVKRTA  60

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SAIFP+S+V    SI P L FKDV N EK  L +SK+ LCC V+DF DP+KN AEKD+KR
Sbjct  61   SAIFPSSVVT---SIEPLLLFKDVPNSEKHNLFISKMKLCCVVFDFSDPNKNCAEKDMKR  117

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC-ASHARGESEDEELFFDPA  622
            Q LL+L D+V +G+ K TE  I+A C+M A+NLFR FPP   +S   GE+E+EEL FDPA
Sbjct  118  QALLDLVDYVDAGTSKFTEPMISASCKMFAINLFRTFPPNTRSSTGGGEAEEEELMFDPA  177

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  178  WSHLQLVY  185



>ref|XP_008394018.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Malus domestica]
Length=512

 Score =   170 bits (430),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 127/194 (65%), Gaps = 11/194 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslks----dsldssGAQPNSCNDPTNSGNGMQFTNSCNVIA-NRLNVV  253
            MLKQ L+K+PRK+LKS    +S  ++  +  S   P+  G G   +N  N     + N  
Sbjct  1    MLKQFLSKLPRKALKSDERPESPRTNXPRSGSRTGPSGLGGGTPRSNGGNXSGPGKANAP  60

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR+SSA+FPAS VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EK
Sbjct  61   KRMSSAVFPASXVAGIEPLVP---FKDVPTPEKMNLFVSKVSLCCVTFDFTDPTKNSIEK  117

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR---GESEDEE  604
            D+KRQ LLEL DFVA GS++ +E AI A CRMCA+NLFR F P   SH+    GE++D+E
Sbjct  118  DVKRQTLLELVDFVAIGSMRFSEPAILATCRMCAINLFRVFXPNYRSHSNGGAGENDDDE  177

Query  605  LFFDPAWYHLQLVY  646
              FDPAW HLQ+VY
Sbjct  178  PMFDPAWPHLQIVY  191



>gb|KDP32288.1| hypothetical protein JCGZ_13213 [Jatropha curcas]
Length=498

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 121/189 (64%), Gaps = 15/189 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS K ++ + +  +  S      S NG            + N  KR SS
Sbjct  1    MLKQILSKLPRKSSKPEATELTRPESPSIQRSNGSSNGS---------VAKSNGPKRTSS  51

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV  GE+  L VSK++LCC  +DF DP KN  EKD+KRQ
Sbjct  52   AVFPASVVAGIEPLVP---FKDVPAGERMNLFVSKVSLCCVTFDFTDPTKNTLEKDVKRQ  108

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDE---ELFFDP  619
             LLEL DFVASGS+K +E AI A+CRM AVNLFR FPP   S +   SE+E   E  FDP
Sbjct  109  TLLELVDFVASGSMKFSEPAILAMCRMSAVNLFRVFPPNYRSSSINVSENEDNDEPMFDP  168

Query  620  AWYHLQLVY  646
            AW HLQ+VY
Sbjct  169  AWPHLQIVY  177



>gb|KCW80467.1| hypothetical protein EUGRSUZ_C018111, partial [Eucalyptus grandis]
Length=386

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 124/189 (66%), Gaps = 9/189 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+KIPR++ + DS +    QP S   P  +          N  + R   ++R SS
Sbjct  1    MLKQILSKIPRRTPRLDSGEL--IQPAS-GSPDGAQKSGGGGGGSNSSSARSGGLRRASS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS++AG E + P   FKDV   EK  LLVSKL+LCC  +DF DP KN  EKD+KRQ
Sbjct  58   VVFPASVIAGIEPLVP---FKDVPASEKMNLLVSKLSLCCVTFDFTDPGKNTMEKDVKRQ  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR---GESEDEELFFDP  619
            +L+E+ DFVASGSV+  ESA+ A+CRMCA+NLFR FPP   S++    GE++ ++  FDP
Sbjct  115  ILMEILDFVASGSVRFAESAVLAMCRMCAINLFRVFPPSYRSNSTGSGGENDHDDPKFDP  174

Query  620  AWYHLQLVY  646
            AW HLQ VY
Sbjct  175  AWSHLQAVY  183



>ref|XP_010913433.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010913512.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=509

 Score =   167 bits (423),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 126/197 (64%), Gaps = 24/197 (12%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSG---------NGMQFTNSCNVIANR  241
            M KQ L+K+PRK           ++ +S +D T++          N +Q  NS N    R
Sbjct  1    MWKQFLSKLPRK----------SSKLDSVSDSTHNHPGSNASSSGNSIQRANSGNAGPGR  50

Query  242  LNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKN  421
               VKR+SSA+FP+S+VAG   I P L FKD+SN EKQ L +SKLNLC  V+DF DP+KN
Sbjct  51   STTVKRMSSAVFPSSVVAG---IEPLLSFKDISNTEKQNLFISKLNLCSVVFDFSDPNKN  107

Query  422  AAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDE  601
            +AEKD+KRQ LL+L DFV SG+ + TE  I+A C+M A+NLFR FPP   S++ G  E E
Sbjct  108  SAEKDMKRQALLDLIDFVNSGTSRFTEPMISASCKMVAINLFRGFPPNYRSNSSGGGETE  167

Query  602  EL--FFDPAWYHLQLVY  646
            E    FDPAW HLQLVY
Sbjct  168  EEEPMFDPAWSHLQLVY  184



>ref|XP_010925115.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010925116.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=509

 Score =   167 bits (422),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 103/189 (54%), Positives = 128/189 (68%), Gaps = 8/189 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsl-dssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            M KQ L+K+PR+S KSDS  DS+   P S   P  SGN +Q  +S N    R   VKR+S
Sbjct  1    MWKQFLSKLPRRSSKSDSACDSAHNHPGSNASP--SGNSIQRASSGNAGPGRSTTVKRMS  58

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FP+S+VAG   I P L FKDV N EKQ L++SKLNLC +V+DF DP+KN+AEKD+KR
Sbjct  59   SAVFPSSVVAG---IEPLLSFKDVPNAEKQNLVISKLNLCSAVFDFSDPNKNSAEKDMKR  115

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL--FFDP  619
            Q LL+L  F  SG+ + TE  I+A CRM A+NLFR FPP   +++    E EE    FDP
Sbjct  116  QTLLDLVYFFNSGTPRFTEPMISASCRMFAINLFRVFPPNYRTNSSSGGETEEEEPIFDP  175

Query  620  AWYHLQLVY  646
            AW HLQLVY
Sbjct  176  AWSHLQLVY  184



>ref|XP_010456709.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like, partial [Camelina sativa]
Length=471

 Score =   166 bits (420),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 122/189 (65%), Gaps = 7/189 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ L+K+PRKS KS+S      + +S   P+         +       R N  KR+SS
Sbjct  1    MFKQFLSKLPRKSSKSESGGGELNRSSSGQVPSPVQRSGA-GSGVGSGPVRSNSGKRMSS  59

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EKD+KRQ
Sbjct  60   AVFPASVVAGIEPLVP---FKDVPTSEKLNLFVSKVSLCCVTFDFSDPGKNSIEKDVKRQ  116

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS---HARGESEDEELFFDP  619
             LLEL DFVASGSVK TE AI A+CRMCAVNLFR FPP   S      GE++D+E  FDP
Sbjct  117  TLLELLDFVASGSVKFTEPAILAMCRMCAVNLFRVFPPNYRSSGGGGGGENDDDEPMFDP  176

Query  620  AWYHLQLVY  646
            AW HLQ+VY
Sbjct  177  AWPHLQIVY  185



>ref|XP_008445128.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Cucumis melo]
Length=515

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 127/196 (65%), Gaps = 13/196 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTN----SGNGMQFTNSCNVIANRLNVVK  256
            MLKQIL+K+PRKS  S     +    ++ + P +    SG+G Q ++     + R N  K
Sbjct  1    MLKQILSKLPRKSSDSSDSPRTPRSSSNRSSPRSSTAPSGHGTQRSSGGASASGRSNATK  60

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            + SSA+FPAS+VAG E + P   FKDV + EK  L VSKL+LCC  +DF DP KN+ EK 
Sbjct  61   KTSSAVFPASLVAGIEPLVP---FKDVPSSEKMNLFVSKLSLCCVTFDFTDPSKNSIEKG  117

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHA------RGESED  598
            +KRQ L+EL DFV +G+VK  E AI A+C+MCAVNLFR FPP   ++        GE++D
Sbjct  118  VKRQTLIELVDFVGAGTVKFNEPAIHALCKMCAVNLFRVFPPNYRANMIGGGSNGGENDD  177

Query  599  EELFFDPAWYHLQLVY  646
            +E  FDPAW HLQLVY
Sbjct  178  DEPTFDPAWPHLQLVY  193



>ref|XP_010421407.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Camelina sativa]
Length=506

 Score =   166 bits (420),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 122/189 (65%), Gaps = 7/189 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ L+K+PRKS KS+S      + +S   P+         +       R N  KR+SS
Sbjct  1    MFKQFLSKLPRKSSKSESGGGELNRSSSGQVPSPVQRSGA-GSGVGSGPVRSNSGKRMSS  59

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  +DF DP KN+ EKD+KRQ
Sbjct  60   AVFPASVVAGIEPLVP---FKDVPTSEKLNLFVSKVSLCCVTFDFSDPGKNSIEKDVKRQ  116

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH---ARGESEDEELFFDP  619
             LLEL DFVASGSVK TE AI A+CRMCAVNLFR FPP   S      GE++D+E  FDP
Sbjct  117  TLLELLDFVASGSVKFTEPAILAMCRMCAVNLFRVFPPNYRSSGGGGGGENDDDEPMFDP  176

Query  620  AWYHLQLVY  646
            AW HLQ+VY
Sbjct  177  AWPHLQIVY  185



>ref|XP_004961286.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Setaria italica]
Length=500

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 125/189 (66%), Gaps = 17/189 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI--ANRLNVVKRV  262
            M KQ L+K+PRKS               C++    G G+Q T+S   I  +   + ++R+
Sbjct  1    MWKQFLSKLPRKSSA-------SGDSGQCSN----GTGIQRTSSLGSIPPSRPASAIRRM  49

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FP+S+VAG   I P + FKDV N EKQ L VSKL+LCC V+DF DP+K++ EKD+K
Sbjct  50   SSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKDIK  106

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHA-RGESEDEELFFDP  619
            RQ LL+L +FV S + + +E++IAA  RMCA+NLFR FPP   S +  GE +++E  FDP
Sbjct  107  RQALLDLIEFVESSNARFSEASIAACARMCAINLFRAFPPNYRSGSCGGEGDEDEPMFDP  166

Query  620  AWYHLQLVY  646
            AW HLQLVY
Sbjct  167  AWCHLQLVY  175



>ref|XP_010048263.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Eucalyptus grandis]
Length=504

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/189 (50%), Positives = 124/189 (66%), Gaps = 9/189 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+KIPR++ + DS +    QP S   P  +          N  + R   ++R SS
Sbjct  1    MLKQILSKIPRRTPRLDSGEL--IQPAS-GSPDGAQKSGGGGGGSNSSSARSGGLRRASS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS++AG E + P   FKDV   EK  LLVSKL+LCC  +DF DP KN  EKD+KRQ
Sbjct  58   VVFPASVIAGIEPLVP---FKDVPASEKMNLLVSKLSLCCVTFDFTDPGKNTMEKDVKRQ  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR---GESEDEELFFDP  619
            +L+E+ DFVASGSV+  ESA+ A+CRMCA+NLFR FPP   S++    GE++ ++  FDP
Sbjct  115  ILMEILDFVASGSVRFAESAVLAMCRMCAINLFRVFPPSYRSNSTGSGGENDHDDPKFDP  174

Query  620  AWYHLQLVY  646
            AW HLQ VY
Sbjct  175  AWSHLQAVY  183



>ref|XP_007161261.1| hypothetical protein PHAVU_001G055500g [Phaseolus vulgaris]
 gb|ESW33255.1| hypothetical protein PHAVU_001G055500g [Phaseolus vulgaris]
Length=491

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 123/187 (66%), Gaps = 10/187 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslk-sdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            ML+QIL+K+PRKSLK      + G    S + P  +G   +     +  A R +     S
Sbjct  1    MLRQILSKLPRKSLKPDSDESTWGDSARSADSPRVAGKSQRPHGGSSTAAKRAS-----S  55

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+V+G E + P   FKDV+N EK  L VSKL+LCC  +DF DP K+ A+KD+KR
Sbjct  56   SAVFPASMVSGFEPLVP---FKDVANAEKMNLFVSKLSLCCVTFDFCDPSKSVADKDVKR  112

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAW  625
            + L+EL DFVA G+V+ +E AI A+CRMCA NLFR FPP   +   GE++D+E  FDPAW
Sbjct  113  KTLVELVDFVACGTVRFSEPAILALCRMCAFNLFRVFPPNYRTGG-GENDDDEPMFDPAW  171

Query  626  YHLQLVY  646
             HLQLVY
Sbjct  172  PHLQLVY  178



>ref|XP_004498632.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Cicer arietinum]
Length=500

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 124/191 (65%), Gaps = 13/191 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGA-QPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            MLKQI  K+PRKS K+D+ +S+    P S + P  +G              R +     S
Sbjct  1    MLKQIFNKLPRKSSKTDTDESNRVDSPRSTDSPPAAGKSNHRLQGGGASLKRAS-----S  55

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+V+G E + P   FKDV N EK  L VSKL+LCC  +DF DP KN A+KD+KR
Sbjct  56   SAVFPASMVSGIEPLVP---FKDVPNAEKMNLFVSKLSLCCVTFDFTDPGKNTADKDVKR  112

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH----ARGESEDEELFF  613
            + L+EL DFVA GS+K +E AI A+CRMCA+NLFR FPP   ++    + GE++D+E  F
Sbjct  113  KTLVELVDFVAYGSMKFSEPAILAMCRMCAINLFRVFPPNYRANGVVASGGENDDDEPMF  172

Query  614  DPAWYHLQLVY  646
            DPAW HLQLVY
Sbjct  173  DPAWSHLQLVY  183



>ref|XP_006654758.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Oryza brachyantha]
Length=508

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 128/189 (68%), Gaps = 9/189 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI--ANRLNVVKRV  262
            M K  L+K+PRK+  S   D    Q   C++ T +GN +Q T+SC  I  A   + +KR+
Sbjct  1    MWKGFLSKLPRKNSSSGRGDLDSGQ---CSNGTANGNPIQRTSSCVSIPSARSTSTIKRM  57

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSAIFP+S+VAG   I P + FKDV N EKQ L VSKLNLCC+V+DF DP+K++AEKD+K
Sbjct  58   SSAIFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSDPNKSSAEKDIK  114

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL-FFDP  619
            RQ LL+L DFV S + + +E+ IAA  RM AVNLFR FPP   S + G   DEE   F+P
Sbjct  115  RQTLLDLIDFVDSSNSRFSEAVIAASARMFAVNLFRVFPPNYRSGSGGGEGDEEEPMFEP  174

Query  620  AWYHLQLVY  646
            AW HLQLVY
Sbjct  175  AWCHLQLVY  183



>emb|CDX80521.1| BnaC07g29230D [Brassica napus]
Length=496

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 100/136 (74%), Gaps = 3/136 (2%)
 Frame = +2

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
            R N  KR+SSA+FPAS+V+G   I P L FKDV N EK  L VSK++LCC  +DF DP+K
Sbjct  43   RSNSGKRMSSAVFPASVVSG---IEPLLPFKDVPNSEKLNLFVSKVSLCCVTFDFSDPNK  99

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESED  598
            N+ EK +KRQ LLEL DFVASGSV+ TE AI A+CRMCAVNLFR FPP   S     ++D
Sbjct  100  NSIEKLVKRQTLLELLDFVASGSVRFTEPAILAMCRMCAVNLFRVFPPSYRSSGGENNDD  159

Query  599  EELFFDPAWYHLQLVY  646
            +E  FDPAW HLQ+VY
Sbjct  160  DEPVFDPAWPHLQIVY  175



>emb|CDX88186.1| BnaA06g27770D [Brassica napus]
Length=495

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 100/136 (74%), Gaps = 3/136 (2%)
 Frame = +2

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
            R N  KR+SSA+FPAS+V+G   I P L FKDV N EK  L VSK++LCC  +DF DP+K
Sbjct  42   RSNSGKRMSSAVFPASVVSG---IEPLLPFKDVPNSEKLNLFVSKVSLCCVTFDFSDPNK  98

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESED  598
            N+ EK +KRQ LLEL DFVASGSV+ TE AI A+CRMCAVNLFR FPP   S     ++D
Sbjct  99   NSIEKLVKRQTLLELLDFVASGSVRFTEPAILAMCRMCAVNLFRVFPPSYRSSGGENNDD  158

Query  599  EELFFDPAWYHLQLVY  646
            +E  FDPAW HLQ+VY
Sbjct  159  DEPVFDPAWPHLQIVY  174



>ref|XP_009151080.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Brassica rapa]
Length=495

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 100/136 (74%), Gaps = 3/136 (2%)
 Frame = +2

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
            R N  KR+SSA+FPAS+V+G   I P L FKDV N EK  L VSK++LCC  +DF DP+K
Sbjct  42   RSNSGKRMSSAVFPASVVSG---IEPLLPFKDVPNSEKLNLFVSKVSLCCVAFDFSDPNK  98

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESED  598
            N+ EK +KRQ LLEL DFVASGSV+ TE AI A+CRMCAVNLFR FPP   S     ++D
Sbjct  99   NSIEKLVKRQTLLELLDFVASGSVRFTEPAILAMCRMCAVNLFRVFPPSYRSSGGENNDD  158

Query  599  EELFFDPAWYHLQLVY  646
            +E  FDPAW HLQ+VY
Sbjct  159  DEPVFDPAWPHLQIVY  174



>ref|XP_010670759.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Beta vulgaris subsp. vulgaris]
Length=499

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 122/188 (65%), Gaps = 10/188 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+KIPRK  KSD       +P   N+   SGNG     + N  + + N  KR SS
Sbjct  1    MLKQILSKIPRKPFKSD-----NGEPILNNNLNGSGNGTPRARNGNAASGKANATKRTSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP S+VAG   I P + FKDV N EK  L +SKLNLCC  +DF DP KN +EKD+KR+
Sbjct  56   AVFPTSVVAG---IEPLVSFKDVPNSEKMNLFLSKLNLCCVTFDFYDPSKNTSEKDIKRE  112

Query  449  VLLELNDFVASG-SVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG-ESEDEELFFDPA  622
             L+EL DFVA G   K  E AI A+CRMC+VNLFR FPP   S   G E++D+E  FDP+
Sbjct  113  TLIELVDFVAVGPPSKFPEPAIFAMCRMCSVNLFRVFPPNYRSGGGGAENDDDEPMFDPS  172

Query  623  WYHLQLVY  646
            W HLQ+VY
Sbjct  173  WTHLQIVY  180



>ref|NP_001148974.1| transposon protein [Zea mays]
 gb|ACG33695.1| transposon protein [Zea mays]
Length=501

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 126/192 (66%), Gaps = 22/192 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPT--NSGNGMQFTNSCNVI--ANRLNVVK  256
            M KQ+L+K+PR             +  +C D    ++G G+Q T+SC  I      + ++
Sbjct  1    MWKQLLSKLPR-------------KSPACGDSGQCSNGTGIQRTSSCGSIPPGRPASAIR  47

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSA+FP+S+VAG   I P + FKDV N EKQ L VSKL+LCC V+DF DP+K++ EKD
Sbjct  48   RMSSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKD  104

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL--F  610
            +KRQ LL+L +FV S + + +E+AIAA  RMCA+NLFR FPP C S + G  E +E    
Sbjct  105  IKRQALLDLIEFVESTNARFSEAAIAACSRMCAINLFRAFPPSCRSGSSGGGEGDEEEPM  164

Query  611  FDPAWYHLQLVY  646
            FDPAW HLQLVY
Sbjct  165  FDPAWCHLQLVY  176



>gb|ACN30940.1| unknown [Zea mays]
Length=501

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 126/192 (66%), Gaps = 22/192 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPT--NSGNGMQFTNSCNVI--ANRLNVVK  256
            M KQ+L+K+PR             +  +C D    ++G G+Q T+SC  I      + ++
Sbjct  1    MWKQLLSKLPR-------------KSPACGDSGQCSNGTGIQRTSSCGSIPPGRPASAIR  47

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSA+FP+S+VAG   I P + FKDV N EKQ L VSKL+LCC V+DF DP+K++ EKD
Sbjct  48   RMSSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKD  104

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL--F  610
            +KRQ LL+L +FV S + + +E+AIAA  RMCA+NLFR FPP C S + G  E +E    
Sbjct  105  IKRQALLDLIEFVESTNARFSEAAIAACSRMCAINLFRAFPPSCRSGSSGGGEGDEEEPM  164

Query  611  FDPAWYHLQLVY  646
            FDPAW HLQLVY
Sbjct  165  FDPAWCHLQLVY  176



>ref|XP_008647861.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647862.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647863.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 ref|XP_008647864.1| PREDICTED: transposon protein isoform X1 [Zea mays]
 gb|ACN27844.1| unknown [Zea mays]
 gb|ACN28036.1| unknown [Zea mays]
 gb|ACN29212.1| unknown [Zea mays]
 gb|AFW79075.1| transposon protein isoform 1 [Zea mays]
 gb|AFW79076.1| transposon protein isoform 2 [Zea mays]
 gb|AFW79077.1| transposon protein isoform 3 [Zea mays]
 gb|AFW79078.1| transposon protein isoform 4 [Zea mays]
Length=501

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 126/192 (66%), Gaps = 22/192 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPT--NSGNGMQFTNSCNVI--ANRLNVVK  256
            M KQ+L+K+PR             +  +C D    ++G G+Q T+SC  I      + ++
Sbjct  1    MWKQLLSKLPR-------------KSPACGDSGQCSNGTGIQRTSSCGSIPPGRPASAIR  47

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSA+FP+S+VAG   I P + FKDV N EKQ L VSKL+LCC V+DF DP+K++ EKD
Sbjct  48   RMSSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKD  104

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL--F  610
            +KRQ LL+L +FV S + + +E+AIAA  RMCA+NLFR FPP C S + G  E +E    
Sbjct  105  IKRQALLDLIEFVESTNARFSEAAIAACSRMCAINLFRAFPPSCRSGSSGGGEGDEEEPM  164

Query  611  FDPAWYHLQLVY  646
            FDPAW HLQLVY
Sbjct  165  FDPAWCHLQLVY  176



>ref|XP_002440213.1| hypothetical protein SORBIDRAFT_09g027870 [Sorghum bicolor]
 gb|EES18643.1| hypothetical protein SORBIDRAFT_09g027870 [Sorghum bicolor]
Length=501

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 125/190 (66%), Gaps = 18/190 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI--ANRLNVVKRV  262
            M KQ L+K+PRKS               C++    G G+Q T+SC+ I      + ++R+
Sbjct  1    MWKQFLSKLPRKSSA-------SGDSGQCSN----GTGIQRTSSCSSIPSGRPASAIRRM  49

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FP+S+VAG   I P + FKDV N EKQ L VSKL+LCC V+DF DP+K++ EKD+K
Sbjct  50   SSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLSLCCVVFDFSDPNKSSVEKDIK  106

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL--FFD  616
            RQ LL+L +FV S + + +E+AIAA  RMCA+NLFR FPP C S + G  E +E    FD
Sbjct  107  RQALLDLIEFVESTNTRFSEAAIAACSRMCAINLFRAFPPNCRSGSSGGGEGDEDEPMFD  166

Query  617  PAWYHLQLVY  646
            PAW HLQLVY
Sbjct  167  PAWCHLQLVY  176



>ref|XP_002308635.2| hypothetical protein POPTR_0006s26320g, partial [Populus trichocarpa]
 gb|EEE92158.2| hypothetical protein POPTR_0006s26320g, partial [Populus trichocarpa]
Length=383

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 100/134 (75%), Gaps = 6/134 (4%)
 Frame = +2

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            KR SS +FPAS+VAG E + P   FKDVSN EK  L VSK++LCC  +DF DP KN  EK
Sbjct  50   KRTSSVVFPASVVAGIEPLVP---FKDVSNAEKMNLFVSKVSLCCVTFDFSDPSKNTLEK  106

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH--ARGESED-EE  604
            D+KRQ LLEL DFVASGS++ +E AI A+CRMCAVNLFR FPP   S+  + GE++D ++
Sbjct  107  DVKRQTLLELVDFVASGSMRFSEPAILAMCRMCAVNLFRVFPPYYRSNLSSVGENDDNDD  166

Query  605  LFFDPAWYHLQLVY  646
              FDPAW HLQ+VY
Sbjct  167  PMFDPAWPHLQIVY  180



>ref|XP_011019731.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Populus euphratica]
Length=499

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 128/190 (67%), Gaps = 16/190 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQ-PNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            ML+QIL+K+P+KS K+DS +S+  + P +      S  G+  ++S           KR S
Sbjct  1    MLRQILSKLPKKSSKTDSAESTRPESPLTQQRSNGSTAGLGKSSSGP---------KRTS  51

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            S +FPAS+VAG E + P   FKDV N EK  L VSK++LCC  +DF DP KN  EKD+KR
Sbjct  52   SVVFPASVVAGIEPLVP---FKDVPNAEKMNLFVSKVSLCCVTFDFSDPSKNTLEKDVKR  108

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESED-EELFFD  616
            Q LLEL DFVASG+++ +E AI A+CRMCAVNLFR FPP  +  S + GE++D ++  FD
Sbjct  109  QTLLELVDFVASGAMRFSEPAILAMCRMCAVNLFRVFPPYYRSNSSSVGENDDNDDPMFD  168

Query  617  PAWYHLQLVY  646
            PAW HLQ+VY
Sbjct  169  PAWPHLQIVY  178



>ref|XP_008785874.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Phoenix dactylifera]
Length=526

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 128/192 (67%), Gaps = 4/192 (2%)
 Frame = +2

Query  71   HWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNV  250
            H + ATM KQ ++K+PRKS K D+  +S    N  N+    GN ++ T S N + +    
Sbjct  14   HPNTATMWKQFISKLPRKSSKYDTASNSPPS-NPGNNAAACGNPIERTASGNGLPDGAAS  72

Query  251  VKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAE  430
            +KR++SA FP+S+V G   I P + FKDV N EKQ + +SKLNLCC ++DF DP+K++  
Sbjct  73   MKRLASAEFPSSVVVG---IEPLISFKDVPNFEKQNVFLSKLNLCCIIFDFSDPNKDSVG  129

Query  431  KDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELF  610
            KDLKRQ L+EL D+V++ + + T+  IAA CRM A+NLFR FPP   +++     +EEL 
Sbjct  130  KDLKRQTLIELVDYVSTDAPRFTDQMIAASCRMFAINLFRVFPPSHRANSSIGEAEEELV  189

Query  611  FDPAWYHLQLVY  646
            FDPAW HLQ+VY
Sbjct  190  FDPAWSHLQIVY  201



>ref|XP_009415355.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Musa acuminata subsp. 
malaccensis]
Length=510

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 124/189 (66%), Gaps = 7/189 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS--GNGMQFTNSCNVIANRLNVVKRV  262
            M KQ L+K+P KS +SD+       P   N+ T S  GN +  TNS NV+++R   +KR 
Sbjct  1    MWKQFLSKLPHKSFQSDASLDLTHLPPG-NNGTGSVNGNSIHRTNSDNVVSSRSTTMKRT  59

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            +SAIFP+++V   E   P L FKDV N EKQ L +SKLN CC V+DF DP+KN+ EKD+K
Sbjct  60   ASAIFPSNVVTSAE---PLLLFKDVPNAEKQNLFISKLNFCCLVFDFSDPNKNSTEKDMK  116

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL-FFDP  619
            RQVLL+L  +V +G+ + TE  I+A C+M A+NLFR FPP   S   G   +EE+  +D 
Sbjct  117  RQVLLDLIGYVDAGTSRFTEPVISASCKMIAINLFRAFPPNTRSGNGGGEAEEEVPVYDS  176

Query  620  AWYHLQLVY  646
            AW HLQLVY
Sbjct  177  AWTHLQLVY  185



>gb|EAY98962.1| hypothetical protein OsI_20919 [Oryza sativa Indica Group]
Length=510

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 130/192 (68%), Gaps = 13/192 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNS--CNDPTNSGNGMQFTNSCNVI--ANRLNVVK  256
            M K  L+K+PRK+  S      GA  +S  C++   +GN +Q T+SC  I      + +K
Sbjct  1    MWKGFLSKLPRKTSASGR----GADLDSGQCSNGAGNGNPIQRTSSCGSIPSGRSTSTIK  56

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSAIFP+S+VAG   I P + FKDV N EKQ L VSKLNLCC+V+DF DP+K++AEKD
Sbjct  57   RMSSAIFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSDPNKSSAEKD  113

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESEDEELF  610
            +KRQ LL+L D+V S S + +E+ IAA  RM AVNLFR FPP  +  S   GE E+EE  
Sbjct  114  IKRQTLLDLIDYVDSSSSRFSEAVIAASSRMFAVNLFRVFPPNYRSGSSGGGEGEEEEPM  173

Query  611  FDPAWYHLQLVY  646
            F+PAW HLQLVY
Sbjct  174  FEPAWCHLQLVY  185



>gb|KFK27832.1| hypothetical protein AALP_AA8G435800 [Arabis alpina]
Length=502

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 119/187 (64%), Gaps = 7/187 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ L+K+PRKS K DS + +       + P           S  V   R N  KR+SS
Sbjct  1    MFKQFLSKLPRKSSKPDSNELNRTSSGPVSSPVQRSGASGGGGSGPV---RSNSGKRMSS  57

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV + EK  L VSK++LCC  +DF DP KN+ EKD+KRQ
Sbjct  58   AVFPASVVAGIEPLVP---FKDVPSSEKLNLFVSKVSLCCVTFDFSDPSKNSIEKDVKRQ  114

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL-FFDPAW  625
             LLEL DFVASGSVK TE AI A+CRMCAVNLFR FPP   S   G   D++   FDPAW
Sbjct  115  TLLELLDFVASGSVKFTEPAILAMCRMCAVNLFRVFPPNYRSSGGGGENDDDDPMFDPAW  174

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  175  PHLQIVY  181



>emb|CAC85920.1| protein phosphatase 2A B'kappa subunit [Oryza sativa Japonica 
Group]
 gb|AAT58738.1| protein phosphatase 2A B'kappa subunit [Oryza sativa Japonica 
Group]
Length=510

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 131/192 (68%), Gaps = 13/192 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNS--CNDPTNSGNGMQFTNSCNVI--ANRLNVVK  256
            M K  L+K+PRK+  S      GA  +S  C++   +GN +Q T+SC  I      + +K
Sbjct  1    MWKGFLSKLPRKTSASGR----GADLDSGQCSNGAGNGNPIQRTSSCGSIPSGRSTSTIK  56

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R+SSAIFP+S+VAG   I P + FKDV N EKQ L VSKLNLCC+V+DF DP+K++AEKD
Sbjct  57   RMSSAIFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSDPNKSSAEKD  113

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESEDEELF  610
            +KRQ LL+L D+V S S + +E+ IAA  RM AVNLFR FPP  + +S   GE E+EE  
Sbjct  114  IKRQTLLDLIDYVDSSSSRFSEAVIAASSRMFAVNLFRVFPPNYRSSSSGGGEGEEEEPM  173

Query  611  FDPAWYHLQLVY  646
            F+PAW HLQLVY
Sbjct  174  FEPAWCHLQLVY  185



>gb|KJB27047.1| hypothetical protein B456_004G274600 [Gossypium raimondii]
Length=429

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 121/188 (64%), Gaps = 10/188 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            ML+Q L+KIPR    SDS +    +PNS      +G     +NS N    R    KR SS
Sbjct  1    MLRQFLSKIPRSFGNSDSPEL--TRPNSF---MTAGLHTHRSNSFNSGCGRPCATKRTSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            +IFPAS+VAG   I P L FK+  N EK  L VSK++LCC+ +DF D  KN+ EKD+KRQ
Sbjct  56   SIFPASVVAG---IEPLLPFKNAPNSEKMNLFVSKVSLCCATFDFSDATKNSIEKDVKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESEDEELFFDPA  622
             LLEL DFVASGS++ +E AI A+CRMC+ NLFR FPP  +  +   GE++D++  F  A
Sbjct  113  TLLELLDFVASGSIRFSEPAILAMCRMCSTNLFRVFPPNYRSITSNNGENDDDDPIFCSA  172

Query  623  WYHLQLVY  646
            W HLQ+VY
Sbjct  173  WPHLQIVY  180



>ref|XP_003567932.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Brachypodium distachyon]
Length=506

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 125/189 (66%), Gaps = 11/189 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI--ANRLNVVKRV  262
            M KQ L+K+PRKS  S   D    Q ++ N     G+ +Q T+SC  I      + +KR+
Sbjct  1    MWKQFLSKLPRKSSGSGRDDFDSGQCSNGN-----GSSIQRTSSCGSIPAGRSTSTIKRM  55

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FP+S+VAG   I P + FKDV N EKQ L VSKLNLCC+V+DF DP K++AEKD+K
Sbjct  56   SSAVFPSSVVAG---IEPLVSFKDVPNSEKQNLFVSKLNLCCAVFDFSDPSKSSAEKDIK  112

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL-FFDP  619
            RQ LL+L DFV S S + +E+ IAA  RM AVNLFR FPP   S + G   DE+   FDP
Sbjct  113  RQTLLDLVDFVDSSSSRFSEAVIAACSRMFAVNLFRVFPPNYRSGSGGGEGDEDEPMFDP  172

Query  620  AWYHLQLVY  646
            AW HLQLVY
Sbjct  173  AWCHLQLVY  181



>ref|XP_002516615.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF45956.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=498

 Score =   160 bits (406),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 118/190 (62%), Gaps = 17/190 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDP-TNSGNGMQFTNSCNVIANRLNVVKRVS  265
            M KQ L+K+PRK           ++P S     T S +  +  NS      + N  KR S
Sbjct  1    MFKQFLSKLPRK----------SSKPESTESTRTESPSVQRCNNSSPASGVKSNGPKRTS  50

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+VAG E + P   FKDV + E+  L VSK++LCC  +DF DP KN  EKD+K+
Sbjct  51   SAVFPASVVAGIEPLVP---FKDVPSAERMNLFVSKVSLCCVTFDFTDPTKNTLEKDVKK  107

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDE---ELFFD  616
            Q LLEL DFVASGS+K +E AI A+CRMCAVNLFR F     S++   SE+E   E  FD
Sbjct  108  QTLLELLDFVASGSMKFSEPAILAMCRMCAVNLFRVFQQNYRSNSISMSENEDNDEPMFD  167

Query  617  PAWYHLQLVY  646
            PAW HLQ+VY
Sbjct  168  PAWPHLQIVY  177



>ref|XP_004292963.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Fragaria vesca subsp. vesca]
Length=525

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 130/207 (63%), Gaps = 24/207 (12%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQ------------PNSCNDPTNSGNGMQFTNSCNVI  232
            MLKQ L+++PRK+LK DS   SG+             P+  +    S  G+   N+ +  
Sbjct  1    MLKQFLSRLPRKALKGDSGGDSGSPRTTTPRSTSRTGPSGLSGTPRSNGGLSNANNNSNN  60

Query  233  AN------RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSV  394
             +      R +  KR+SSA+FPAS+VAG E + P   FKDV   EK  L VSK++LCC  
Sbjct  61   NHPGQAQQRPSGPKRMSSAVFPASVVAGIEPLVP---FKDVPGSEKMNLFVSKVSLCCVT  117

Query  395  YDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS  574
            +DF DP KN+ EKD+KRQ LLEL +FV+S S+K +E AI A CRMCA+NLFR FPP   S
Sbjct  118  FDFTDPTKNSIEKDVKRQTLLELVEFVSSASMKFSEPAILATCRMCAINLFRVFPPNYRS  177

Query  575  HA---RGESEDEELFFDPAWYHLQLVY  646
            ++    GE+ED+E  FDPAW HLQ+VY
Sbjct  178  NSGVGGGENEDDEPTFDPAWPHLQIVY  204



>ref|XP_003588682.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES58933.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=494

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 119/190 (63%), Gaps = 17/190 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQI  K+PRK+ K+        + +  +    +G   Q          R +     SS
Sbjct  1    MLKQIFNKLPRKTSKTY-----SDESSRVDSSRAAGKSHQRPQGAAASLKRAS-----SS  50

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+V+G E + P   FKDV N EK  L VSKL+LCC  +DF DP KN AEKD+KR+
Sbjct  51   AVFPASMVSGIEPLVP---FKDVPNAEKMNLFVSKLSLCCVTFDFTDPGKNVAEKDVKRK  107

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH----ARGESEDEELFFD  616
             L+EL DFVA GS+K +E AI A+CRMCA+NLFR FPP   ++    + GE++D++  FD
Sbjct  108  TLVELVDFVACGSMKFSEPAILAMCRMCAINLFRVFPPNYRANGVVASGGETDDDDPMFD  167

Query  617  PAWYHLQLVY  646
            PAW HLQLVY
Sbjct  168  PAWPHLQLVY  177



>gb|KJB27048.1| hypothetical protein B456_004G274600 [Gossypium raimondii]
Length=501

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 121/188 (64%), Gaps = 10/188 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            ML+Q L+KIPR    SDS +    +PNS      +G     +NS N    R    KR SS
Sbjct  1    MLRQFLSKIPRSFGNSDSPEL--TRPNSF---MTAGLHTHRSNSFNSGCGRPCATKRTSS  55

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            +IFPAS+VAG   I P L FK+  N EK  L VSK++LCC+ +DF D  KN+ EKD+KRQ
Sbjct  56   SIFPASVVAG---IEPLLPFKNAPNSEKMNLFVSKVSLCCATFDFSDATKNSIEKDVKRQ  112

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESEDEELFFDPA  622
             LLEL DFVASGS++ +E AI A+CRMC+ NLFR FPP  +  +   GE++D++  F  A
Sbjct  113  TLLELLDFVASGSIRFSEPAILAMCRMCSTNLFRVFPPNYRSITSNNGENDDDDPIFCSA  172

Query  623  WYHLQLVY  646
            W HLQ+VY
Sbjct  173  WPHLQIVY  180



>ref|XP_008785883.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Phoenix dactylifera]
 ref|XP_008785890.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Phoenix dactylifera]
Length=507

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 124/186 (67%), Gaps = 4/186 (2%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ ++K+PRKS K D+  +S    N  N+    GN ++ T S N + +    +KR++S
Sbjct  1    MWKQFISKLPRKSSKYDTASNSPPS-NPGNNAAACGNPIERTASGNGLPDGAASMKRLAS  59

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A FP+S+V G   I P + FKDV N EKQ + +SKLNLCC ++DF DP+K++  KDLKRQ
Sbjct  60   AEFPSSVVVG---IEPLISFKDVPNFEKQNVFLSKLNLCCIIFDFSDPNKDSVGKDLKRQ  116

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
             L+EL D+V++ + + T+  IAA CRM A+NLFR FPP   +++     +EEL FDPAW 
Sbjct  117  TLIELVDYVSTDAPRFTDQMIAASCRMFAINLFRVFPPSHRANSSIGEAEEELVFDPAWS  176

Query  629  HLQLVY  646
            HLQ+VY
Sbjct  177  HLQIVY  182



>gb|AFW81037.1| hypothetical protein ZEAMMB73_275381 [Zea mays]
Length=504

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 120/192 (63%), Gaps = 20/192 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANR---LNVVKR  259
            M KQ L+K+PR+S               C+    SG G+Q T+SC  I       + ++R
Sbjct  1    MWKQFLSKLPRRSSA-------SGDSGHCS----SGAGIQRTSSCGSIPPGRPPASAIRR  49

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
            +SSA+FP+S+VAG   I P + FKDV + EKQ L VSKL+LCC V+DF DPD+++ EKD+
Sbjct  50   MSSAVFPSSVVAG---IEPLVSFKDVPSSEKQSLFVSKLSLCCVVFDFSDPDRSSVEKDI  106

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC---ASHARGESEDEELF  610
            KRQ LL+L +FV S + + +E+A+ A  RMCAVNLFR FP  C    S   GE +++E  
Sbjct  107  KRQALLDLIEFVESTNARFSEAAVVACSRMCAVNLFRAFPASCRSGGSSGVGECDEDEPM  166

Query  611  FDPAWYHLQLVY  646
            FD  W HL LVY
Sbjct  167  FDTGWCHLHLVY  178



>ref|XP_011026522.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Populus euphratica]
Length=500

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 122/189 (65%), Gaps = 14/189 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            ML+QIL+K+PRKS K+D  +   A+P S   P           S        N  KR SS
Sbjct  2    MLRQILSKLPRKSSKTDLAE--SARPES---PVTQQIS---NGSSAGSGKSSNGPKRTSS  53

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS+VAG E + P   FKDV N EK  L VSK++LCC  +DF D  KN  EKD+KRQ
Sbjct  54   VVFPASVVAGIEPLVP---FKDVPNAEKMNLFVSKVSLCCVTFDFSDSSKNTLEKDVKRQ  110

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESED-EELFFDP  619
             LLEL DFVA+GS+K +E AI A+CRMCAVNLFR FPP  +  S + GE++D ++  FDP
Sbjct  111  TLLELVDFVAAGSMKFSEPAILAMCRMCAVNLFRVFPPNYRSNSSSIGENDDNDDPMFDP  170

Query  620  AWYHLQLVY  646
            AW HLQ+VY
Sbjct  171  AWPHLQIVY  179



>ref|XP_002458327.1| hypothetical protein SORBIDRAFT_03g031350 [Sorghum bicolor]
 gb|EES03447.1| hypothetical protein SORBIDRAFT_03g031350 [Sorghum bicolor]
Length=500

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 127/190 (67%), Gaps = 8/190 (4%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI--ANRLNVVKRV  262
            M KQ L K+P+KS  S   D  G+  +   + T +G  +Q T+SC     A  ++ VKR+
Sbjct  1    MWKQFLTKLPKKSSASGKGDH-GSGSSPGRNATGNGGTIQRTSSCPSAGPARPVSSVKRM  59

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FP+S+VAG   I P + FKDV NGEKQ L VSK++LCC V+DF DP+KN+AEKD K
Sbjct  60   SSAVFPSSVVAG---IEPLVSFKDVPNGEKQNLFVSKVSLCCVVFDFSDPNKNSAEKDFK  116

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP--KCASHARGESEDEELFFD  616
            RQ L++L ++V S S + TE+ +AA CRM  +NLFR FPP  +  S   GE E+EE  FD
Sbjct  117  RQALVDLMEYVDSASSRFTETMVAACCRMFTINLFRVFPPNYRSGSSGGGEGEEEEPMFD  176

Query  617  PAWYHLQLVY  646
            PAW HL LVY
Sbjct  177  PAWPHLHLVY  186



>emb|CDP18419.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 120/191 (63%), Gaps = 21/191 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLK I +++PRKSL         A+    +DP       Q +   +        +KR SS
Sbjct  1    MLKHIFSRLPRKSLS-------KAESLDSSDP-----FCQNSGCSSGRGAGGGALKRASS  48

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS+VAG E + P   FKDV + EK  L +SKL+LCC V+DF +P KN +EK+LKR 
Sbjct  49   AVFPASVVAGFEPLVP---FKDVPSSEKMNLFISKLSLCCVVFDFTNPSKNTSEKELKRA  105

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC-----ASHARGESEDEELFF  613
             L+EL DFV+S +VK +E AI  VC+MCAVNLFR FPP       +SHA  E++D+E  F
Sbjct  106  TLIELVDFVSSNTVKYSEPAILVVCKMCAVNLFRVFPPDHRSKNNSSHA-SENDDDEPTF  164

Query  614  DPAWYHLQLVY  646
            DPAW HLQLVY
Sbjct  165  DPAWSHLQLVY  175



>ref|XP_008809266.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Phoenix dactylifera]
Length=509

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 128/188 (68%), Gaps = 6/188 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ L+K+PRKS KSDS     A  +S ++ ++SGN +Q  +S N    R   VKR+SS
Sbjct  1    MWKQFLSKLPRKSSKSDSSLD-SAHNHSGSNASSSGNSIQRASSGNAGPGRSTTVKRMSS  59

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+S+VAG   I P L FKDV N EKQ L +SKLNLC +V DF DP+KN+AEKD+KR 
Sbjct  60   AVFPSSVVAG---IEPLLSFKDVPNNEKQNLFISKLNLCSAVLDFSDPNKNSAEKDMKRL  116

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELF--FDPA  622
             LL+L DFV SG+ + TE  I+A CRM A+NLFR FPP   +++    E EE    FDPA
Sbjct  117  TLLDLVDFVNSGTPRFTEPMISASCRMFAINLFRVFPPNYRTNSSSGGETEEEEPTFDPA  176

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  177  WSHLQLVY  184



>ref|XP_011087131.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Sesamum indicum]
Length=491

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 118/189 (62%), Gaps = 16/189 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQIL+K+PRKS K D       Q N  + P     G     + N  A      KR S+
Sbjct  1    MWKQILSKLPRKSQKPDQ----DLQRNPDSGPNTPSLGSGRIGAANPAA------KRASA  50

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS++AG   I P L FKDVS+ EK  L +SKL+LCC V+DF DP KN  EK+LKR 
Sbjct  51   AVFPASVIAG---IEPLLPFKDVSSSEKMNLFISKLSLCCVVFDFTDPAKNIQEKELKRA  107

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH--ARGESE-DEELFFDP  619
             LLEL +FV+    K +E AI A C+MC++NLFR FPP C S   + GE++ D+E  FDP
Sbjct  108  TLLELLEFVSENPPKFSEPAILASCKMCSINLFRVFPPHCRSRNTSSGENDNDDEPMFDP  167

Query  620  AWYHLQLVY  646
            AW HLQ+VY
Sbjct  168  AWSHLQIVY  176



>ref|XP_004969559.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Setaria italica]
Length=500

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 123/191 (64%), Gaps = 10/191 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksds-ldssGAQPNSCNDPTNSGNGMQFTNSCNVI--ANRLNVVKR  259
            M KQ L K+PRKS  S      SG+ P    +   +G+ +Q T+SC     A   + VKR
Sbjct  1    MWKQFLPKLPRKSSASGKGDHVSGSSPG--RNAAGNGSAIQRTSSCPSAGPARPASSVKR  58

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
            +SSA+FP+S+VAG   I P + FKDV NGEK  L VSK++LCC V+DF DP+KN+AEKD 
Sbjct  59   MSSAVFPSSVVAG---IEPLVSFKDVPNGEKPNLFVSKVSLCCVVFDFSDPNKNSAEKDF  115

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL--FF  613
            KRQ L++L D+V S S + TE  + A CRM A+NLFR FPP C S + G  E EE    F
Sbjct  116  KRQALVDLVDYVDSASSRFTEPMVVACCRMFAINLFRVFPPNCRSSSSGGGEGEEEEPMF  175

Query  614  DPAWYHLQLVY  646
            DPAW HL LVY
Sbjct  176  DPAWPHLHLVY  186



>ref|XP_003550157.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform 1 [Glycine max]
Length=492

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 125/187 (67%), Gaps = 9/187 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGA-QPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            MLKQIL+K+PRKSLK DS +S       S + P  +G   +     +  A      +  S
Sbjct  1    MLKQILSKLPRKSLKPDSDESPRVDSARSADSPRAAGRSNKPHGGSSSAAK-----RASS  55

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS+V+G E + P   FKDV N EK  L VSKL+LCC  +DF DP K++A+KD+KR
Sbjct  56   SAVFPASMVSGIEPLVP---FKDVPNAEKMNLFVSKLSLCCVTFDFTDPSKSSADKDVKR  112

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAW  625
            + L+EL DFVA G+++ +E AI A+CRMCA+NLFR FPP   +   GE++D+E  FDPAW
Sbjct  113  KTLVELVDFVACGTMRFSEPAILAICRMCAINLFRVFPPNYRASGGGENDDDEPLFDPAW  172

Query  626  YHLQLVY  646
             HLQLVY
Sbjct  173  PHLQLVY  179



>ref|NP_001056272.1| Os05g0555100 [Oryza sativa Japonica Group]
 dbj|BAF18186.1| Os05g0555100, partial [Oryza sativa Japonica Group]
Length=449

 Score =   155 bits (392),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 116/162 (72%), Gaps = 7/162 (4%)
 Frame = +2

Query  173  CNDPTNSGNGMQFTNSCNVI--ANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNG  346
            C++   +GN +Q T+SC  I      + +KR+SSAIFP+S+VAG   I P + FKDV N 
Sbjct  59   CSNGAGNGNPIQRTSSCGSIPSGRSTSTIKRMSSAIFPSSVVAG---IEPLVSFKDVPNS  115

Query  347  EKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCR  526
            EKQ L VSKLNLCC+V+DF DP+K++AEKD+KRQ LL+L D+V S S + +E+ IAA  R
Sbjct  116  EKQNLFVSKLNLCCAVFDFSDPNKSSAEKDIKRQTLLDLIDYVDSSSSRFSEAVIAASSR  175

Query  527  MCAVNLFRDFPP--KCASHARGESEDEELFFDPAWYHLQLVY  646
            M AVNLFR FPP  + +S   GE E+EE  F+PAW HLQLVY
Sbjct  176  MFAVNLFRVFPPNYRSSSSGGGEGEEEEPMFEPAWCHLQLVY  217



>ref|XP_007137075.1| hypothetical protein PHAVU_009G097600g [Phaseolus vulgaris]
 gb|ESW09069.1| hypothetical protein PHAVU_009G097600g [Phaseolus vulgaris]
Length=497

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 97/189 (51%), Positives = 124/189 (66%), Gaps = 10/189 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCND-PTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            MLKQ L+++PRK+ K DS +S  A  +  +D P  +G      +  + +A   N  KR S
Sbjct  1    MLKQFLSRLPRKTPKPDSDESCRADSSRSDDSPRAAGRH----SRAHGVAAASNAAKRTS  56

Query  266  S-AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            S A+FPAS V+  E + P   FKDV + EK  L VSKL+LCC  +DF DP KN  EK++K
Sbjct  57   SSAVFPASTVSVIEPLVP---FKDVPSAEKMNLFVSKLSLCCVSFDFRDPVKNTVEKEVK  113

Query  443  RQVLLELNDFVAS-GSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDP  619
            R+ L+EL DFV+S GS +  E AI AVCRMCA+NLFR FPP   S+  GE+ED+E  FDP
Sbjct  114  RKTLVELVDFVSSCGSSRFGEPAILAVCRMCAINLFRVFPPNYRSNRGGENEDDEPAFDP  173

Query  620  AWYHLQLVY  646
            AW HLQLVY
Sbjct  174  AWPHLQLVY  182



>gb|EYU21914.1| hypothetical protein MIMGU_mgv1a005231mg [Erythranthe guttata]
Length=492

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 119/190 (63%), Gaps = 17/190 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQIL KIP+KS K D        PNS  + ++ G+    TN+           KR S+
Sbjct  2    MWKQILGKIPKKSQKPDQDS--SRNPNSGPNTSSPGSIRANTNTP--------AAKRASA  51

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP  ++AG   I P L FKDVS+ EK  L +SKL+LCC V+DF DP KN  EK+LKR 
Sbjct  52   AVFPTCVIAG---IEPLLAFKDVSSSEKMNLFISKLSLCCVVFDFTDPAKNVQEKELKRA  108

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR---GESE-DEELFFD  616
             L+EL DFV+    K +E AI A C+MC+VNLFR FPP C S++    GE++ D+E  FD
Sbjct  109  TLIELLDFVSQNPPKFSEPAILASCKMCSVNLFRVFPPNCRSNSNPTSGENDNDDEPTFD  168

Query  617  PAWYHLQLVY  646
            PAW HLQ+VY
Sbjct  169  PAWPHLQIVY  178



>emb|CDY54903.1| BnaC02g48620D [Brassica napus]
Length=486

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 118/189 (62%), Gaps = 30/189 (16%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ L+K+PRK           ++P+S +DP+ S               R N VKR+SS
Sbjct  1    MFKQFLSKLPRK----------SSKPDSTSDPSGSS------------VVRSNSVKRMSS  38

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+S+VAG E + P   FKDV   EK  L VSKL+LCC  +DF D  KN+ EKD+KRQ
Sbjct  39   AVFPSSVVAGIEPLVP---FKDVPTSEKLNLFVSKLSLCCVTFDFSDQTKNSIEKDVKRQ  95

Query  449  VLLELNDFV---ASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDP  619
             LLEL DFV   +S SV+ TE AI A+C+M AVNLFR FPP  +   R +S+D +  F+P
Sbjct  96   TLLELLDFVSSSSSSSVRFTEPAILAMCKMSAVNLFRVFPP--SYRERNDSDDNDPTFEP  153

Query  620  AWYHLQLVY  646
            AW HLQ+VY
Sbjct  154  AWPHLQIVY  162



>ref|XP_003603467.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Medicago truncatula]
 gb|AES73718.1| protein phosphatase 2A regulatory B subunit family protein [Medicago 
truncatula]
Length=499

 Score =   154 bits (389),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 120/191 (63%), Gaps = 12/191 (6%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQ L+K+PRK+ K DS +S     +  +  T   N  Q  N       + N  KR SS
Sbjct  1    MLKQFLSKLPRKASKHDSDESCRVDSHDSHRVTGKNNRSQGGND----GGKANAAKRNSS  56

Query  269  A-IFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            A +FP S V+  E + P   FKDV + EK  L VSKL+LCC  +DF D  KN  EKD+KR
Sbjct  57   AAVFPTSTVSLIEPLVP---FKDVPSSEKMNLFVSKLSLCCVAFDFTDSGKNVVEKDVKR  113

Query  446  QVLLELNDFVAS-GSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR---GESEDEELFF  613
            + L+EL DFV+S GS K +E AI A+CRMCA+NLFR FPP   +H R   GE++D+E  F
Sbjct  114  RTLVELVDFVSSFGSAKFSEPAILAMCRMCAINLFRVFPPHYRAHNRIGGGENDDDEPAF  173

Query  614  DPAWYHLQLVY  646
            DPAW HLQLVY
Sbjct  174  DPAWPHLQLVY  184



>ref|XP_010925297.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
 ref|XP_010925298.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Elaeis guineensis]
Length=507

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 121/194 (62%), Gaps = 20/194 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDP--------TNSGNGMQFTNSCNVIANRL  244
            M KQ ++K+PRKS             N  N P           GN ++ T S N + +  
Sbjct  1    MWKQFISKLPRKS---------SKYDNGSNSPPNNAGNNAAACGNPVERTASGNGLPDGA  51

Query  245  NVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNA  424
              +KR++SA FP+S+VAG   I P + FKDV N EKQ + +SKLNLCC ++DF DP+K++
Sbjct  52   ASLKRLASAEFPSSVVAG---IEPLISFKDVPNLEKQNVFLSKLNLCCIIFDFSDPNKDS  108

Query  425  AEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEE  604
              KDLKRQ L+EL D+V++ + + T+  IA+ CRM A+NLFR FPP   +++ G   +EE
Sbjct  109  MGKDLKRQTLIELVDYVSTDAPRFTDQMIASSCRMFAINLFRVFPPNHRANSLGGEAEEE  168

Query  605  LFFDPAWYHLQLVY  646
            L FDPAW HLQ+VY
Sbjct  169  LVFDPAWSHLQIVY  182



>emb|CDY05497.1| BnaA02g31940D [Brassica napus]
Length=485

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 118/187 (63%), Gaps = 27/187 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ L+K+PRKS          ++P+S +DP+ S               R N VKR+SS
Sbjct  1    MFKQFLSKLPRKS---------SSKPDSTSDPSGSS------------VVRSNSVKRMSS  39

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+S+VAG E + P   FKDV   EK  L VSKL+LCC  +DF D  KN+ EKD+KRQ
Sbjct  40   AVFPSSVVAGIEPLVP---FKDVPTSEKLNLFVSKLSLCCVTFDFSDQTKNSLEKDVKRQ  96

Query  449  VLLELNDF-VASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAW  625
             LLEL DF  +S SV+ TE AI A+C+M AVNLFR FPP  +   R +S+D +  F+PAW
Sbjct  97   TLLELLDFVSSSSSVRFTEPAILAMCKMSAVNLFRVFPP--SYRERNDSDDNDPTFEPAW  154

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  155  PHLQIVY  161



>ref|XP_009129957.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Brassica rapa]
Length=487

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 118/187 (63%), Gaps = 27/187 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ L+K+PRKS          ++P+S +DP+ S               R N VKR+SS
Sbjct  3    MFKQFLSKLPRKS---------SSKPDSTSDPSGSS------------VVRSNSVKRMSS  41

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP+S+VAG E + P   FKDV   EK  L VSKL+LCC  +DF D  KN+ EKD+KRQ
Sbjct  42   AVFPSSVVAGIEPLVP---FKDVPTSEKLNLFVSKLSLCCVTFDFSDQTKNSLEKDVKRQ  98

Query  449  VLLELNDF-VASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAW  625
             LLEL DF  +S SV+ TE AI A+C+M AVNLFR FPP  +   R +S+D +  F+PAW
Sbjct  99   TLLELLDFVSSSSSVRFTEPAILAMCKMSAVNLFRVFPP--SYRERNDSDDNDPTFEPAW  156

Query  626  YHLQLVY  646
             HLQ+VY
Sbjct  157  PHLQIVY  163



>ref|XP_002284526.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
 ref|XP_010648553.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Vitis vinifera]
Length=492

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 114/187 (61%), Gaps = 17/187 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+++PR            A      D   +  G   ++S +  +   +  K  +S
Sbjct  1    MLKQILSRLPR-----------KALKAESGDLVRTDTGTPRSSSGSPGSRPTSAKK--TS  47

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            ++FP + VAG E   P   F DV   EK  L VSKLNLCC+V+DF DP KN+ EKD+KRQ
Sbjct  48   SVFPTNAVAGVE---PSAAFNDVPIAEKLNLFVSKLNLCCTVFDFNDPSKNSIEKDVKRQ  104

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR-GESEDEELFFDPAW  625
             L+EL DF+ SG  + TE  IAA+C+MCA NLFR FPP   S++  GE++D+E  FDPAW
Sbjct  105  TLIELVDFMVSGPPRFTEPVIAAMCKMCATNLFRVFPPNYRSNSLGGENDDDEPTFDPAW  164

Query  626  YHLQLVY  646
             HLQLVY
Sbjct  165  SHLQLVY  171



>ref|XP_011081886.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Sesamum indicum]
Length=490

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 119/193 (62%), Gaps = 24/193 (12%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNV----VK  256
            M KQIL K+PRK            +P    D  ++ N     NS +  ++R+N      K
Sbjct  1    MWKQILGKLPRK----------SQKP----DQDSTRNPSLGPNSSSPGSSRVNASSPAAK  46

Query  257  RVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKD  436
            R S+A+FPAS++AG   I P L FKDV + EK  L +SKL+LCC V+DF DP KN  EK+
Sbjct  47   RASAAVFPASVIAG---IEPLLAFKDVPSSEKMNLFISKLSLCCVVFDFTDPAKNIQEKE  103

Query  437  LKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH--ARGESE-DEEL  607
            LKR  LLEL DFV+    K +E AI A C+MC++NLFR FPP C S   + GE++ D+E 
Sbjct  104  LKRATLLELLDFVSQNPPKFSEPAILASCKMCSINLFRVFPPNCRSSNTSSGENDNDDEP  163

Query  608  FFDPAWYHLQLVY  646
             FDPAW HLQ+VY
Sbjct  164  TFDPAWSHLQIVY  176



>ref|XP_004241801.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Solanum lycopersicum]
Length=498

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 120/194 (62%), Gaps = 26/194 (13%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIAN----RLNVV-  253
            M K  L+K+P+KSLK              ++  +SG G   +NS N  +N    R N V 
Sbjct  1    MWKHFLSKLPKKSLK--------------SESVDSGRGNSDSNSPNASSNLGPGRPNSVP  46

Query  254  KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEK  433
            +R SS +FPAS++AG   I P + FKDV + EK  L +SKL+LCC  +DF DP KN AEK
Sbjct  47   RRTSSVVFPASVIAG---IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRDPTKNVAEK  103

Query  434  DLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCA---SHARGESEDEE  604
            +LKR  L EL DFV++   K +E AI A+C+ CAVNLFR FPP      SHA  E++D+E
Sbjct  104  ELKRATLFELLDFVSANPPKFSEPAILALCKTCAVNLFRVFPPNYRSNNSHA-SENDDDE  162

Query  605  LFFDPAWYHLQLVY  646
              FDPAW HLQ+VY
Sbjct  163  PTFDPAWPHLQIVY  176



>ref|XP_009619322.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Nicotiana tomentosiformis]
Length=499

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 114/192 (59%), Gaps = 21/192 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTN-SCNVIANRLN--VVKR  259
            M K  L+K+P+            A  +   D     +G    N S N+ + R N   ++R
Sbjct  1    MWKHFLSKLPK-----------KALKSESVDSARGNSGSHGPNASPNLGSGRPNSSALRR  49

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
             SS +FPAS++AG   I P + FKDV + EK  L +SKL+LCC  +DF DP KN AEK+L
Sbjct  50   TSSVVFPASVIAG---IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRDPTKNVAEKEL  106

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCA---SHARGESEDEELF  610
            KR  L EL DFV+S   K +E AI A+C+ CAVNLFR FPP      SHA  E+ED+E  
Sbjct  107  KRATLFELLDFVSSNPPKFSEPAILAMCKTCAVNLFRVFPPNYRSSNSHA-SENEDDEPT  165

Query  611  FDPAWYHLQLVY  646
            FDPAW HLQ+VY
Sbjct  166  FDPAWPHLQIVY  177



>ref|XP_006353657.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Solanum tuberosum]
Length=498

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 118/188 (63%), Gaps = 14/188 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M K  L+K+P+KSLKS+S+D      +S +   +S  G    NS         V +R SS
Sbjct  1    MWKHFLSKLPKKSLKSESVDLGRGNSDSHSPNASSNLGPGRPNS---------VPRRTSS  51

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +FPAS++AG   I P + FKDV + EK  L +SKL+LCC  +DF DP KN AEK+LKR 
Sbjct  52   VVFPASVIAG---IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRDPTKNVAEKELKRA  108

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESE--DEELFFDPA  622
             L EL DFV++   K +E AI A+C+ CAVNLFR FPP   S++   SE  D+E  FDPA
Sbjct  109  TLFELLDFVSANPPKFSEPAILALCKTCAVNLFRVFPPNYRSNSSQTSENDDDEPTFDPA  168

Query  623  WYHLQLVY  646
            W HLQ+VY
Sbjct  169  WPHLQIVY  176



>ref|XP_009798807.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform [Nicotiana sylvestris]
Length=499

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 123/191 (64%), Gaps = 19/191 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldss--GAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRV  262
            M K  L+K+P+K+LKS+S+DS+   + P   N   N G+G    NS        + ++R 
Sbjct  1    MWKHFLSKLPKKALKSESVDSARGNSGPLGPNASPNLGSGR--PNS--------SALRRT  50

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SS +FPAS++AG   I P + FKDV + EK  L +SKL+LCC  +DF DP KN AEK+LK
Sbjct  51   SSVVFPASVIAG---IEPLISFKDVPSSEKMNLFISKLSLCCVDFDFRDPTKNVAEKELK  107

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCA---SHARGESEDEELFF  613
            R  L EL DFV+S   K +E AI A+C+ CAVNLFR FPP      SHA  E++D+E  F
Sbjct  108  RATLFELLDFVSSNPPKFSEPAILAMCKTCAVNLFRVFPPNYRSSNSHA-SENDDDEPTF  166

Query  614  DPAWYHLQLVY  646
            DPAW HLQ+VY
Sbjct  167  DPAWPHLQIVY  177



>gb|KHN10390.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Glycine soja]
Length=430

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 89/120 (74%), Gaps = 3/120 (3%)
 Frame = +2

Query  287  IVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELN  466
            +V+G E + P   FKDV N EK  L VSKL+LCC  +DF DP K++A+KD+KR+ L+EL 
Sbjct  1    MVSGIEPLVP---FKDVPNAEKMNLFVSKLSLCCVTFDFTDPSKSSADKDVKRKTLVELV  57

Query  467  DFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWYHLQLVY  646
            DFVA G+++ +E AI A+CRMCA+NLFR FPP   +   GE++D+E  FDPAW HLQLVY
Sbjct  58   DFVACGTMRFSEPAILAICRMCAINLFRVFPPNYRASGGGENDDDEPLFDPAWPHLQLVY  117



>ref|XP_003522642.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Glycine max]
Length=496

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 120/188 (64%), Gaps = 9/188 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCND-PTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            MLKQ L+K+PRK+ K DS +S  A  +  +D P  +   ++               K  S
Sbjct  1    MLKQFLSKLPRKAPKPDSDESCRADSSRSDDSPRAASRNIRPPGG----GGSSAAKKTSS  56

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            SA+FPAS V+  E + P   FKDV + EK  L VSKL+LCC  +DF DP KN  EK++KR
Sbjct  57   SAVFPASTVSLIEPLVP---FKDVPSSEKMNLFVSKLSLCCVTFDFTDPGKNTVEKEVKR  113

Query  446  QVLLELNDFVAS-GSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPA  622
            + L+EL DFV+S GS + +E AI AVCRMCA+NLFR FPP   S+  GE++D+E  FDPA
Sbjct  114  RTLVELVDFVSSCGSSRFSEPAILAVCRMCAINLFRVFPPNYRSNRGGENDDDEPAFDPA  173

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  174  WPHLQLVY  181



>ref|XP_004501280.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X1 [Cicer arietinum]
 ref|XP_004501281.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like isoform X2 [Cicer arietinum]
Length=498

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 117/187 (63%), Gaps = 5/187 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQ L+K+PRK+ K +S +SS    +S      +              N  +  K  S+
Sbjct  1    MLKQFLSKLPRKASKPESDESSRGDSSSPRAAGKNNRSNGGNGGGTSAKNNPSK-KNSSA  59

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPAS V+  E + P   FKDV + EK  L VSKL+LCC  +DF DP KN  EKD+KR+
Sbjct  60   AVFPASTVSLIEPLVP---FKDVPSSEKMNLFVSKLSLCCVSFDFTDPGKNVVEKDVKRR  116

Query  449  VLLELNDFVAS-GSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAW  625
             L+EL DFV++ GS + +E AI A+CRMCA+NLFR FPP   ++  GE++D+E  FDPAW
Sbjct  117  TLVELVDFVSTFGSSRFSEPAILAMCRMCAINLFRVFPPNYRANRGGENDDDEPSFDPAW  176

Query  626  YHLQLVY  646
             HL LVY
Sbjct  177  PHLHLVY  183



>gb|EPS62004.1| hypothetical protein M569_12788, partial [Genlisea aurea]
Length=473

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 112/189 (59%), Gaps = 19/189 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ L K+PRK+ K D        P S +   + G+G   TN+ N         K  S+
Sbjct  1    MWKQFLGKLPRKTQKPDPD-----SPISASATLSPGSGR--TNAVNA------AYKLASA  47

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FPA ++AG E   P L FKDV   EK  L +SKL+LCC V+DF DP KN  EK+LKR 
Sbjct  48   AVFPACVIAGVE---PLLAFKDVPCSEKLNLFISKLSLCCVVFDFTDPAKNIQEKELKRA  104

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESE---DEELFFDP  619
             LLEL +FV+    K +E++I A C+MC+VNLFR FPP   S     SE   D+E  FDP
Sbjct  105  TLLELLEFVSQNPPKFSENSILAACKMCSVNLFRVFPPNSRSSNTTTSENENDDEPVFDP  164

Query  620  AWYHLQLVY  646
            AW HLQ+VY
Sbjct  165  AWSHLQIVY  173



>gb|EPS70113.1| hypothetical protein M569_04647, partial [Genlisea aurea]
Length=465

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 111/192 (58%), Gaps = 31/192 (16%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M KQ L K+P+K           A P+S   P +S            ++NR+N     +S
Sbjct  1    MWKQFLGKLPKKPQ--------KADPDSARTPLSSP-----------VSNRINATAAAAS  41

Query  269  A------IFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAE  430
                   +FP S++AG   I P + F++V + EK  L VSKLNLCC V+DF D  KN  E
Sbjct  42   KRASSSAVFPTSLIAG---IEPLVSFREVPSSEKMNLFVSKLNLCCVVFDFTDSSKNIQE  98

Query  431  KDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELF  610
            KDLKR  LL+L +FV+    K +E A+++ CRMC+VNLFR FPP+C+     E+EDE   
Sbjct  99   KDLKRAALLDLLEFVSQNPSKFSEDAVSSTCRMCSVNLFRIFPPRCS--VENENEDEPT-  155

Query  611  FDPAWYHLQLVY  646
            FDPAW HLQ+VY
Sbjct  156  FDPAWPHLQIVY  167



>ref|XP_003526435.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' iota isoform-like [Glycine max]
Length=497

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = +2

Query  272  IFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQV  451
            +FPAS V+  E + P   FKDV + EK  L VSKL+LCC  +DF DP KN  EK++KR+ 
Sbjct  60   VFPASTVSLIEPLVP---FKDVPSSEKMNLFVSKLSLCCVTFDFTDPGKNTVEKEVKRRT  116

Query  452  LLELNDFVAS-GSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAWY  628
            L+EL DFV+S GS +  E AI AVCRMCA+NLFR FPP   S+  GE++D+E  FDPAW 
Sbjct  117  LVELVDFVSSCGSSRFGEPAILAVCRMCAINLFRVFPPNYRSNRGGENDDDEPAFDPAWP  176

Query  629  HLQLVY  646
            HLQLVY
Sbjct  177  HLQLVY  182



>dbj|BAK03510.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 111/195 (57%), Gaps = 17/195 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIA--NRLNVVKRV  262
            M KQ L+K+PR             Q +  N     GN +Q T+S          + +KR+
Sbjct  1    MWKQFLSKLPRTKSSGGGGGGDSGQCSGGN-----GNPIQRTSSVPAGGGGRSASTIKRM  55

Query  263  SSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLK  442
            SSA+FP+S+VAG ES+   + FKDV + E+  L VSKL LCC+V+DF DP K++AEKD+K
Sbjct  56   SSAVFPSSVVAGIESL---VSFKDVPSSERHNLFVSKLGLCCAVFDFSDPAKSSAEKDIK  112

Query  443  RQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEEL-----  607
            RQ LL+L DFV S S +  E+ IAA  RM AVNLFR FPP   S                
Sbjct  113  RQTLLDLIDFVDSSSGRYPEAVIAACSRMLAVNLFRVFPPSYRSGGGSSGGGGGGEGDED  172

Query  608  --FFDPAWYHLQLVY  646
               FDPAW HLQLVY
Sbjct  173  EPMFDPAWCHLQLVY  187



>ref|NP_001146050.1| uncharacterized protein LOC100279581 [Zea mays]
 gb|ACL53110.1| unknown [Zea mays]
Length=455

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 93/132 (70%), Gaps = 6/132 (5%)
 Frame = +2

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
            +SSA+FP+S+VAG   I P + FKDV + EKQ L VSKL+LCC V+DF DPD+++ EKD+
Sbjct  1    MSSAVFPSSVVAG---IEPLVSFKDVPSSEKQSLFVSKLSLCCVVFDFSDPDRSSVEKDI  57

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC---ASHARGESEDEELF  610
            KRQ LL+L +FV S + + +E+A+ A  RMCAVNLFR FP  C    S   GE +++E  
Sbjct  58   KRQALLDLIEFVESTNARFSEAAVVACSRMCAVNLFRAFPASCRSGGSSGVGECDEDEPM  117

Query  611  FDPAWYHLQLVY  646
            FD  W HL LVY
Sbjct  118  FDTGWCHLHLVY  129



>gb|EPS71240.1| hypothetical protein M569_03516, partial [Genlisea aurea]
Length=471

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 108/191 (57%), Gaps = 31/191 (16%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M +Q L K+PRK            +P    DP +S            I++     KR SS
Sbjct  1    MWRQFLGKLPRK----------SQKP----DPDSSKGQ---------ISSPTTASKRASS  37

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
            A+FP  ++AG   I P L FKDV + E+  L V KLNLC  V+DF DP  +  EKDLKR 
Sbjct  38   AVFPTCLIAG---IEPLLAFKDVPSSERMNLFVGKLNLCSVVFDFTDPSTDVQEKDLKRA  94

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHA----RGESE-DEELFF  613
             LLEL DFV+    K  E+AI A CRMC++N+FR FPP  +S +     GE+E D+E  F
Sbjct  95   TLLELLDFVSRNPPKFPENAILAACRMCSINMFRVFPPNSSSRSGATTLGENENDDEPTF  154

Query  614  DPAWYHLQLVY  646
            DP+W HLQ+VY
Sbjct  155  DPSWQHLQIVY  165



>ref|XP_002448078.1| hypothetical protein SORBIDRAFT_06g020625 [Sorghum bicolor]
 gb|EES12406.1| hypothetical protein SORBIDRAFT_06g020625 [Sorghum bicolor]
Length=407

 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/206 (37%), Positives = 108/206 (52%), Gaps = 23/206 (11%)
 Frame = +2

Query  68   IHWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLN  247
            + W +  M+KQIL ++PRK            +     +   +GNG + +NS +V  +   
Sbjct  9    VSWFWWEMIKQILGRLPRKP----------GKAGDSREAAAAGNGTEPSNSYSVARSMDP  58

Query  248  VVKR-------VSSAIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVY  397
              KR       V S + P  ++ G     S  P   FKDV   EKQ L V K+NLCC+VY
Sbjct  59   GNKRAGNGDYPVPSGVTPNPVMNGAVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCAVY  118

Query  398  DFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH  577
            DF DP KN  EK++KRQ L+EL D+V S + K +E  +  + +M ++NLFR   P    +
Sbjct  119  DFADPTKNLKEKEVKRQTLMELVDYVTSANGKFSEVVMLEITKMVSINLFRTSSPTPREN  178

Query  578  ARGES---EDEELFFDPAWYHLQLVY  646
               E    E++E   DPAW HLQ+VY
Sbjct  179  KAIEGVDLEEDEPLMDPAWSHLQIVY  204



>emb|CDY38628.1| BnaA05g19590D [Brassica napus]
Length=509

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 110/192 (57%), Gaps = 15/192 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            M+KQI  K+PRK  KS + DS+G    NS   P  S +  +  N    IA   N  K + 
Sbjct  1    MIKQIFGKLPRKPSKSLNNDSNGEGAVNSYYAPNPSASASRLPNGT--IAPNSN--KNIQ  56

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            +  FP S VA  E++     F+DV   EK  L + KL +CC V+DF DP KN  EK++KR
Sbjct  57   AGPFPPSGVAVYEALP---SFRDVPISEKPNLFLQKLTMCCVVFDFRDPSKNLKEKEIKR  113

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG-----ESEDEELF  610
            Q LLEL D+VAS  VK  E+AI  + +M AVNLFR FP   A+H        + EDEE  
Sbjct  114  QTLLELVDYVASVGVKFNEAAIQELTKMVAVNLFRTFP--SANHETKILEMHDMEDEEPS  171

Query  611  FDPAWYHLQLVY  646
             +PAW H+Q+VY
Sbjct  172  LEPAWPHIQVVY  183



>ref|XP_004976008.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Setaria italica]
Length=513

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 109/199 (55%), Gaps = 20/199 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKR---  259
            M+K IL ++PRK  K+     + A        T++GNGM+ +NS +V  +     KR   
Sbjct  1    MIKNILGRLPRKPGKAGDSRDAAAA-------TSAGNGMEPSNSYSVARSMDPANKRAGN  53

Query  260  ----VSSAIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
                V   + P  ++ G     S  P   FKDV+  EKQ L V K+NLCC+VYDF DP K
Sbjct  54   GDYAVPPGVAPNPVMNGAVVYHSNEPLPAFKDVAASEKQNLFVKKVNLCCAVYDFTDPTK  113

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES--  592
            N  EK++KRQ L+EL D+V S + K +E  +  + +M ++NLFR   P    +   E   
Sbjct  114  NLKEKEVKRQTLMELVDYVTSANGKFSEVVMQEITKMVSINLFRSSNPTPRENKVIEGVD  173

Query  593  -EDEELFFDPAWYHLQLVY  646
             E++E   DPAW HLQ+VY
Sbjct  174  LEEDEPLMDPAWSHLQIVY  192



>ref|XP_006830091.1| hypothetical protein AMTR_s00123p00060730 [Amborella trichopoda]
 gb|ERM97507.1| hypothetical protein AMTR_s00123p00060730 [Amborella trichopoda]
Length=550

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 118/221 (53%), Gaps = 38/221 (17%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPN---------SCNDPTNS--GNGMQFTNSCNVIA  235
            M+KQIL ++PRK  KS   + +G  P          S ++P+N+  GNG  F  S    A
Sbjct  1    MIKQILGRLPRKPSKSSENNEAGGNPATNASPAAMASPSNPSNNLRGNGGNFRASNVTTA  60

Query  236  NR-LNVVKRVSSAIF---------PASIVA--------GGESISPHLCFKDVSNGEKQGL  361
            +R  N    +S+++          P SIV         G  +      F+DV + EKQ L
Sbjct  61   SRGSNAGPTLSNSLAGSRSNHGKKPNSIVPNANNNTTFGSSAYEALPGFRDVPSSEKQNL  120

Query  362  LVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVN  541
             + KLN+C  V+DF DP KNA EKD+KRQ LLEL D+V S S + TE  +  + +M A+N
Sbjct  121  FIRKLNMCYVVFDFSDPAKNAKEKDVKRQTLLELVDYVTSASGRFTEVLMQEITKMVAIN  180

Query  542  LFRDFPPKCASHARG------ESEDEELFFDPAWYHLQLVY  646
            LFR FP   +S+  G      + E+EE   DPAW HLQ+VY
Sbjct  181  LFRTFP---SSNHEGKVPDAYDGEEEEPTMDPAWPHLQIVY  218



>ref|NP_001053130.1| Os04g0485100 [Oryza sativa Japonica Group]
 emb|CAE03154.2| OSJNBa0081L15.16 [Oryza sativa Japonica Group]
 emb|CAD41393.2| OJ000223_09.6 [Oryza sativa Japonica Group]
 dbj|BAF15044.1| Os04g0485100 [Oryza sativa Japonica Group]
 gb|EAY94598.1| hypothetical protein OsI_16375 [Oryza sativa Indica Group]
 gb|EAZ31144.1| hypothetical protein OsJ_15242 [Oryza sativa Japonica Group]
 dbj|BAG95856.1| unnamed protein product [Oryza sativa Japonica Group]
Length=509

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 107/192 (56%), Gaps = 10/192 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL ++PRK  K+       A PN  N+P+NS +  +     N  +   + V  V +
Sbjct  1    MIKQILGRLPRKPGKAGDSRD-AAGPNG-NEPSNSYSVARSVEQGNKRSGNGDYV--VPA  56

Query  269  AIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
             + P  ++ G     S  P   FKDV   EKQ L V K+NLCC+VYDF DP KN  EK+ 
Sbjct  57   GLTPNPMMNGTVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFADPTKNLKEKET  116

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELF  610
            KRQ L+EL D+V S + K +E  ++ + +M ++NLFR   P    +   E    E+EE  
Sbjct  117  KRQTLMELVDYVTSANGKFSEVVMSEITKMVSINLFRSSSPTPRENKAIEGVDLEEEEPL  176

Query  611  FDPAWYHLQLVY  646
             DPAW HLQ+VY
Sbjct  177  MDPAWSHLQIVY  188



>ref|XP_011042316.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042318.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042319.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042320.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011042321.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=547

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 111/215 (52%), Gaps = 28/215 (13%)
 Frame = +2

Query  71   HWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNV  250
            ++ F  M+KQIL ++P+K  KS      G        P+N+ +  + T+     +NRL  
Sbjct  16   YFFFLVMIKQILGRLPKKPSKSSENREFGG---PAIAPSNTSSASKSTSDFQ--SNRLGT  70

Query  251  VKR-------------VSSAIFPASI---VAGGESISPHL----CFKDVSNGEKQGLLVS  370
            +                S  + P  +      G S+ P       F+DV N EKQ L + 
Sbjct  71   LNNSSPPGLDSAPHLGFSHGMKPTQVGNPKLNGSSVPPPYEALPTFRDVPNSEKQNLFIR  130

Query  371  KLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFR  550
            KLNLCC V+DF DP KN  EKD+KRQ LLEL D+V S + K TE+ +  V ++ +VNLFR
Sbjct  131  KLNLCCVVFDFADPTKNLKEKDIKRQTLLELVDYVTSANGKFTETVMQEVIKVVSVNLFR  190

Query  551  DFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
               P+   +   E+   E+EE   DPAW HLQ+VY
Sbjct  191  PRTPQTRENKVLEAFDLEEEEPMMDPAWPHLQIVY  225



>ref|XP_011021363.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021364.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021365.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021366.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
 ref|XP_011021367.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=547

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 111/215 (52%), Gaps = 28/215 (13%)
 Frame = +2

Query  71   HWSFATMLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNV  250
            ++ F  M+KQIL ++P+K  KS      G        P+N+ +  + T+     +NRL  
Sbjct  16   YFFFLVMIKQILGRLPKKPSKSSENREFGG---PAIAPSNTSSASKSTSDFQ--SNRLGT  70

Query  251  VKR-------------VSSAIFPASI---VAGGESISPHL----CFKDVSNGEKQGLLVS  370
            +                S  + P  +      G S+ P       F+DV N EKQ L + 
Sbjct  71   LNNSSPPGLDSAPHLGFSHGMKPTQVGNPKLNGSSVPPPYEALPTFRDVPNSEKQNLFIR  130

Query  371  KLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFR  550
            KLNLCC V+DF DP KN  EKD+KRQ LLEL D+V S + K TE+ +  V ++ +VNLFR
Sbjct  131  KLNLCCVVFDFADPTKNLKEKDIKRQTLLELVDYVTSANGKFTETVMQEVIKVVSVNLFR  190

Query  551  DFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
               P+   +   E+   E+EE   DPAW HLQ+VY
Sbjct  191  PRTPQTRENKVLEAFDLEEEEPMMDPAWPHLQIVY  225



>ref|XP_009145466.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform [Brassica rapa]
Length=509

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 109/192 (57%), Gaps = 15/192 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            M+KQI  K+PRK  KS + DS+G    NS   P  S +  +  N    +A   N  K + 
Sbjct  1    MIKQIFGKLPRKPSKSLNNDSNGEGAVNSYYAPNPSASASRLPNGT--LAPNSN--KNIQ  56

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            +  FP S V   E++     F+DV   EK  L + KL +CC V+DF DP KN  EK++KR
Sbjct  57   AGPFPPSGVVVYEALP---SFRDVPISEKPNLFLQKLTMCCVVFDFRDPSKNLKEKEIKR  113

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG-----ESEDEELF  610
            Q LLEL D+VAS  VK  E+AI  + +M AVNLFR FP   A+H        + EDEE  
Sbjct  114  QTLLELVDYVASVGVKFNEAAIQELTKMVAVNLFRTFP--SANHETKILEMHDMEDEEPS  171

Query  611  FDPAWYHLQLVY  646
             +PAW H+Q+VY
Sbjct  172  LEPAWPHIQVVY  183



>emb|CAC09487.2| H0811E11.3 [Oryza sativa Indica Group]
 emb|CAH67484.1| H0805A05.14 [Oryza sativa Indica Group]
Length=509

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 106/192 (55%), Gaps = 10/192 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL ++PRK  K+       A PN  N+P+NS +  +     N  +   + V  V +
Sbjct  1    MIKQILGRLPRKPGKAGDSRD-AAGPNG-NEPSNSYSVARSVEQGNKRSGNGDYV--VPA  56

Query  269  AIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
             + P  ++ G     S  P   FKDV   EKQ L V K+NLCC VYDF DP KN  EK+ 
Sbjct  57   GLTPNPMMNGTVVYHSNEPLPAFKDVPASEKQNLFVKKVNLCCVVYDFADPTKNLKEKET  116

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELF  610
            KRQ L+EL D+V S + K +E  ++ + +M ++NLFR   P    +   E    E+EE  
Sbjct  117  KRQTLMELVDYVTSANGKFSEVVMSEITKMVSINLFRSSSPTPRENKAIEGVDLEEEEPL  176

Query  611  FDPAWYHLQLVY  646
             DPAW HLQ+VY
Sbjct  177  MDPAWSHLQIVY  188



>ref|XP_008669249.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Zea mays]
 tpg|DAA37270.1| TPA: hypothetical protein ZEAMMB73_719926 [Zea mays]
Length=510

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 104/202 (51%), Gaps = 29/202 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS---GNGMQFTNSCNVIANRLNVVKR  259
            M+KQIL ++PR             +P    D   +   GNG + +NS +V+       KR
Sbjct  1    MIKQILGRLPR-------------KPGKAGDSREAAAAGNGTEPSNSYSVVRGMDPGNKR  47

Query  260  VSSAIFPAS-------IVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
              +  +P         ++ G     S  P   FKDV   EKQ L V K+NLCC+VYDF D
Sbjct  48   AGNGDYPVPSGLTSNPVMNGAVVYHSSEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFAD  107

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGE  589
            P KN  EK++KRQ L+EL D++ S + K +E  +  + +M ++NLFR   P    +   E
Sbjct  108  PTKNLKEKEVKRQTLMELVDYITSANGKFSEVVMLEITKMVSINLFRSSSPTPRENKAIE  167

Query  590  S---EDEELFFDPAWYHLQLVY  646
                E++E   DPAW HLQ+VY
Sbjct  168  GVDLEEDEPLMDPAWSHLQIVY  189



>ref|NP_001183245.1| hypothetical protein [Zea mays]
 gb|ACR36180.1| unknown [Zea mays]
 gb|AFW58631.1| hypothetical protein ZEAMMB73_760675 [Zea mays]
Length=510

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 106/202 (52%), Gaps = 29/202 (14%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS---GNGMQFTNSCNVIANRLNVVKR  259
            M+KQIL ++PR             +P    D   +   GNG + +NS +V  +     KR
Sbjct  1    MIKQILGRLPR-------------KPGKAGDSREAAAAGNGTEPSNSYSVARSMDPGNKR  47

Query  260  -------VSSAIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
                   V S + P  ++ G     S  P   FKDV   EKQ L V K++LCC+VYDF D
Sbjct  48   AGNGDYPVPSGVIPNPVMNGAVVYHSNEPLPAFKDVPMSEKQNLFVKKVSLCCAVYDFVD  107

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGE  589
            P KN  EK++KRQ L+EL D+VAS + K +E  +  + +M ++NLFR   P    +   E
Sbjct  108  PTKNLKEKEVKRQTLMELVDYVASANGKFSEVVMLEITKMVSINLFRSSSPTPRENKAIE  167

Query  590  S---EDEELFFDPAWYHLQLVY  646
                E++E   DPAW HLQ+VY
Sbjct  168  GVDLEEDEPLMDPAWSHLQIVY  189



>gb|EYU29254.1| hypothetical protein MIMGU_mgv1a005961mg [Erythranthe guttata]
Length=463

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 98/187 (52%), Gaps = 40/187 (21%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCND-PTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            M KQ L K+PR              P S  D P N   G    N+ N  A      KR S
Sbjct  1    MWKQFLGKLPR------------KSPKSDQDLPRNPNLG---PNAANPAA------KRAS  39

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            +A+FPAS++AG   I P L FKDV N E+  L +SKL+LC  V+DF DP KN  EK+LKR
Sbjct  40   AAVFPASVIAG---IEPLLAFKDVPNSERMNLFISKLSLCSVVFDFTDPAKNIQEKELKR  96

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESEDEELFFDPAW  625
              LLEL +FV+    K +E AI A C++                   ++EDE + FDPAW
Sbjct  97   ATLLELLEFVSENPPKFSEPAILASCKIIT--------------TENDNEDEPI-FDPAW  141

Query  626  YHLQLVY  646
             HLQLVY
Sbjct  142  PHLQLVY  148



>ref|XP_001782778.1| predicted protein [Physcomitrella patens]
 gb|EDQ52425.1| predicted protein [Physcomitrella patens]
Length=480

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 73/117 (62%), Gaps = 6/117 (5%)
 Frame = +2

Query  308  ISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGS  487
              P   F+DV   E+Q L   KLNLCC  +DF DP K+  EK++KRQ LLEL D+V SG+
Sbjct  31   FEPLPSFRDVPVSERQFLFSRKLNLCCHTFDFTDPTKDVKEKEIKRQTLLELVDYVTSGT  90

Query  488  VKCTESAIAAVCRMCAVNLFRDFPPKCASH----ARGESEDEELFFDPAWYHLQLVY  646
             K TE+    V RM  VNLFR  PP  A H    A GE++DEE   DPAW HLQ+VY
Sbjct  91   GKFTENVFEDVTRMLVVNLFRTLPP--AHHENTGAEGEADDEEPVMDPAWPHLQIVY  145



>ref|XP_002311732.2| hypothetical protein POPTR_0008s18020g, partial [Populus trichocarpa]
 gb|EEE89099.2| hypothetical protein POPTR_0008s18020g, partial [Populus trichocarpa]
Length=407

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EKQ L + KLNLCC V+DF DP KN  EKD+KRQ LLEL D+V S + K TE+
Sbjct  95   FRDVPNSEKQNLFIRKLNLCCVVFDFTDPTKNLKEKDIKRQTLLELVDYVTSANGKFTET  154

Query  506  AIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
             +  V +M +VNLFR   P    +   E+   E+EE   DPAW HLQ+VY
Sbjct  155  VMQEVIKMVSVNLFRPLTPHPRENKLSEAFDLEEEEPMMDPAWPHLQIVY  204



>gb|KDO82045.1| hypothetical protein CISIN_1g010504mg [Citrus sinensis]
 gb|KDO82046.1| hypothetical protein CISIN_1g010504mg [Citrus sinensis]
Length=508

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 82/124 (66%), Gaps = 6/124 (5%)
 Frame = +2

Query  284  SIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLEL  463
            S+VA  E++     F+DV++ EKQ LL+ KLNLCC ++DF DP KN  EKD+KRQ LLEL
Sbjct  83   SVVAPYEALP---GFRDVASFEKQNLLIRKLNLCCVLFDFTDPTKNLKEKDVKRQTLLEL  139

Query  464  NDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHL  634
             DF+ S + K TE+ +  V +M +VNLFR   P+   +   ES   E+EE   DPAW HL
Sbjct  140  VDFITSANGKFTETVMQEVIKMVSVNLFRSLSPQPRENKTLESFDLEEEEPLMDPAWPHL  199

Query  635  QLVY  646
            Q+VY
Sbjct  200  QIVY  203



>gb|KJB40702.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40703.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40704.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
 gb|KJB40705.1| hypothetical protein B456_007G074200 [Gossypium raimondii]
Length=523

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 110/203 (54%), Gaps = 19/203 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGN------------GMQFT--NSCN  226
            M+KQIL ++PRK  KS      G   +S N  T+S N            G  F+  +S N
Sbjct  1    MIKQILNRLPRKPSKSSDNREGGTSTSSSNAYTSSRNSDLASNHYANSSGASFSGFHSTN  60

Query  227  VIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
               N+ N + +V +A    + VA   S  P   F+DV N EKQ L + KLN+CC V+DF 
Sbjct  61   SGLNQGNKISQVVNAKLNGNTVAT--SFEPLPNFRDVPNSEKQNLFIRKLNICCIVFDFT  118

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF---PPKCASH  577
            DP KN  EKD+KRQ LLE+ D+V+S + K +E  +  + +M ++NLFR     P +    
Sbjct  119  DPTKNVKEKDIKRQTLLEIMDYVSSANGKFSEIVMQEIVKMVSINLFRALTSAPRENKVL  178

Query  578  ARGESEDEELFFDPAWYHLQLVY  646
               + E+EE   D AW HLQ+VY
Sbjct  179  LAFDLEEEEPSMDSAWPHLQVVY  201



>ref|XP_008797311.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Phoenix dactylifera]
Length=522

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 109/203 (54%), Gaps = 20/203 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksd--sldssGAQPNSCNDPTNSGNGMQFTNSCNVIANR-------  241
            M+KQIL ++PRK  KS      S G+ P+  N  T+S +G    +S   + ++       
Sbjct  1    MIKQILGRLPRKPSKSADNRDSSGGSTPSLPNASTSSRSGDLLNSSVTDLNSQVLPGLNP  60

Query  242  -LNVVKRVSSAIFPASIVAGGESISPHL----CFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             LN   R   A+   S+   G  +SP       F+DV + EKQ L + KLNLCC V+DF 
Sbjct  61   GLNHGSRYPPAV---SLRLNGNLVSPPYEALPSFRDVPSSEKQNLFIKKLNLCCVVFDFT  117

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG  586
            DP KN  EKD+KRQ LLEL D+V S + K  E+ I    RM ++NLFR        +   
Sbjct  118  DPTKNLREKDIKRQTLLELVDYVTSANGKFPENVIQETIRMVSINLFRALTSPSRENKVL  177

Query  587  ES---EDEELFFDPAWYHLQLVY  646
            E+   E+EE   DPAW HLQ+VY
Sbjct  178  EAFDLEEEEPVMDPAWQHLQIVY  200



>emb|CDY44320.1| BnaC05g30730D [Brassica napus]
Length=508

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 110/192 (57%), Gaps = 16/192 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVS  265
            M+KQI  K+PRK  KS + DS+G    NS   P  S +G +  N    +A   N  K + 
Sbjct  1    MIKQIFGKLPRKPSKSLNNDSNGEGAVNSYYAPNPSASGSRLPNGT--LAPNSN--KNIQ  56

Query  266  SAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKR  445
            +  FP S V   E++     F+DV   EK  L + KL +CC V+DF DP KN  EK++KR
Sbjct  57   AGPFPPSGVVY-EALP---SFRDVPISEKPNLFLQKLTMCCVVFDFRDPSKNLKEKEIKR  112

Query  446  QVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG-----ESEDEELF  610
            Q LLEL D+VAS  VK  E+AI  + +M AVNLFR FP   A+H        + EDEE  
Sbjct  113  QTLLELVDYVASVGVKFNEAAIQELTKMVAVNLFRTFP--SANHETKILEMHDLEDEEPS  170

Query  611  FDPAWYHLQLVY  646
             +PAW H+Q+VY
Sbjct  171  LEPAWPHIQVVY  182



>ref|XP_011029624.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Populus euphratica]
Length=526

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 77/123 (63%), Gaps = 6/123 (5%)
 Frame = +2

Query  296  GGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELN  466
            GG   +P+     F+DV N EKQ L + KLNLCC V+DF DP KN  EKD+KRQ LLEL 
Sbjct  82   GGSVSAPYEALPGFRDVPNSEKQNLFIRKLNLCCLVFDFTDPTKNLKEKDIKRQTLLELV  141

Query  467  DFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQ  637
            D+V S + K TE+ +  V +M +VNLFR   P    +   E+   E+EE   DPAW HLQ
Sbjct  142  DYVTSANGKFTETVMQEVIKMVSVNLFRPLTPHPRENKLSEAFDLEEEEPMMDPAWPHLQ  201

Query  638  LVY  646
            +VY
Sbjct  202  IVY  204



>ref|XP_002314559.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEF00730.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=526

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 110/209 (53%), Gaps = 28/209 (13%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL ++P+K  KS      G  P+    P+N+ +  + T+     +NRL  +   S 
Sbjct  1    MIKQILGRLPKKPSKSSENREFGG-PSIA--PSNTSSASKSTSDFQ--SNRLGTLNNSSP  55

Query  269  AIFPASIVAG----------------GESISPHL----CFKDVSNGEKQGLLVSKLNLCC  388
                ++   G                G S+ P       F+DV N EKQ L + KLNLCC
Sbjct  56   PGLDSAPHLGFSHGMKPTQAGNPKLNGSSVPPPYEALPTFRDVPNSEKQNLFIRKLNLCC  115

Query  389  SVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC  568
             V+DF DP KN  EKD+KRQ LLEL D++ S + K TE+ +  V ++ +VNLFR   P+ 
Sbjct  116  VVFDFADPTKNLKEKDIKRQTLLELVDYITSANGKFTETVMQEVIKVVSVNLFRPRTPQT  175

Query  569  ASHARGES---EDEELFFDPAWYHLQLVY  646
              +   E+   E+EE   DPAW HLQ+VY
Sbjct  176  RENKVLEAFDLEEEEPMMDPAWPHLQIVY  204



>ref|XP_007222857.1| hypothetical protein PRUPE_ppa004253mg [Prunus persica]
 gb|EMJ24056.1| hypothetical protein PRUPE_ppa004253mg [Prunus persica]
Length=520

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 113/202 (56%), Gaps = 19/202 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSC----------NDPTNSGNG--MQFTNSCNV-  229
            M+KQIL K+PRK  KS      G    S           N P NS +   +   ++ N+ 
Sbjct  1    MIKQILGKLPRKPSKSAENREFGGSSASSLSSRSSDVVSNRPINSNSVPLLGLDSASNLG  60

Query  230  IANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
             ++  N+ + V+S +  +S  A  +++     F+DV + EKQ L + KLNLCC ++DF D
Sbjct  61   YSHGSNLPQLVNSNLNGSSATASYQALP---AFRDVPSSEKQNLFMKKLNLCCVLFDFTD  117

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGE  589
            P K+  EKD+KRQ LLEL D+V S + K TE+ +  V ++  VNLFR F P+   +   E
Sbjct  118  PTKHLREKDIKRQTLLELVDYVTSANGKFTETVVQEVIKVVTVNLFRSFSPQPRENKVLE  177

Query  590  S---EDEELFFDPAWYHLQLVY  646
            +   E+EE   DPAW HLQ+VY
Sbjct  178  AFDLEEEEPLMDPAWSHLQIVY  199



>ref|XP_006438131.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
 ref|XP_006438132.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
 gb|ESR51371.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
 gb|ESR51372.1| hypothetical protein CICLE_v10031285mg [Citrus clementina]
Length=508

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 82/124 (66%), Gaps = 6/124 (5%)
 Frame = +2

Query  284  SIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLEL  463
            S+VA  E++     F+DV++ EKQ LL+ KLNLCC ++DF DP KN  EKD+KRQ LLEL
Sbjct  83   SVVAPYEALP---GFRDVASFEKQNLLIRKLNLCCVLFDFTDPTKNLKEKDVKRQTLLEL  139

Query  464  NDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHL  634
             DF+ S + K TE+ +  V +M +VNLFR   P+   +   E+   E+EE   DPAW HL
Sbjct  140  VDFITSANGKFTETVMQEVIKMVSVNLFRSLSPQPRENKTLEAFDLEEEEPLMDPAWPHL  199

Query  635  QLVY  646
            Q+VY
Sbjct  200  QIVY  203



>ref|XP_002301608.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
 gb|EEE80881.1| serine/threonine protein phosphatase 2A regulatory subunit B' 
[Populus trichocarpa]
Length=514

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 108/204 (53%), Gaps = 40/204 (20%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL K+PRK           ++P+S ND  N G    +++     A+RLN     + 
Sbjct  1    MIKQILGKLPRK----------PSKPSS-NDSNNDGGLHAYSSG----ASRLN-----NG  40

Query  269  AIFPASIVAGGESISPHL-------------CFKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
            ++ P S    G+  +P L              F+DV N EK  L + KLN+CC V+DF D
Sbjct  41   SLVPNSKGNQGKKSAPQLDPLMTSGVYEALPSFRDVPNSEKHNLFMKKLNMCCVVFDFSD  100

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG-  586
            P KN  EKD+KRQ L EL D++++ + K  E A+  + RM A NLFR  P    +H +  
Sbjct  101  PSKNLKEKDIKRQTLHELLDYISTVTSKFNEIAMQEITRMVAANLFRTLP--SMNHDKKI  158

Query  587  ----ESEDEELFFDPAWYHLQLVY  646
                + EDEE   +PAW HLQ+VY
Sbjct  159  LEMFDPEDEEPAMEPAWPHLQIVY  182



>gb|KJB11609.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
 gb|KJB11610.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
Length=516

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 106/198 (54%), Gaps = 14/198 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQ--------FTNSCNVIANR  241
            M+KQI  ++PRK  KS      G    +S N  T+S N            +++ N+  N+
Sbjct  2    MIKQIFNRLPRKQSKSSDNREGGGTSASSSNAYTSSRNNANSGGPASSGVSSTPNLGLNQ  61

Query  242  LNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKN  421
             N V +V +      + A      P   FKD+ N EKQ L + KLNLCC V+DF DP KN
Sbjct  62   GNKVSQVVNTKLNGDVFASSFVTLP--SFKDIPNSEKQNLFIRKLNLCCVVFDFSDPTKN  119

Query  422  AAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCASHARG-ES  592
              EKD+KRQ LLEL D+V+S + K +E  +    +M ++NLFR    PP+        + 
Sbjct  120  LKEKDIKRQTLLELVDYVSSANGKFSEIVMQEFVKMVSLNLFRPLTSPPRENKVLEAFDV  179

Query  593  EDEELFFDPAWYHLQLVY  646
            EDEE   DPAW HLQ+VY
Sbjct  180  EDEEPSVDPAWSHLQVVY  197



>gb|KHG13833.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=523

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 110/203 (54%), Gaps = 19/203 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGN------------GMQFT--NSCN  226
            M+KQIL ++PRK  KS      G   +S N  T+S N            G  F+  +S N
Sbjct  1    MIKQILNRLPRKPSKSSDNREGGTSTSSSNAYTSSRNSDLASNHYANSSGASFSGFHSTN  60

Query  227  VIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
               N+ N + +V +A    + VA      P+  F+DV N EKQ L + KLN+CC V+DF 
Sbjct  61   SGLNQGNKISQVVNAKLNGNTVATSFEALPN--FRDVPNSEKQNLFIRKLNICCIVFDFT  118

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF---PPKCASH  577
            DP KN  EKD+KRQ LLE+ D+V+S + K +E  +  + +M +VNLFR     P +    
Sbjct  119  DPTKNVKEKDIKRQTLLEIVDYVSSANGKFSEIIMQEIVKMVSVNLFRALTSAPRENKVL  178

Query  578  ARGESEDEELFFDPAWYHLQLVY  646
               + E+EE   D AW HLQ+VY
Sbjct  179  LAFDLEEEEPSMDSAWPHLQVVY  201



>gb|KJB11611.1| hypothetical protein B456_001G268200 [Gossypium raimondii]
Length=419

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 106/198 (54%), Gaps = 14/198 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQ--------FTNSCNVIANR  241
            M+KQI  ++PRK  KS      G    +S N  T+S N            +++ N+  N+
Sbjct  2    MIKQIFNRLPRKQSKSSDNREGGGTSASSSNAYTSSRNNANSGGPASSGVSSTPNLGLNQ  61

Query  242  LNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKN  421
             N V +V +      + A      P   FKD+ N EKQ L + KLNLCC V+DF DP KN
Sbjct  62   GNKVSQVVNTKLNGDVFASSFVTLP--SFKDIPNSEKQNLFIRKLNLCCVVFDFSDPTKN  119

Query  422  AAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCASHARG-ES  592
              EKD+KRQ LLEL D+V+S + K +E  +    +M ++NLFR    PP+        + 
Sbjct  120  LKEKDIKRQTLLELVDYVSSANGKFSEIVMQEFVKMVSLNLFRPLTSPPRENKVLEAFDV  179

Query  593  EDEELFFDPAWYHLQLVY  646
            EDEE   DPAW HLQ+VY
Sbjct  180  EDEEPSVDPAWSHLQVVY  197



>ref|XP_007222861.1| hypothetical protein PRUPE_ppa004258mg [Prunus persica]
 gb|EMJ24060.1| hypothetical protein PRUPE_ppa004258mg [Prunus persica]
Length=520

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 108/201 (54%), Gaps = 16/201 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS-GNGMQFTNSCNVIA-----NRLNV  250
            M KQIL+K+PRKS K+      G+     N PT+S  +    + S N++      N ++ 
Sbjct  1    MFKQILSKLPRKSSKNSESRD-GSHTMYSNPPTSSRSSDFGISKSGNLVTSFPAGNPVSD  59

Query  251  V------KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDP  412
            V      K V  A    +      S      F+DV N EKQ L + KLNLCC V+DF DP
Sbjct  60   VGKSYGNKNVRGANLKPNGFVLSSSYEALPGFRDVPNSEKQSLFIKKLNLCCVVFDFTDP  119

Query  413  DKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES  592
             K+  EK++KRQ LLEL D+V S + K TE+ +  + +M + NLFR F P+   +   E 
Sbjct  120  TKHLKEKEIKRQTLLELVDYVTSANGKFTETVMQEIAKMVSTNLFRSFTPQPRENKLVEG  179

Query  593  ---EDEELFFDPAWYHLQLVY  646
               E++E   DPAW HLQLVY
Sbjct  180  FDLEEDEPSMDPAWPHLQLVY  200



>ref|XP_006652431.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Oryza brachyantha]
Length=507

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 106/192 (55%), Gaps = 10/192 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVV---KR  259
            M+KQIL ++PRK  K+       A PN  N+P+NS +  +     N  +     V     
Sbjct  1    MIKQILGRLPRKPGKNGDSRDV-AGPNG-NEPSNSYSVARSVEQGNKRSGNGEYVVPAGP  58

Query  260  VSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
             S+ +   S+V    S  P   FKDV   EKQ L V K+NLCC+VYDF DP KN  EK+ 
Sbjct  59   ASNLMMNGSVVY--HSNEPLPAFKDVPASEKQNLFVKKVNLCCAVYDFTDPTKNLKEKET  116

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELF  610
            KRQ L+EL D+V S + K +E+ ++ + +M ++NLFR   P    +   E    E+EE  
Sbjct  117  KRQTLMELVDYVTSANGKFSEAVMSEITKMVSINLFRSSSPTPRENKAIEGVDLEEEEPL  176

Query  611  FDPAWYHLQLVY  646
             DPAW HLQ+VY
Sbjct  177  MDPAWSHLQIVY  188



>gb|KHN03104.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform, partial [Glycine soja]
Length=404

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 0/91 (0%)
 Frame = +2

Query  374  LNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRD  553
            L+LCC  +DF DP K+ A+KD+KR+ L+EL DFVA G+++ +E AI A+CRMCA+NLFR 
Sbjct  1    LSLCCVTFDFTDPGKSIADKDVKRKTLVELVDFVACGTMRFSEPAILAMCRMCAINLFRV  60

Query  554  FPPKCASHARGESEDEELFFDPAWYHLQLVY  646
            FPP   +   GE++D+E  FDPAW HLQLVY
Sbjct  61   FPPNYRASGGGENDDDEPMFDPAWPHLQLVY  91



>ref|XP_011097329.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Sesamum indicum]
Length=524

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/204 (38%), Positives = 107/204 (52%), Gaps = 20/204 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGN----GMQFTNSCNVIANRLNVVK  256
            M+K IL K+PRK  K       G+     N  T S +    G +  NS   I   +N   
Sbjct  1    MIKNILNKLPRKQTKLVDHRDGGSSTYPSNASTTSRSSYAVGSRSGNSNTTIGPGINSTS  60

Query  257  --------RVSSAIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDF  403
                    ++  A+   + V G     P+     F+DV N EKQ L + KL+LCC+V+DF
Sbjct  61   NSGPSYGNKLHDAL--NTKVNGNAGPVPYEALPSFRDVPNAEKQNLFIKKLSLCCAVFDF  118

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR  583
             DP KN  EKD+KRQ L+EL D+VAS + K TE+ +  + RM ++NLFR    +   +  
Sbjct  119  TDPAKNLKEKDIKRQTLVELVDYVASTNAKFTETVMQEIVRMISINLFRTLSTQPRDNKV  178

Query  584  GES---EDEELFFDPAWYHLQLVY  646
             E+   E+EE   DPAW HLQ+VY
Sbjct  179  LEAFDLEEEEPLMDPAWPHLQVVY  202



>ref|XP_008222035.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=520

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/202 (39%), Positives = 112/202 (55%), Gaps = 19/202 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSC----------NDPTNSGNG--MQFTNSCNV-  229
            M+KQIL K+PRK  KS      G    S           N P NS +   +   ++ N+ 
Sbjct  1    MIKQILGKLPRKPSKSAENREFGGSSASSLSSRSSDVVSNRPINSNSLPLLGLDSASNLG  60

Query  230  IANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
             ++   + + V+S +  +S  A  +++     F+DV + EKQ L + KLNLCC V+DF D
Sbjct  61   YSHGSKLPQLVNSNLNGSSATASYQALP---AFRDVPSSEKQNLFMKKLNLCCVVFDFTD  117

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGE  589
            P K+  EKD+KRQ LLEL D+V S + K TE+ +  V ++  VNLFR F P+   +   E
Sbjct  118  PTKHLREKDIKRQTLLELVDYVTSANGKFTETVVQEVIKVVTVNLFRSFSPQPRENKVLE  177

Query  590  S---EDEELFFDPAWYHLQLVY  646
            +   E+EE   DPAW HLQ+VY
Sbjct  178  AFDLEEEEPLMDPAWSHLQIVY  199



>ref|XP_001766093.1| predicted protein [Physcomitrella patens]
 gb|EDQ69152.1| predicted protein [Physcomitrella patens]
Length=467

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 74/115 (64%), Gaps = 2/115 (2%)
 Frame = +2

Query  308  ISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGS  487
            + P + FKDV   E+Q L   KL LCC ++DF DP K+  EK++KRQ LLEL D+V SG+
Sbjct  31   LEPLMSFKDVPVSERQFLFSRKLKLCCYMFDFTDPMKDVKEKEIKRQTLLELVDYVTSGT  90

Query  488  VKCTESAIAAVCRMCAVNLFRDFPPKCASH--ARGESEDEELFFDPAWYHLQLVY  646
             K TE+    + RM  +N+FR  PP    H  A G+++DEE   +PAW HLQ+VY
Sbjct  91   GKFTENVFEDITRMLVINIFRPLPPAHHEHTGAEGDADDEEPVMNPAWPHLQIVY  145



>gb|KHN10406.1| Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit 
B' iota isoform [Glycine soja]
Length=390

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 64/83 (77%), Gaps = 1/83 (1%)
 Frame = +2

Query  401  FGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKC-ASH  577
              DPDKN  E+DLKR+ LLEL D+V+SGSVK TE AIAA+C+MCA NLFR FPPK   S 
Sbjct  1    MSDPDKNTTEQDLKRKTLLELVDYVSSGSVKFTEPAIAALCKMCATNLFRAFPPKFRTST  60

Query  578  ARGESEDEELFFDPAWYHLQLVY  646
              GE+EDEE  FDPAW HLQ+VY
Sbjct  61   TGGETEDEEPIFDPAWSHLQVVY  83



>gb|KHF99622.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
zeta-like protein [Gossypium arboreum]
Length=548

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 111/217 (51%), Gaps = 37/217 (17%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQ------------PNSCNDPTNSGNGMQFTNSCNVI  232
            M+KQI  K+PRK  KS   + +G              PNS N  +  G+  +F+NS    
Sbjct  1    MMKQIFGKLPRKPSKSSQHEPNGDALNGNSFFNSSLGPNSLNS-SKPGSAFKFSNS----  55

Query  233  ANRLNVVKRVSSAIFPASIVAGGESISPHLC----------------FKDVSNGEKQGLL  364
             +RLN    V+S    ++    G+   P                   F+DV + EKQ L 
Sbjct  56   GSRLNG-GTVNSHSSSSANSNQGKKTDPLASQAGLMLVSGIYEALPGFRDVPSTEKQSLF  114

Query  365  VSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNL  544
            + KLN+CC V+DFGDP KN  EKD+K+Q LLEL D+++S + K  E A+  + RM A NL
Sbjct  115  LKKLNMCCVVFDFGDPTKNLREKDIKKQTLLELVDYISSVTSKFNELAVQEMTRMVAANL  174

Query  545  FRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
            FR FP     +   E    EDEE   DPAW HLQ+VY
Sbjct  175  FRTFPSPNHDNKLLEMYDLEDEEPAMDPAWPHLQIVY  211



>ref|XP_010025360.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 ref|XP_010025361.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 gb|KCW62002.1| hypothetical protein EUGRSUZ_H04680 [Eucalyptus grandis]
Length=525

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 105/205 (51%), Gaps = 21/205 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPN-SCNDPTNSGNGMQFTNSCNVI-----------  232
            M KQ L+K+PRKS KS     +G   N   N   NS +G   +     +           
Sbjct  1    MFKQFLSKLPRKSSKSADSRDNGGGSNPYANASINSRSGELGSAKSGALNPTSSSAPNHV  60

Query  233  ----ANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYD  400
                +N  N   R S+      +V+      P   FKDVS+ EKQ LL+ KLNL C ++D
Sbjct  61   SDKGSNHGNKTSRNSNVQLNGYMVSSAYEALP--GFKDVSSSEKQHLLIRKLNLSCVIFD  118

Query  401  FGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHA  580
            F DP KN  EK++KRQ LLEL D+V S + K  E+ +    +M ++NLFR   P+   + 
Sbjct  119  FTDPTKNLREKEIKRQTLLELVDYVTSVNAKFAETVMQEATKMVSINLFRALTPQPRENK  178

Query  581  RGES---EDEELFFDPAWYHLQLVY  646
              E+   E+EE   DPAW HLQLVY
Sbjct  179  ATEAFDLEEEEPLMDPAWPHLQLVY  203



>ref|XP_002266932.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Vitis vinifera]
Length=515

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 106/207 (51%), Gaps = 25/207 (12%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQI +K+PRK  K+      G      N+ +N   G       N  AN LNV    +S
Sbjct  1    MIKQIFSKLPRKLSKAVENRELGGTTAFSNN-SNRSRGSDV--ESNQFAN-LNVTSLAAS  56

Query  269  AIFP-------ASIVAGGES------ISPHL-----CFKDVSNGEKQGLLVSKLNLCCSV  394
               P       + I  GG S      ++P+       F+DV + EKQ L + KLNLCC V
Sbjct  57   NSTPITGNNLGSKIPQGGNSKVNGNYMTPNTYEALPAFRDVPSSEKQNLFIGKLNLCCVV  116

Query  395  YDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS  574
            +DF DP KN  EK++KRQ LLEL D+V S S K TE+ +    +M + NLFR F  +   
Sbjct  117  FDFTDPTKNIKEKEIKRQTLLELVDYVTSASGKFTETVMLECVKMVSANLFRAFTTQSCE  176

Query  575  HARGES---EDEELFFDPAWYHLQLVY  646
                E    E+EE   DPAW HLQ+VY
Sbjct  177  TKASEGFDLEEEEPSIDPAWPHLQIVY  203



>ref|XP_006852143.1| hypothetical protein AMTR_s00049p00063500 [Amborella trichopoda]
 gb|ERN13610.1| hypothetical protein AMTR_s00049p00063500 [Amborella trichopoda]
Length=528

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 106/201 (53%), Gaps = 18/201 (9%)
 Frame = +2

Query  89   MLKQILAKIPR--kslksdsldssGAQPNS--CND--PTNSGNGMQFTNSCNVIANRL--  244
            M+KQIL K+PR              + PN+   N+  P+   N    T S N   + L  
Sbjct  1    MIKQILGKLPRRPSKSSDSREGVGNSIPNARVANNYHPSRGENSAPATRSGNDSESYLVP  60

Query  245  --NVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
              N VK++   I  A+  +   +      FKDV + EKQ L + KLN+CC  +DF DP K
Sbjct  61   GSNQVKKLG-LIDRANGNSASSAYEALPSFKDVPSAEKQNLFIRKLNMCCVAFDFTDPSK  119

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG----  586
            N  EKD+KRQ LLEL D++ S + K TE+ +  + +M AVNLFR  P   +SH       
Sbjct  120  NQKEKDVKRQTLLELVDYITSANGKFTETIMQEITKMVAVNLFRTLP--SSSHETKVIEN  177

Query  587  -ESEDEELFFDPAWYHLQLVY  646
             + E+EE   DPAW HLQ+VY
Sbjct  178  FDQEEEEPVMDPAWPHLQIVY  198



>ref|XP_008340161.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Malus domestica]
Length=521

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 110/202 (54%), Gaps = 19/202 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS----------GNGMQFTNSCNVIAN  238
            ML+QIL K+PRKS K+      GAQ    N PT+S          GN      S N +A+
Sbjct  1    MLRQILNKLPRKSSKNAENRD-GAQTLYSNPPTSSRSSDLGTSKSGNLTTSFPSGNAVAD  59

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGD  409
             +      S+    A++   G +IS +     F+DV N EKQ L + KL+LCC V+DF D
Sbjct  60   XVKSYSNKSAR--GANMKPNGFAISSYEALPGFRDVPNAEKQSLFIKKLSLCCVVFDFTD  117

Query  410  PDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGE  589
            P K+  EK++KRQ LLEL D+V   + K +E+ +  +  M + N+FR F P+   +   E
Sbjct  118  PTKHLKEKEIKRQTLLELVDYVTKPNSKFSEALMQELINMVSANMFRAFTPQPRENKVAE  177

Query  590  S---EDEELFFDPAWYHLQLVY  646
                E+EE   DPAW HLQ+VY
Sbjct  178  GFDLEEEEPSMDPAWPHLQVVY  199



>ref|XP_002970708.1| hypothetical protein SELMODRAFT_171686 [Selaginella moellendorffii]
 gb|EFJ28034.1| hypothetical protein SELMODRAFT_171686 [Selaginella moellendorffii]
Length=474

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 3/117 (3%)
 Frame = +2

Query  305  SISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASG  484
            +  P   F+DV + EKQ L V KL+LCC V+DF DP K+  EK++KRQ LLEL D+V SG
Sbjct  31   NFEPLPLFRDVPSSEKQSLFVKKLHLCCCVFDFTDPSKHTREKEIKRQTLLELVDYVTSG  90

Query  485  SVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGES--EDEELFFDPAWYHLQLVY  646
            S K TE+ +  + +M + NLFR  PP    + A  ES  EDEE   DPAW HLQ+VY
Sbjct  91   SGKFTENVLEDMTKMVSANLFRSLPPSSRENSAVSESFDEDEEPVMDPAWPHLQIVY  147



>ref|XP_002969377.1| hypothetical protein SELMODRAFT_267276 [Selaginella moellendorffii]
 gb|EFJ29465.1| hypothetical protein SELMODRAFT_267276 [Selaginella moellendorffii]
Length=467

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 76/117 (65%), Gaps = 3/117 (3%)
 Frame = +2

Query  305  SISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASG  484
            +  P   F+DV + EKQ L V KL+LCC V+DF DP K+  EK++KRQ LLEL D+V SG
Sbjct  31   NFEPLPLFRDVPSSEKQSLFVKKLHLCCCVFDFTDPSKHTREKEIKRQTLLELVDYVTSG  90

Query  485  SVKCTESAIAAVCRMCAVNLFRDFPPKCASH-ARGES--EDEELFFDPAWYHLQLVY  646
            S K TE+ +  + +M + NLFR  PP    + A  ES  EDEE   DPAW HLQ+VY
Sbjct  91   SGKFTENVLEDMTKMVSANLFRSLPPSSRENSAVSESFDEDEEPVMDPAWPHLQIVY  147



>ref|NP_172803.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 ref|NP_973816.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 sp|Q8LF36.2|2A5T_ARATH RecName: Full=Serine/threonine protein phosphatase 2A 57 kDa 
regulatory subunit B' theta isoform; Short=AtB' theta; Short=PP2A, 
B' subunit, theta isoform [Arabidopsis thaliana]
 gb|AAG09562.1|AC011810_21 Putative protein phosphatase 2A regulatory subunit B [Arabidopsis 
thaliana]
 gb|ABH04491.1| At1g13460 [Arabidopsis thaliana]
 gb|AEE29021.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
 gb|AEE29022.1| protein phosphatase 2A B'theta [Arabidopsis thaliana]
Length=492

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = +2

Query  281  ASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQV  451
             ++   G   +P+     FKDV N EKQ L V KL+LCC V+DF DP KN  EKD+KRQ 
Sbjct  58   GNLKGNGNGFTPYEALPGFKDVPNAEKQNLFVRKLSLCCVVFDFSDPTKNVKEKDIKRQT  117

Query  452  LLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPA  622
            LLEL D+VAS + K +E+ I  V RM +VN+FR   P+   +   ++   E+EE   DP 
Sbjct  118  LLELVDYVASPNGKFSETVIQEVVRMVSVNIFRTLNPQPRENKVIDALDLEEEEPSMDPT  177

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  178  WPHLQLVY  185



>gb|AAM61625.1| B regulatory subunit of protein phosphatase 2A, putative [Arabidopsis 
thaliana]
Length=492

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = +2

Query  281  ASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQV  451
             ++   G   +P+     FKDV N EKQ L V KL+LCC V+DF DP KN  EKD+KRQ 
Sbjct  58   GNLKGNGNGFTPYEALPGFKDVPNAEKQNLFVRKLSLCCVVFDFSDPTKNVKEKDIKRQT  117

Query  452  LLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPA  622
            LLEL D+VAS + K +E+ I  V RM +VN+FR   P+   +   ++   E+EE   DP 
Sbjct  118  LLELVDYVASPNGKFSETVIQEVVRMVSVNIFRTLNPQPRENKVIDALDLEEEEPSMDPT  177

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  178  WPHLQLVY  185



>ref|XP_010044751.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 ref|XP_010044752.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Eucalyptus grandis]
 gb|KCW86862.1| hypothetical protein EUGRSUZ_B03453 [Eucalyptus grandis]
Length=524

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 113/211 (54%), Gaps = 35/211 (17%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL ++PRK  KS++ D  G+  +S      SG G   + + ++ ++RL+      +
Sbjct  1    MIKQILGRLPRKPSKSENRDHGGSVVSSMK----SGGG---SRTADLASHRLD---NSGN  50

Query  269  AIFP----ASIVAGGESISPHLC------------------FKDVSNGEKQGLLVSKLNL  382
            A  P    AS +  G    P                     F+DV N EKQ L + KLN+
Sbjct  51   ASLPGPASASNLGNGHGRKPAQAVNSKYDNVTPASYEALPGFRDVGNSEKQNLFIRKLNM  110

Query  383  CCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP  562
            CC ++DF DP KN  EK++KRQ LLEL D+V S + K +E+ +  + +M +VNLFR F P
Sbjct  111  CCVLFDFTDPTKNLKEKEIKRQTLLELVDYVTSANGKFSETVMQEITKMVSVNLFRPFTP  170

Query  563  KCASHARGES---EDEELFFDPAWYHLQLVY  646
            +   +   ES   E+EE   DP W HLQ+VY
Sbjct  171  QPRENKVFESFDLEEEEPLMDPTWPHLQIVY  201



>ref|XP_010089442.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' zeta isoform [Morus notabilis]
 gb|EXB37815.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' zeta isoform [Morus notabilis]
Length=545

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 83/216 (38%), Positives = 118/216 (55%), Gaps = 33/216 (15%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG--------AQPNSCNDPTNSGNGMQ------------  208
            M+KQIL KIPRK  KS   DS G        +  NS N P NS NG++            
Sbjct  1    MIKQILGKIPRKPSKSTQDDSYGDGGVDNGYSSVNSYNGP-NSSNGLKPSSTQSKSSISG  59

Query  209  --FTNSCN-VIA--NRLNVVKRVSSAIFPAS--IVAGGESISPHLCFKDVSNGEKQGLLV  367
               + S N  IA  N+ N  K+ ++++      + +GG    P   F+DV + EKQ L +
Sbjct  60   LGISRSSNGTIAGGNKSNQAKKSAASVTQVDPLLASGGYEALP--SFRDVPSSEKQNLFI  117

Query  368  SKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLF  547
             KLN+CC V++F DP  +  +KD+KRQ LLEL D+++S + K  E+ +  + +M AVNLF
Sbjct  118  KKLNMCCVVFNFSDPVSDLKKKDIKRQTLLELVDYISSVNSKFNEAVMQEITQMVAVNLF  177

Query  548  RDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
            R FP     +   ES   E+EE   +PAW H+Q+VY
Sbjct  178  RIFPSASHENKVLESYDLEEEEPTMEPAWPHIQVVY  213



>ref|XP_004231808.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315939.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315940.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315941.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315942.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
 ref|XP_010315943.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Solanum lycopersicum]
Length=523

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 110/204 (54%), Gaps = 21/204 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS-GNGMQFTNSCNVIANRLNVVKRVS  265
            M+KQIL ++PRK  KS      G+  +  N  T S  + +    S N  A  ++ V   S
Sbjct  1    MIKQILNRLPRKPSKSAENRDGGSSASPSNASTGSRSSDLSTAQSGNSSATTVSGV--TS  58

Query  266  SAIFP---------ASIVAGGESISPHLC-----FKDVSNGEKQGLLVSKLNLCCSVYDF  403
            S + P         A+    G S +  LC     FKDV   EKQ L + KLNLCC ++DF
Sbjct  59   STLGPNHGNRLPQGANAKVNG-SAAVFLCETLPSFKDVPTAEKQNLFIKKLNLCCVLFDF  117

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR  583
             DP K+  EKD+KRQ L+EL D+++S + K TE+ I  + +M + NLFR   P+   +  
Sbjct  118  TDPTKHLKEKDIKRQTLIELVDYLSSANGKFTETVIQEIVKMVSSNLFRSLTPQPRENKV  177

Query  584  GES---EDEELFFDPAWYHLQLVY  646
             E+   ED+E   DPAW HLQ+VY
Sbjct  178  LEAFDLEDDEPLMDPAWPHLQIVY  201



>gb|KCW62001.1| hypothetical protein EUGRSUZ_H04680 [Eucalyptus grandis]
Length=545

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 105/205 (51%), Gaps = 21/205 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPN-SCNDPTNSGNGMQFTNSCNVI-----------  232
            M KQ L+K+PRKS KS     +G   N   N   NS +G   +     +           
Sbjct  1    MFKQFLSKLPRKSSKSADSRDNGGGSNPYANASINSRSGELGSAKSGALNPTSSSAPNHV  60

Query  233  ----ANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYD  400
                +N  N   R S+      +V+      P   FKDVS+ EKQ LL+ KLNL C ++D
Sbjct  61   SDKGSNHGNKTSRNSNVQLNGYMVSSAYEALP--GFKDVSSSEKQHLLIRKLNLSCVIFD  118

Query  401  FGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHA  580
            F DP KN  EK++KRQ LLEL D+V S + K  E+ +    +M ++NLFR   P+   + 
Sbjct  119  FTDPTKNLREKEIKRQTLLELVDYVTSVNAKFAETVMQEATKMVSINLFRALTPQPRENK  178

Query  581  RGES---EDEELFFDPAWYHLQLVY  646
              E+   E+EE   DPAW HLQLVY
Sbjct  179  ATEAFDLEEEEPLMDPAWPHLQLVY  203



>ref|XP_009370310.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=514

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 103/192 (54%), Gaps = 6/192 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL ++PRK   S+  +   +  NS    ++ GN +      +      +     + 
Sbjct  1    MIKQILNRLPRKPKSSEHREGGSSNTNSNASASSRGNSISSNKYASSSTTFSSATSTPNF  60

Query  269  AIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
             +   S + G    SP+     FKDV N EKQ LL+ KLNLCC V+DF DP KN  EK++
Sbjct  61   GVNVNSKLNGNSLASPYEALPSFKDVPNAEKQNLLIKKLNLCCVVFDFSDPTKNIKEKEI  120

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF---PPKCASHARGESEDEELF  610
            KRQ L+EL D++AS + K  E  +  + +M  +NLFR     P +  +    + E+EE  
Sbjct  121  KRQTLVELVDYIASANGKFPEIVVQEIVKMVCINLFRTLSSPPLENKALEAFDVEEEEPS  180

Query  611  FDPAWYHLQLVY  646
             DPAW HLQ+VY
Sbjct  181  MDPAWPHLQVVY  192



>ref|XP_009371715.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
 ref|XP_009371716.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=514

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 71/192 (37%), Positives = 103/192 (54%), Gaps = 6/192 (3%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL ++PRK   S+  +   +  NS    ++ GN +      +      +     + 
Sbjct  1    MIKQILNRLPRKPKSSEHREGGSSNTNSNASASSRGNSISSNKYASSSTTFSSATSTPNF  60

Query  269  AIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDL  439
             +   S + G    SP+     FKDV N EKQ LL+ KLNLCC V+DF DP KN  EK++
Sbjct  61   GVNVNSKLNGNSLASPYEALPSFKDVPNAEKQNLLIKKLNLCCVVFDFSDPTKNIKEKEI  120

Query  440  KRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF---PPKCASHARGESEDEELF  610
            KRQ L+EL D++AS + K  E  +  + +M  +NLFR     P +  +    + E+EE  
Sbjct  121  KRQTLVELVDYIASANGKFPEIVVQEIVKMVCINLFRTLSSPPLENKALEAFDVEEEEPS  180

Query  611  FDPAWYHLQLVY  646
             DPAW HLQ+VY
Sbjct  181  MDPAWPHLQVVY  192



>ref|XP_006417120.1| hypothetical protein EUTSA_v10007450mg [Eutrema salsugineum]
 gb|ESQ35473.1| hypothetical protein EUTSA_v10007450mg [Eutrema salsugineum]
Length=497

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = +2

Query  281  ASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQV  451
             ++   G   +P+     FKDV N EKQ L + KLNLCC V+DF DP KN  EK++KRQ 
Sbjct  63   GNLKGNGNGFTPYEALPSFKDVPNAEKQNLFLKKLNLCCVVFDFSDPTKNVKEKEIKRQT  122

Query  452  LLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPA  622
            LLEL D+VAS + K +E+ I    RM +VN+FR   P+   +   ++   E+EE   DPA
Sbjct  123  LLELVDYVASANGKFSETVIQEAIRMVSVNIFRTLNPQPRENKVIDALDLEEEEPSMDPA  182

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  183  WPHLQLVY  190



>ref|XP_010531427.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Tarenaya hassleriana]
Length=520

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV + EKQ L ++KLNL C+V+DF DP KN  EKD+KRQ LLEL D+V SG+ K +E+
Sbjct  89   FKDVPSSEKQNLFITKLNLSCAVFDFTDPTKNGREKDIKRQTLLELVDYVTSGNGKFSET  148

Query  506  AIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
             + A  RM + NLFR   P+   +   E    E+EE   DPAW HLQ+VY
Sbjct  149  VMQAAVRMVSANLFRPLSPQPRENKAMEGLDLEEEEPSMDPAWPHLQIVY  198



>ref|XP_007031734.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 3, partial [Theobroma cacao]
 gb|EOY02660.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 3, partial [Theobroma cacao]
Length=415

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 6/149 (4%)
 Frame = +2

Query  209  FTNSCNVIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCC  388
            F ++ N+  N  N + +V +A    ++ A  E++     F+D+ N EKQ L + KLNLCC
Sbjct  58   FNSTPNIGLNPGNKISQVVNAKLNGNMFASFEALP---SFRDIPNSEKQNLFIRKLNLCC  114

Query  389  SVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PP  562
             V+DF DP KN  EKD+KRQ LLEL D+V+S S K +E  +  + +M +VNLFR    PP
Sbjct  115  IVFDFTDPTKNFKEKDIKRQTLLELVDYVSSASGKFSEIVMQEIVKMVSVNLFRALTSPP  174

Query  563  KCASHARG-ESEDEELFFDPAWYHLQLVY  646
            +        + E+EE   DPAW HLQ+VY
Sbjct  175  RENKVLEAFDLEEEEPSMDPAWPHLQVVY  203



>ref|XP_010660818.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform isoform X2 [Vitis vinifera]
Length=419

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 103/189 (54%), Gaps = 22/189 (12%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+K IL ++PRK  KS      GA P S + P N GN                + + V+ 
Sbjct  1    MIKNILNRLPRKPSKSAENRDGGANPTSNSGP-NYGN---------------KIPQAVNM  44

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
             +   S  A  E++     F+DV N EKQ L + KL+LCC V+DF DP KN  EK++KRQ
Sbjct  45   KLNGNSAAASYEALP---SFRDVPNSEKQTLFIRKLSLCCVVFDFTDPTKNLKEKEIKRQ  101

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCASHARG-ESEDEELFFDP  619
             L+EL D+V S + K TE+ +  + +M +VNLFR    PP+        + E+EE   DP
Sbjct  102  TLVELVDYVTSANGKFTENVMQEIIKMVSVNLFRTLTSPPRENKVLEAFDLEEEEPSMDP  161

Query  620  AWYHLQLVY  646
            AW HLQ+VY
Sbjct  162  AWSHLQIVY  170



>ref|NP_001051871.1| Os03g0844500 [Oryza sativa Japonica Group]
 emb|CAC85921.1| putative protein phosphatase 2A B'zeta subunit [Oryza sativa 
Japonica Group]
 gb|AAS07368.1| putative B' regulatory subunit of protein phosphatase [Oryza 
sativa Japonica Group]
 gb|ABF99851.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 gb|ABF99852.1| transposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13785.1| Os03g0844500 [Oryza sativa Japonica Group]
 gb|EEC76514.1| hypothetical protein OsI_14291 [Oryza sativa Indica Group]
 gb|EEE60283.1| hypothetical protein OsJ_13339 [Oryza sativa Japonica Group]
Length=517

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 104/195 (53%), Gaps = 9/195 (5%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQFTN--SCNVIANRLNVVKR  259
            M+KQIL + P+K  KS   D  G + P+  N P       + +N  S   + +   +   
Sbjct  1    MIKQILGRFPKKPSKSGDKDPIGRSSPSVPNPPLGPRGAERSSNLSSQTPVISSSGLSYG  60

Query  260  VSSAIFPASIVAGGESISPHL----CFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAA  427
                +  A+    G S+ P +     FKDV N EK  L V KLNLCC+ +DF DP K+  
Sbjct  61   SGMHVGNANSRVNGNSVQPTVELLPSFKDVPNTEKNNLFVKKLNLCCATFDFTDPTKSVK  120

Query  428  EKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCASHARGESEDE  601
            EK++KRQ LLEL D++AS + K  E  +  + RM +VNLFR    PP+       + +DE
Sbjct  121  EKEVKRQTLLELVDYIASANGKFPEIIMQEITRMVSVNLFRTLTTPPRENKIEAFDVDDE  180

Query  602  ELFFDPAWYHLQLVY  646
            E   DPAW HLQ+VY
Sbjct  181  EPVMDPAWSHLQIVY  195



>ref|XP_007031732.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 ref|XP_007031733.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 gb|EOY02658.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
 gb|EOY02659.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform 1 [Theobroma cacao]
Length=525

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 6/149 (4%)
 Frame = +2

Query  209  FTNSCNVIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCC  388
            F ++ N+  N  N + +V +A    ++ A  E++     F+D+ N EKQ L + KLNLCC
Sbjct  58   FNSTPNIGLNPGNKISQVVNAKLNGNMFASFEALP---SFRDIPNSEKQNLFIRKLNLCC  114

Query  389  SVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PP  562
             V+DF DP KN  EKD+KRQ LLEL D+V+S S K +E  +  + +M +VNLFR    PP
Sbjct  115  IVFDFTDPTKNFKEKDIKRQTLLELVDYVSSASGKFSEIVMQEIVKMVSVNLFRALTSPP  174

Query  563  KCASHARG-ESEDEELFFDPAWYHLQLVY  646
            +        + E+EE   DPAW HLQ+VY
Sbjct  175  RENKVLEAFDLEEEEPSMDPAWPHLQVVY  203



>ref|XP_011470807.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Fragaria vesca subsp. 
vesca]
Length=526

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 103/204 (50%), Gaps = 27/204 (13%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL +IPRK  K        +Q ++ ND   +G G    NS     +     +  + 
Sbjct  1    MIKQILGRIPRKPSK-------SSQNDAYNDGGVNGIGPNSINSSKSSNSGSGNSRTSNG  53

Query  269  AIFPAS---------------IVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDF  403
             + P S               + +G     P   F+DV + EKQGL + KLN+CC V+DF
Sbjct  54   VLAPLSSKPSQSKKPGQVGPLLFSGAYEALP--SFRDVPSAEKQGLFIKKLNMCCVVFDF  111

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR  583
             DP KN  EKD+KRQ LLEL D+++S + K  E  +  + +M A NLFR FP        
Sbjct  112  NDPWKNVKEKDVKRQTLLELVDYISSVNSKFNEVTMQEITKMVATNLFRTFPSPSHEKKA  171

Query  584  GESED---EELFFDPAWYHLQLVY  646
             ES D   E+   +PAW HLQ+VY
Sbjct  172  LESYDQDEEDQMLEPAWSHLQVVY  195



>ref|XP_008222034.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=520

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 107/201 (53%), Gaps = 16/201 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDP-TNSGNGMQFTNSCNVIA-----NRLNV  250
            M KQIL+K+PRKS K+      G+     N P T+  +    + S N++      N ++ 
Sbjct  1    MFKQILSKLPRKSSKNSESRD-GSHTMYSNPPNTSRSSDFGTSKSGNLVTSFPAGNPVSD  59

Query  251  V------KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDP  412
            V      K V  A    +      S      F+DV N EKQ L + KLNLCC V+DF DP
Sbjct  60   VGKSYGNKNVRGANLKPNGFVLSSSYEALPGFRDVPNSEKQSLFIKKLNLCCVVFDFTDP  119

Query  413  DKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES  592
             K+  EK++KRQ LLEL D+V S + K TE+ +  + +M + NLFR F P+   +   E 
Sbjct  120  TKHLKEKEIKRQTLLELVDYVTSANGKFTETVMQEIAKMVSTNLFRSFTPQPRENKLVEG  179

Query  593  ---EDEELFFDPAWYHLQLVY  646
               E++E   DPAW HLQLVY
Sbjct  180  FDLEEDEPSMDPAWPHLQLVY  200



>ref|XP_009402720.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402721.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009402722.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Musa acuminata subsp. 
malaccensis]
Length=522

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 114/203 (56%), Gaps = 20/203 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldss--GAQPNSCNDPTNSGNG-MQFTNSCNV-------IAN  238
            M+KQIL ++PRK  KS     S  G  P S +  T+S NG +Q +   N+       ++ 
Sbjct  1    MIKQILNRLPRKPSKSSDSRDSVGGPTPQSSSSSTSSRNGDLQASRITNLNSQAPPGLSP  60

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHL----CFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             LN   +   A+   ++   G ++ P       FKDV N EKQ L + KL+LCC V+DF 
Sbjct  61   GLNHQNKYDPAV---NVKLNGNNVVPVFEALPSFKDVPNSEKQSLFMRKLDLCCVVFDFT  117

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPK-CASH  577
            DP KN  EKD+KRQ LLEL D+V S S K  E+ +  + +M +VNLFR    PP+     
Sbjct  118  DPSKNLKEKDIKRQTLLELVDYVTSSSGKFPENVMQEIAKMVSVNLFRTLTSPPRENMIL  177

Query  578  ARGESEDEELFFDPAWYHLQLVY  646
             + ++E+EE   DPAW HLQ+VY
Sbjct  178  EKIDAEEEEPVMDPAWPHLQIVY  200



>gb|KHG26982.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=516

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 105/198 (53%), Gaps = 14/198 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-AQPNSCNDPTNSGNGMQ--------FTNSCNVIANR  241
            M+KQI  ++PRK  KS      G    +S N  T+S N            +++ N+  N+
Sbjct  2    MIKQIFNRLPRKQSKSSDNREGGGTSASSSNAYTSSRNNANSGGPASSGVSSTPNLGLNQ  61

Query  242  LNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKN  421
             N V +V +      ++A      P   FKD+ N EKQ L + KLNLC  V+DF DP KN
Sbjct  62   GNKVSQVVNTKLNGDVLASSFETLP--SFKDIPNSEKQNLFIRKLNLCRVVFDFSDPTKN  119

Query  422  AAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCASHARG-ES  592
              EKD+KRQ LLEL D+V+S + K  E  +    +M ++NLFR    PP+        + 
Sbjct  120  LKEKDIKRQTLLELVDYVSSANGKFPEIVMQEFVKMVSLNLFRPLTSPPRENKVLEAFDV  179

Query  593  EDEELFFDPAWYHLQLVY  646
            EDEE   DPAW HLQ+VY
Sbjct  180  EDEEPSVDPAWSHLQVVY  197



>ref|XP_006414514.1| hypothetical protein EUTSA_v10024939mg [Eutrema salsugineum]
 gb|ESQ55967.1| hypothetical protein EUTSA_v10024939mg [Eutrema salsugineum]
Length=516

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/209 (36%), Positives = 110/209 (53%), Gaps = 44/209 (21%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNG-----MQFTNSCN---------  226
            M+KQI  K+PR               +S NDP  +G G     M+ + S +         
Sbjct  1    MIKQIFGKLPR-----------KPSKSSHNDPNPNGEGRDNVFMESSTSNSHGANGTVPA  49

Query  227  ---VIANRLNVVKRVSSA-IFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSV  394
               ++ NR N   + S A  FP       E++     F+DV + EK  L + KL++CC V
Sbjct  50   FPPLVNNRTNQANKPSGAGAFPVY-----EALP---SFRDVPSSEKPNLFIKKLSMCCVV  101

Query  395  YDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS  574
            +DF DP KN  EK++KRQ LLEL D++A+ S K +++A+  + +M  VNLFR FP   A+
Sbjct  102  FDFSDPSKNLREKEIKRQTLLELVDYIATVSTKFSDAAMQEIAKMAVVNLFRTFP--SAN  159

Query  575  HARG-----ESEDEELFFDPAWYHLQLVY  646
            H        +++DEE   +PAW HLQ+VY
Sbjct  160  HESKLLETLDADDEEPALEPAWPHLQVVY  188



>ref|XP_010252513.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nelumbo nucifera]
 ref|XP_010252514.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nelumbo nucifera]
 ref|XP_010252515.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nelumbo nucifera]
 ref|XP_010252516.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Nelumbo nucifera]
Length=553

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 89/167 (53%), Gaps = 5/167 (3%)
 Frame = +2

Query  155  GAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKD  334
            G  PNS +  + S NG    +S     ++ N  K+   A      V    +      F++
Sbjct  57   GKAPNSGSGASRSNNGASVPHSS--ATSKSNQGKKSVPAASQVGPVLASTTYEALPTFRE  114

Query  335  VSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIA  514
            V + EKQ L + KLN+CC V+DF DP KN  EKD+KRQ LLEL D++ S + K  E  + 
Sbjct  115  VPSSEKQNLFIRKLNMCCIVFDFTDPSKNLKEKDIKRQTLLELVDYITSVTSKFNEIVMQ  174

Query  515  AVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
             + +M A NLFR FP     +   E+   EDEE   +PAW HLQ+VY
Sbjct  175  EITKMVAANLFRTFPSSNHENKLPETYDPEDEEPTMEPAWPHLQIVY  221



>ref|XP_008648421.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Zea mays]
 ref|XP_008648422.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Zea mays]
 gb|AFW74401.1| hypothetical protein ZEAMMB73_323247 [Zea mays]
Length=506

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 107/204 (52%), Gaps = 21/204 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIA--NRLNVVKRV  262
            M+KQIL ++P+K  K+   + +GA P+  +  +++      T S  +++  N  +     
Sbjct  1    MIKQILGRLPKKPTKAGEKELAGAGPSLPSPTSDARTTTDLTASSRLVSPSNYASAATNP  60

Query  263  SSAIFP-------------ASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDF  403
              +  P             A   AG E++     F+DV   EK GLL+ KL +CC V+DF
Sbjct  61   GQSYAPRAAGLGAGASNGFAGSAAGYEALP---SFRDVPASEKPGLLLGKLAMCCVVFDF  117

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR  583
             DP K+  EK++KRQ LLEL D++ S + K  E  +  V RM +VNLFR   P    +  
Sbjct  118  ADPTKDVREKEVKRQTLLELVDYITSATSKFPEPVVQEVVRMVSVNLFRVPTPAPRENKA  177

Query  584  GES---EDEELFFDPAWYHLQLVY  646
             ES   E+EE   DPAW HLQ+VY
Sbjct  178  LESFDMEEEEPVMDPAWSHLQIVY  201



>ref|XP_009359296.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
 ref|XP_009359297.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
 ref|XP_009359298.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Pyrus x bretschneideri]
Length=520

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 107/204 (52%), Gaps = 22/204 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNS----------GNGMQFTNSCNVIAN  238
            ML+QIL K+PRKS K       GA     N PT+S          GN      S NV+AN
Sbjct  1    MLRQILNKLPRKSSKKAENRD-GAHTLYSNPPTSSRSNDSGTSKSGNLTTSFPSGNVVAN  59

Query  239  RLNVVKRVSS-----AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDF  403
               VVK  S+     A    +  A   S      F+DV N EKQ L + KL+LCC  +DF
Sbjct  60   ---VVKSYSNKNAKGANMKPNGFAFSSSYEALPGFRDVPNAEKQSLFIKKLSLCCVAFDF  116

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR  583
             DP K+  EK++K+Q LLEL D+V   + K +E+ +  + +M + NLFR F P+   +  
Sbjct  117  TDPTKHLKEKEIKQQTLLELVDYVTKPNSKFSEALMQELIKMVSANLFRAFTPQPRENKV  176

Query  584  GES---EDEELFFDPAWYHLQLVY  646
             E    E+EE   DPAW HLQ+VY
Sbjct  177  AEGFDLEEEEPSMDPAWPHLQVVY  200



>emb|CDP16651.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 109/201 (54%), Gaps = 17/201 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCN--------DPTNSGNGMQFTNSCNVIANR-  241
            M+KQIL ++PRK  KS      G    S N        D +NS +G     S  V +N  
Sbjct  1    MIKQILNRLPRKPSKSAEGRDGGPPTFSSNASTSSRNNDLSNSRSGNSNATSLAVASNPG  60

Query  242  LNVVKRVSSAIFPASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDP  412
            LN   ++  A+     V G  ++SP+     F+DV N EKQ L + KLNLC  V+DF DP
Sbjct  61   LNHGNKLPQAL--NMKVNGNLAVSPYEALPSFRDVPNSEKQNLFIKKLNLCSVVFDFTDP  118

Query  413  DKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES  592
             KN  EKD+KRQ L+EL D+V+S + K TE+ +  + +M + NLFR    +   +   E+
Sbjct  119  TKNLKEKDIKRQTLVELVDYVSSANGKFTETVMQEIIKMVSTNLFRTLSSQPRENKVLEA  178

Query  593  ---EDEELFFDPAWYHLQLVY  646
               ++EE   D AW HLQ+VY
Sbjct  179  FDVDEEEPLMDAAWPHLQVVY  199



>ref|XP_010551033.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Tarenaya hassleriana]
 ref|XP_010551034.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' zeta isoform-like [Tarenaya hassleriana]
Length=525

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/196 (40%), Positives = 110/196 (56%), Gaps = 16/196 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG----AQPNSCNDPTNSGNGM---QFTNSCNVIANRLN  247
            M+KQI  K+PRK  KS   DS+G    +  NS   P+ SGNG    +  NS   I  +  
Sbjct  1    MIKQIFGKLPRKPSKSLPSDSNGEGGISSLNSYYSPS-SGNGTLSPRSLNSNRTIQGKKP  59

Query  248  VVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAA  427
            +   + +  FP S+V   E++     F+DV   EK  L + KL++CC V+DF DP KN  
Sbjct  60   LGDSLQADPFPPSVVY--EALP---GFRDVPVSEKPNLFIRKLHMCCVVFDFSDPSKNLK  114

Query  428  EKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGE---SED  598
            EK++KRQ LLEL D++AS  VK  E A+  + +M  +NLFR FP +       E    ++
Sbjct  115  EKEIKRQTLLELVDYIASVPVKFNEMAMQEITKMVGLNLFRSFPSRNHESKILEMFDMDE  174

Query  599  EELFFDPAWYHLQLVY  646
            +E   +PAW HLQ+VY
Sbjct  175  DEPTLEPAWPHLQVVY  190



>gb|KJB10684.1| hypothetical protein B456_001G216400 [Gossypium raimondii]
Length=544

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 109/215 (51%), Gaps = 32/215 (15%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-------------AQPNSCNDPTNSGNGMQFT-----  214
            M+KQI  K+PRK  KS   DS+G               PNS N   NS  G   +     
Sbjct  1    MIKQIFGKLPRKPSKSSHNDSNGDGGVHDNSSLNSALGPNSLN---NSKPGSASSKPSNS  57

Query  215  --------NSCNVIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVS  370
                    NS +  +N+ N  K+ +S    A  ++          F+DV + EKQ L + 
Sbjct  58   SRSNNGPLNSHSSTSNKSNHGKKTASLASQAGPISASGVYEALPSFRDVPSSEKQNLFLK  117

Query  371  KLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFR  550
            KL+LC  V+DF DP KN  EK++KRQ LLEL D+++S S K  E A+  V RM A NLFR
Sbjct  118  KLSLCYVVFDFSDPSKNLREKEIKRQTLLELVDYISSVSSKFNEVAMQEVTRMVAANLFR  177

Query  551  DFP-PKCASH--ARGESEDEELFFDPAWYHLQLVY  646
             FP P   S      + EDEE   DPAW HLQ+VY
Sbjct  178  TFPSPNHDSKILEMYDMEDEEPAMDPAWPHLQIVY  212



>gb|KHG18630.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
gamma-like protein [Gossypium arboreum]
Length=544

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/215 (40%), Positives = 109/215 (51%), Gaps = 32/215 (15%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG-------------AQPNSCNDPTNSGNGMQFT-----  214
            M+KQI  K+PRK  KS   DS+G               PNS N   NS  G   +     
Sbjct  1    MIKQIFGKLPRKPSKSSHNDSNGDGGVHDNSSLNSALGPNSLN---NSKPGSASSKPSNS  57

Query  215  --------NSCNVIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVS  370
                    NS +  +N+ N  K+ +S    A  ++          F+DV + EKQ L + 
Sbjct  58   SRSNNGPLNSHSSTSNKSNHGKKTASLASQAGPISASGVYEALPSFRDVPSSEKQNLFLK  117

Query  371  KLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFR  550
            KL+LC  V+DF DP KN  EK++KRQ LLEL D+++S S K  E A+  V RM A NLFR
Sbjct  118  KLSLCYVVFDFSDPSKNLREKEIKRQTLLELVDYISSVSSKFNEVAMQEVTRMVAANLFR  177

Query  551  DFP-PKCASH--ARGESEDEELFFDPAWYHLQLVY  646
             FP P   S      + EDEE   DPAW HLQ+VY
Sbjct  178  TFPSPNHDSKILEMYDMEDEEPAMDPAWPHLQIVY  212



>gb|AFW74402.1| hypothetical protein ZEAMMB73_323247 [Zea mays]
Length=536

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 107/204 (52%), Gaps = 21/204 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIA--NRLNVVKRV  262
            M+KQIL ++P+K  K+   + +GA P+  +  +++      T S  +++  N  +     
Sbjct  1    MIKQILGRLPKKPTKAGEKELAGAGPSLPSPTSDARTTTDLTASSRLVSPSNYASAATNP  60

Query  263  SSAIFP-------------ASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDF  403
              +  P             A   AG E++     F+DV   EK GLL+ KL +CC V+DF
Sbjct  61   GQSYAPRAAGLGAGASNGFAGSAAGYEALP---SFRDVPASEKPGLLLGKLAMCCVVFDF  117

Query  404  GDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHAR  583
             DP K+  EK++KRQ LLEL D++ S + K  E  +  V RM +VNLFR   P    +  
Sbjct  118  ADPTKDVREKEVKRQTLLELVDYITSATSKFPEPVVQEVVRMVSVNLFRVPTPAPRENKA  177

Query  584  GES---EDEELFFDPAWYHLQLVY  646
             ES   E+EE   DPAW HLQ+VY
Sbjct  178  LESFDMEEEEPVMDPAWSHLQIVY  201



>ref|XP_010927329.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform-like [Elaeis guineensis]
Length=542

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 75/113 (66%), Gaps = 6/113 (5%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV + EK  L + K+ LCC V+DF DP KN  EK++KRQ LLEL D+VA+ + K +E+
Sbjct  99   FRDVPSSEKPNLFLKKIALCCVVFDFTDPAKNLREKEVKRQTLLELVDYVATATAKFSEA  158

Query  506  AIAAVCRMCAVNLFRDFP-PKCASHARG-----ESEDEELFFDPAWYHLQLVY  646
            A+    RM A NLFR FP   C S +RG     ++E+EE   DPAW HLQ+VY
Sbjct  159  AMQEATRMVAANLFRTFPSSSCDSTSRGLPEGFDAEEEEPAMDPAWPHLQVVY  211



>gb|KDP26745.1| hypothetical protein JCGZ_17903 [Jatropha curcas]
Length=524

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/218 (36%), Positives = 109/218 (50%), Gaps = 48/218 (22%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG----------------------AQPNSCNDPTNS---  193
            M+KQIL K+PRK  KS      G                      A  NS + P +    
Sbjct  1    MIKQILGKLPRKPSKSSESREFGGPSAPSNTSTSSRSNDLASNKSATLNSTSPPPSDSAP  60

Query  194  ----GNGMQFTNSCNVIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGL  361
                G+G + T + N   ++LN            S++A  E++     F+DV + EKQ L
Sbjct  61   HLGYGHGSKLTQAAN---SKLN----------GNSVIAPYEALP---AFRDVPSSEKQNL  104

Query  362  LVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVN  541
             + KLNLC  V+DF DP KN  EKD+KRQ L+EL D+V S + K TE+ +  V +M +VN
Sbjct  105  FIRKLNLCSVVFDFTDPTKNLKEKDIKRQTLVELVDYVTSANGKFTETVMQEVIKMVSVN  164

Query  542  LFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
            LFR    +   +   E+   E+EE   DPAW HLQ+VY
Sbjct  165  LFRSLTTQPRENKVLETFDLEEEEPLMDPAWPHLQIVY  202



>gb|KJB33914.1| hypothetical protein B456_006G038500 [Gossypium raimondii]
Length=425

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EKQ LL+ KLNLCC V+DF DP KN  EKDLKRQ LLEL D+V+S + K +E 
Sbjct  93   FRDVPNSEKQNLLIRKLNLCCIVFDFTDPTKNLKEKDLKRQTLLELVDYVSSANGKFSEI  152

Query  506  AIAAVCRMCAVNLFRDF--PPKCASHARG-ESEDEELFFDPAWYHLQLVY  646
             +  + +M +VNLFR    PP+        + E+EE   DPAW HLQ+VY
Sbjct  153  VMQEIVKMVSVNLFRALTSPPRENKVLEAFDLEEEEPSMDPAWPHLQVVY  202



>ref|XP_004169443.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Cucumis sativus]
Length=524

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 103/205 (50%), Gaps = 22/205 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNS--------------CNDPTNSGNGMQFTNSCN  226
            M+KQIL ++PRK  KS           S               N  TN+G G  F+   +
Sbjct  1    MIKQILNRLPRKPSKSTEHREGAGTTISSSNASTSLRSNDLAANHHTNTGTG-SFSGPNS  59

Query  227  VIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             ++  LN   + S  +   S      S      FKDV N EKQ L + KLN+CC V+DF 
Sbjct  60   TLSVGLNHGSKPSQGLNSKSNGNSQVSYEALPGFKDVPNSEKQSLFIKKLNMCCVVFDFT  119

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG  586
            DP KN  EKD+KRQ L+EL D+VAS + K +E+ I  + +M + NLFR   P   S    
Sbjct  120  DPSKNLKEKDIKRQTLIELVDYVASANGKLSENVIQEIVKMVSSNLFRT--PTIPSRDNK  177

Query  587  -----ESEDEELFFDPAWYHLQLVY  646
                 + E+EE   DPAW HLQ+VY
Sbjct  178  ALEAFDLEEEEPSMDPAWPHLQVVY  202



>ref|XP_009590023.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590024.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590025.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
 ref|XP_009590026.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana tomentosiformis]
Length=524

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 85/147 (58%), Gaps = 12/147 (8%)
 Frame = +2

Query  215  NSCNVIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSV  394
            N  N +   +N     S+A+FP   +           FKDV + EKQ L + KLNLCC +
Sbjct  65   NHGNRLPQSVNAKVNGSAAVFPYETLPS---------FKDVPSSEKQNLFIKKLNLCCLM  115

Query  395  YDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS  574
            +DF DP K+  EKD+KRQ L+EL D+V+S + K TE+ I  + +M + NLFR   P+   
Sbjct  116  FDFTDPTKHLKEKDIKRQTLVELVDYVSSANGKFTETVIQEIVKMVSSNLFRPLTPQPRE  175

Query  575  HARGES---EDEELFFDPAWYHLQLVY  646
            +   E+   E++E   DPAW HLQ+VY
Sbjct  176  NKVLEAFDLEEDEPLMDPAWPHLQIVY  202



>ref|XP_002870241.1| hypothetical protein ARALYDRAFT_329973 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46500.1| hypothetical protein ARALYDRAFT_329973 [Arabidopsis lyrata subsp. 
lyrata]
Length=948

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 103/199 (52%), Gaps = 34/199 (17%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPT--------NSGNGMQFTNSCNVIANRL  244
            M+KQI  K+PRK  KS       + PN    PT        N  NG     S    +NR 
Sbjct  443  MIKQIFGKLPRKPSKSSHN---DSNPNGEGGPTSKSSASNSNGANGTVIAPSSTS-SNRT  498

Query  245  NVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNA  424
            N V  V  A+                 F+DV + EK  L + KL+LCC V+DF DP KN 
Sbjct  499  NQVNGVYEAL---------------PSFRDVPSSEKPNLFIKKLSLCCVVFDFSDPSKNL  543

Query  425  AEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG-----E  589
             EK++KRQ LLEL D++A+ S K +++A+  + ++  VNLFR FP   A+H        +
Sbjct  544  REKEIKRQTLLELVDYIATVSSKLSDAAMQEIAKVAVVNLFRTFP--SANHESKILETLD  601

Query  590  SEDEELFFDPAWYHLQLVY  646
             +DEE   +PAW HLQ+VY
Sbjct  602  VDDEEPALEPAWPHLQVVY  620



>ref|XP_004310036.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Fragaria vesca subsp. vesca]
Length=514

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/206 (37%), Positives = 105/206 (51%), Gaps = 23/206 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVV-----  253
            M+KQIL ++PRK  KS      G    S  + + S       +   + AN + V+     
Sbjct  1    MIKQILGRLPRKPSKSADNREYGGASASSLNASISSRKSDLASDRPINANSVPVLDLDGA  60

Query  254  ------------KRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVY  397
                        + V+S +   S+ A  E++     F+DV   EKQ L + KLNLC  V+
Sbjct  61   SRLANRGGSKLPQVVNSKLNGNSVAASYEALP---AFRDVPGSEKQILFIKKLNLCSVVF  117

Query  398  DFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASH  577
            DF DP K+  EKD+KRQ LLEL D V+S S K  E+ I    +M +VNLFR   P+   +
Sbjct  118  DFTDPAKHLKEKDIKRQTLLELVDHVSSASGKFNETIIQEAIKMVSVNLFRSLSPQPREN  177

Query  578  ARGES---EDEELFFDPAWYHLQLVY  646
               ES   ED+E   DPAW HLQ+VY
Sbjct  178  KVLESFDMEDDEPLMDPAWPHLQIVY  203



>ref|XP_002890006.1| hypothetical protein ARALYDRAFT_471504 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66265.1| hypothetical protein ARALYDRAFT_471504 [Arabidopsis lyrata subsp. 
lyrata]
Length=495

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 78/128 (61%), Gaps = 6/128 (5%)
 Frame = +2

Query  281  ASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQV  451
             ++   G   +P+     FKDV N EKQ L V KL+LCC  +DF DP KN  EK++KRQ 
Sbjct  61   GNLKGNGNGFTPYEALPGFKDVPNAEKQNLFVKKLSLCCVTFDFSDPTKNVKEKEIKRQT  120

Query  452  LLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPA  622
            LLEL D+VAS + K +E+ I  V RM +VN+FR   P+   +   ++   E+EE   DP 
Sbjct  121  LLELVDYVASPNGKFSETVIQEVVRMVSVNIFRTLNPQPRENKVIDALDLEEEEPSMDPT  180

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  181  WPHLQLVY  188



>ref|XP_009148646.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Brassica rapa]
 ref|XP_009148647.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform [Brassica rapa]
Length=493

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDVSN EKQ L + KL+LCC ++DF DP KN  EK++KRQ LLEL D+VA+ + K +ES
Sbjct  76   FKDVSNAEKQTLFLKKLSLCCVLFDFSDPSKNVKEKEIKRQTLLELVDYVATANGKFSES  135

Query  506  AIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
             I    RM +VN+FR   P+   +   ++   E+EE   DP+W HLQLVY
Sbjct  136  VIQEAVRMVSVNIFRTLNPQPRENKVIDALDLEEEEPSMDPSWPHLQLVY  185



>gb|KJB33915.1| hypothetical protein B456_006G038500 [Gossypium raimondii]
 gb|KJB33916.1| hypothetical protein B456_006G038500 [Gossypium raimondii]
Length=524

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EKQ LL+ KLNLCC V+DF DP KN  EKDLKRQ LLEL D+V+S + K +E 
Sbjct  93   FRDVPNSEKQNLLIRKLNLCCIVFDFTDPTKNLKEKDLKRQTLLELVDYVSSANGKFSEI  152

Query  506  AIAAVCRMCAVNLFRDF--PPKCASHARG-ESEDEELFFDPAWYHLQLVY  646
             +  + +M +VNLFR    PP+        + E+EE   DPAW HLQ+VY
Sbjct  153  VMQEIVKMVSVNLFRALTSPPRENKVLEAFDLEEEEPSMDPAWPHLQVVY  202



>gb|KHG16605.1| Serine/threonine phosphatase 2A 59 kDa regulatory subunit B' 
eta-like protein [Gossypium arboreum]
Length=431

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/199 (38%), Positives = 108/199 (54%), Gaps = 14/199 (7%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTN-----SCNVIANRLNVV  253
            MLKQIL+K+PRKS KS      G   N+      SG G + ++     S N+  +   V 
Sbjct  1    MLKQILSKLPRKSSKSADNREHGGHHNAYYSNV-SGGGSRSSDFGTGKSGNLSVSSFAVS  59

Query  254  KRVSSAIFPASIVA--GGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
               +   + ++ +   G   +S +     FKDV   E+Q L V KLNLCC ++DF DP K
Sbjct  60   NSTADVGWKSADLKQNGNHMLSSYEAMPAFKDVPTSERQNLFVKKLNLCCMIFDFTDPTK  119

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES--  592
            N  EK++KRQ LLEL ++V S + K ++  +  + +M + NLFR F P+   +   E   
Sbjct  120  NLKEKEIKRQTLLELLEYVTSANGKFSDVVLQEIVKMVSANLFRSFNPQPRENKVIEGVD  179

Query  593  -EDEELFFDPAWYHLQLVY  646
             E+EE   DPAW HLQ+VY
Sbjct  180  LEEEEPSMDPAWPHLQIVY  198



>gb|KDP26746.1| hypothetical protein JCGZ_17904 [Jatropha curcas]
Length=510

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 78/211 (37%), Positives = 109/211 (52%), Gaps = 33/211 (16%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            MLKQIL+K+PRKS KS      G    S    +N+  G++ ++     + +LN+     +
Sbjct  1    MLKQILSKLPRKSSKSTEHRDYGG---SLVGDSNASTGLRRSDLGASKSVKLNI-----T  52

Query  269  AIFPASIVA----------------------GGESISPHLCFKDVSNGEKQGLLVSKLNL  382
            ++ P S  +                      G  S      F+DV N +KQ L + KLNL
Sbjct  53   SVAPNSSASDTGQNHGNKIQRGVSLKQNGNLGFSSYEGLPAFRDVPNSDKQNLFIRKLNL  112

Query  383  CCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPP  562
            CC V+DF DP KN  EK++KRQ LLEL D++ S + K TE+ +  V +M A NLFR   P
Sbjct  113  CCIVFDFTDPTKNLKEKEIKRQNLLELVDYITSVNGKFTETVMQEVIKMVAANLFRTLTP  172

Query  563  KCASHAR---GESEDEELFFDPAWYHLQLVY  646
            +   +      E ++EE   DPAW HLQLVY
Sbjct  173  QPRDNKVVDGVELDEEEASMDPAWPHLQLVY  203



>ref|XP_004142950.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Cucumis sativus]
 ref|XP_004159560.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Cucumis sativus]
 gb|KGN62353.1| hypothetical protein Csa_2G350360 [Cucumis sativus]
Length=525

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 75/203 (37%), Positives = 107/203 (53%), Gaps = 17/203 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssG----AQPNSCNDPTNSGNGMQFTNSCNVIAN--RLNV  250
            M+KQI +K+PRKS K       G    A   +    ++ GN +    S N++++    N 
Sbjct  1    MIKQIFSKLPRKSSKGGESREHGGSHMAPSTAYASASSRGNDLASGKSANLVSSFAATNS  60

Query  251  VKRVSSAIFPASIVAGG--------ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
            V+ V       +   G          S  P   F++V + EKQ L V KLNLCC ++DF 
Sbjct  61   VQDVGQNHGTKANKGGNAKLNGIPTSSYEPLPGFREVPSSEKQNLFVKKLNLCCFLFDFT  120

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG  586
            DP K+  EK++KRQ LLE+ D+V S + K TE+ I  V +M ++NLFR   P+   +   
Sbjct  121  DPTKHLKEKEIKRQTLLEIVDYVTSVNSKFTETVIQEVIKMVSINLFRTMSPQPRENKIV  180

Query  587  ES---EDEELFFDPAWYHLQLVY  646
            E    E+EE   DPAW HLQ+VY
Sbjct  181  EGFDLEEEEPSMDPAWPHLQIVY  203



>ref|XP_011047218.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' gamma isoform [Populus euphratica]
Length=541

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 112/216 (52%), Gaps = 37/216 (17%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI------------  232
            M+KQIL K+PRK  +S S DS+     + +   NS +G    N+                
Sbjct  1    MIKQILGKLPRKPSRSSSNDSNNDGGLNAHSSLNSSHGANSINNSKPSSNSSKASNPSLG  60

Query  233  ANRLNVVKRVSSAIFPASIVAGGESISPHL-------------CFKDVSNGEKQGLLVSK  373
            A+RLN     +  + P S ++ G+  +P L              F+DV N EK  L + K
Sbjct  61   ASRLN-----NGILAPNSKMSQGKKSAPQLGPVITSGVYEALPSFRDVPNSEKPNLFIKK  115

Query  374  LNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRD  553
            LN+CC V+DF DP KN  EKD+KRQ LLEL D++++ + K  E A+  + +M A NLFR 
Sbjct  116  LNMCCVVFDFSDPAKNLKEKDIKRQTLLELVDYISTLTSKFNEMAMQEITKMVAANLFRT  175

Query  554  FPPKCASHARG-----ESEDEELFFDPAWYHLQLVY  646
             P   A+H        + EDEE   +PAW HLQ+VY
Sbjct  176  LP--SANHDNKILEMFDPEDEEPAMEPAWPHLQIVY  209



>ref|XP_006307325.1| hypothetical protein CARUB_v10008945mg [Capsella rubella]
 gb|EOA40223.1| hypothetical protein CARUB_v10008945mg [Capsella rubella]
Length=495

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 79/128 (62%), Gaps = 6/128 (5%)
 Frame = +2

Query  281  ASIVAGGESISPHLC---FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQV  451
             ++   G   SP+     FKDV N EKQ L + KLNLCC V+DF DP KN  EK++KRQ 
Sbjct  61   GNLKGNGTGFSPYEALPSFKDVPNAEKQNLCLRKLNLCCLVFDFSDPTKNVKEKEIKRQT  120

Query  452  LLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPA  622
            LL+L D+VAS   K +E AI  V +M +VN+FR   P+   +   ++   E+EE   DPA
Sbjct  121  LLDLVDYVASPGGKFSEMAIQEVVKMVSVNIFRTLNPQPRENKVIDALDLEEEEPSMDPA  180

Query  623  WYHLQLVY  646
            W HLQLVY
Sbjct  181  WPHLQLVY  188



>gb|KDO52091.1| hypothetical protein CISIN_1g0107851mg, partial [Citrus sinensis]
Length=382

 Score =   112 bits (281),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 107/205 (52%), Gaps = 22/205 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGN-----GMQFTNSCNVIANRLNVV  253
            M+KQIL K PRK  KS      G    S +  + +       G ++ N  NV  + +N V
Sbjct  1    MIKQILNKFPRKPSKSSDYREGGGTSTSSSHASANSRNSDLAGNRYANPSNVSNSAINSV  60

Query  254  KRVS---SAIFPASI--------VAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYD  400
              V       FP ++        +A  E++     FKDV N EKQ L V KLNLCC V+D
Sbjct  61   ANVGVNHGNKFPQAVNSKLNGNPLAYYEALP---SFKDVPNAEKQNLFVRKLNLCCVVFD  117

Query  401  FGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCAS  574
            F DP KN  EKD+KRQ L+EL D+V+S + K  E  +  + +M + NLFR    PP+   
Sbjct  118  FTDPTKNLKEKDIKRQTLVELVDYVSSANGKFPEVVMQEMVKMVSANLFRTLTSPPRENK  177

Query  575  HARG-ESEDEELFFDPAWYHLQLVY  646
                 + E+EE   DPAW HLQ+VY
Sbjct  178  VLEAFDLEEEEPSMDPAWPHLQVVY  202



>gb|AHE76186.1| protein phosphatase 2a [Chrysanthemum indicum]
Length=505

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F++V + EKQ L + K+N+CC ++DF DP KN  EK++KRQ LLEL DFVAS +VK TES
Sbjct  84   FREVPSSEKQNLFIKKVNMCCVIFDFTDPTKNLKEKEIKRQTLLELVDFVASSNVKFTES  143

Query  506  AIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
             +    +M + NLFR+  P+       +S   E+EE   DPAW HLQ+VY
Sbjct  144  VMQEFVKMVSANLFRELTPQPRDSKVLDSYDVEEEEPSMDPAWPHLQIVY  193



>ref|XP_004304704.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Fragaria vesca subsp. 
vesca]
Length=522

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 74/110 (67%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KLNLCC V+DF DP KN  EKD+KRQ L+EL D++AS + K +ES
Sbjct  90   FKDVPNSEKQNLCIKKLNLCCYVFDFTDPTKNLKEKDIKRQTLVELVDYIASANGKFSES  149

Query  506  AIAAVCRMCAVNLFRDF---PPKCASHARGESEDEELFFDPAWYHLQLVY  646
             I  + +M ++NLFR F   P +  +    + E++E   DPAW HLQ+VY
Sbjct  150  VIQELVKMVSINLFRTFTSPPHENRALEAFDLEEDEPSMDPAWPHLQVVY  199



>ref|XP_008441374.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Cucumis melo]
 gb|ADN34067.1| protein phosphatase 2a [Cucumis melo subsp. melo]
Length=524

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 108/205 (53%), Gaps = 22/205 (11%)
 Frame = +2

Query  89   MLKQILAKIPRk-slksdsldssGAQPNSCNDPT-------------NSGNGMQFTNSCN  226
            M+KQIL ++PRK S  ++  + +G   +S N  T             N+G G  F+   +
Sbjct  1    MIKQILNRLPRKPSKSTEHREGAGTTISSSNASTSLRSNDLAANHHANTGTG-SFSGPNS  59

Query  227  VIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             ++  LN   + S  +   S      S      FKDV N EKQ L + KLN+CC V+DF 
Sbjct  60   TLSVGLNHGSKPSQGLNSKSNGNSQVSYEALPGFKDVPNSEKQSLFIKKLNMCCVVFDFT  119

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG  586
            DP KN  EKD+KRQ L+EL D+VAS + K +E+ I  + +M + NLFR   P   S    
Sbjct  120  DPSKNLKEKDIKRQTLIELVDYVASANGKLSENVIQEIVKMVSSNLFRT--PTIPSRDNK  177

Query  587  -----ESEDEELFFDPAWYHLQLVY  646
                 + E+EE   DPAW HLQ+VY
Sbjct  178  ALEAFDLEEEEPSMDPAWPHLQVVY  202



>ref|XP_004138464.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine protein phosphatase 
2A 59 kDa regulatory subunit B' eta isoform-like [Cucumis 
sativus]
Length=524

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 108/205 (53%), Gaps = 22/205 (11%)
 Frame = +2

Query  89   MLKQILAKIPRk-slksdsldssGAQPNSCNDPT-------------NSGNGMQFTNSCN  226
            M+KQIL ++PRK S  ++  + +G   +S N  T             N+G G  F+   +
Sbjct  1    MIKQILNRLPRKPSKSTEHREGAGTTISSSNASTSLRSNDLAANHHANTGTG-SFSGPNS  59

Query  227  VIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             ++  LN   + S  +   S      S      FKDV N EKQ L + KLN+CC V+DF 
Sbjct  60   TLSVGLNHGSKPSQGLNSKSNGNSQVSYEALPGFKDVPNSEKQSLFIKKLNMCCVVFDFT  119

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG  586
            DP KN  EKD+KRQ L+EL D+VAS + K +E+ I  + +M + NLFR   P   S    
Sbjct  120  DPSKNLKEKDIKRQTLIELVDYVASANGKLSENVIQEIVKMVSSNLFRT--PTIPSRDNK  177

Query  587  -----ESEDEELFFDPAWYHLQLVY  646
                 + E+EE   DPAW HLQ+VY
Sbjct  178  ALEAFDLEEEEPSMDPAWPHLQVVY  202



>gb|KGN45729.1| hypothetical protein Csa_6G008600 [Cucumis sativus]
Length=524

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 108/205 (53%), Gaps = 22/205 (11%)
 Frame = +2

Query  89   MLKQILAKIPRk-slksdsldssGAQPNSCNDPT-------------NSGNGMQFTNSCN  226
            M+KQIL ++PRK S  ++  + +G   +S N  T             N+G G  F+   +
Sbjct  1    MIKQILNRLPRKPSKSTEHREGAGTTISSSNASTSLRSNDLAANHHANTGTG-SFSGPNS  59

Query  227  VIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFG  406
             ++  LN   + S  +   S      S      FKDV N EKQ L + KLN+CC V+DF 
Sbjct  60   TLSVGLNHGSKPSQGLNSKSNGNSQVSYEALPGFKDVPNSEKQSLFIKKLNMCCVVFDFT  119

Query  407  DPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARG  586
            DP KN  EKD+KRQ L+EL D+VAS + K +E+ I  + +M + NLFR   P   S    
Sbjct  120  DPSKNLKEKDIKRQTLIELVDYVASANGKLSENVIQEIVKMVSSNLFRT--PTIPSRDNK  177

Query  587  -----ESEDEELFFDPAWYHLQLVY  646
                 + E+EE   DPAW HLQ+VY
Sbjct  178  ALEAFDLEEEEPSMDPAWPHLQVVY  202



>ref|XP_006650885.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like [Oryza brachyantha]
Length=517

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 108/198 (55%), Gaps = 15/198 (8%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL + P+K  KS   D +G   +S  +P     G + +++   ++++  V+     
Sbjct  1    MIKQILGRFPKKPSKSGDKDPTGRPSSSVPNPPLGPRGAERSSN---LSSQPPVISSSGL  57

Query  269  AIFPASIVAG------GESISPHL----CFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
            +      V        G+ + P +     FKDV N EK  L V KLNLCC+ +DF DP K
Sbjct  58   SYGSGMHVGNTNSKLNGKLVQPTVELLPSFKDVPNTEKNNLFVKKLNLCCATFDFTDPTK  117

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCASHARGES  592
            +  EK++KRQ LLEL D++AS + K  E  +  + RM +VNLFR    PP+ +     + 
Sbjct  118  SVKEKEIKRQTLLELVDYIASANGKFPELTMQELTRMVSVNLFRTLTTPPRESKIEAFDL  177

Query  593  EDEELFFDPAWYHLQLVY  646
            ++EE   DPAW HLQ+VY
Sbjct  178  DEEEPVMDPAWSHLQIVY  195



>ref|NP_001059361.1| Os07g0274800 [Oryza sativa Japonica Group]
 dbj|BAC84389.1| putative protein phosphatase PP2A0 B' subunit gamma isoform [Oryza 
sativa Japonica Group]
 dbj|BAF21275.1| Os07g0274800 [Oryza sativa Japonica Group]
 dbj|BAG91016.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81852.1| hypothetical protein OsI_25621 [Oryza sativa Indica Group]
 gb|EEE66955.1| hypothetical protein OsJ_23826 [Oryza sativa Japonica Group]
Length=517

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 72/117 (62%), Gaps = 3/117 (3%)
 Frame = +2

Query  305  SISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASG  484
            S  P   FKDV N EKQ LL+ KL LCC V+DF DP KN  EK++K Q LLE+ D+V S 
Sbjct  79   SFQPLPSFKDVPNSEKQNLLIRKLKLCCIVFDFTDPTKNIQEKEMKSQTLLEIVDYVVSA  138

Query  485  SVKCTESAIAAVCRMCAVNLFRDF--PPKCASHARG-ESEDEELFFDPAWYHLQLVY  646
            +VK  E  +  + RM + NLFR    PP+     +  + E++E   DPAW HLQ+VY
Sbjct  139  TVKFPEIVMLEITRMISANLFRTLISPPREKKVLQAFDLEEDEAVMDPAWSHLQIVY  195



>ref|XP_006469972.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Citrus sinensis]
Length=501

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 107/205 (52%), Gaps = 22/205 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGN-----GMQFTNSCNVIANRLNVV  253
            M+KQIL K PRK  KS      G    S +  + +       G ++ N  NV  + +N V
Sbjct  1    MIKQILNKFPRKPSKSSDYREGGGTSTSSSHASANSRNSDLAGNRYANPSNVSNSAINSV  60

Query  254  KRV---SSAIFPASI--------VAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYD  400
              V       FP ++        +A  E++     FKDV N EKQ L V KLNLCC V+D
Sbjct  61   ANVGVNHGNKFPQAVNSKLNGNPLAYYEALP---SFKDVPNAEKQNLFVRKLNLCCVVFD  117

Query  401  FGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCAS  574
            F DP KN  EKD+KRQ L+EL D+V+S + K  E  +  + +M + NLFR    PP+   
Sbjct  118  FTDPTKNLKEKDIKRQTLVELVDYVSSANGKFQEVVMQEMVKMVSANLFRTLTSPPRENK  177

Query  575  HARG-ESEDEELFFDPAWYHLQLVY  646
                 + E+EE   DPAW HLQ+VY
Sbjct  178  VLEAFDLEEEEPSMDPAWPHLQVVY  202



>gb|EPS71994.1| hypothetical protein M569_02763, partial [Genlisea aurea]
Length=431

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 74/110 (67%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV + EKQ L V K+ +CC V+DF DP KN  EK++KRQ LLEL DFVA+ + K +E+
Sbjct  8    FRDVHSSEKQQLFVRKVKMCCVVFDFTDPTKNIKEKEIKRQTLLELVDFVATANGKFSET  67

Query  506  AIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
            AI  V +M +VN+FR F P+   +   +    E+EE   DPAW HLQ+VY
Sbjct  68   AIQEVVKMVSVNIFRVFTPQPRENKLIDGVDLEEEEPAMDPAWPHLQVVY  117



>ref|NP_001146165.1| hypothetical protein [Zea mays]
 gb|ACL53388.1| unknown [Zea mays]
 gb|AFW61329.1| hypothetical protein ZEAMMB73_791311 [Zea mays]
Length=502

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/207 (38%), Positives = 104/207 (50%), Gaps = 31/207 (15%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPN------------------SCNDPTNSGNGMQFT  214
            M+KQIL ++P+K  KS   + +GA P+                      P+N  +     
Sbjct  1    MIKQILGRLPKKQAKSGEKELAGAGPSLPSPTADTRTTTDLTTSSRLVSPSNYASTATNQ  60

Query  215  NSCNVIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSV  394
                V A    V     S  FPAS  AG E++     F+DV   EK GL + KL +CC V
Sbjct  61   GQSFVAARAAGV-----SNGFPAS--AGYEALP---SFRDVPAPEKPGLFLRKLAMCCVV  110

Query  395  YDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS  574
            +DF DP K+A EK++KRQ LLEL D++ S + K  E  +  V RM + NLFR  PP    
Sbjct  111  FDFADPTKDAREKEVKRQTLLELVDYITSATGKFPEHVVPEVIRMVSANLFRVPPPAPRE  170

Query  575  HARGE---SEDEELFFDPAWYHLQLVY  646
            +   E    E+EE   DPAW HLQ+VY
Sbjct  171  NKALELFDMEEEEPVMDPAWPHLQIVY  197



>gb|KDO52090.1| hypothetical protein CISIN_1g0107851mg [Citrus sinensis]
Length=413

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 107/205 (52%), Gaps = 22/205 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGN-----GMQFTNSCNVIANRLNVV  253
            M+KQIL K PRK  KS      G    S +  + +       G ++ N  NV  + +N V
Sbjct  1    MIKQILNKFPRKPSKSSDYREGGGTSTSSSHASANSRNSDLAGNRYANPSNVSNSAINSV  60

Query  254  KRVS---SAIFPASI--------VAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYD  400
              V       FP ++        +A  E++     FKDV N EKQ L V KLNLCC V+D
Sbjct  61   ANVGVNHGNKFPQAVNSKLNGNPLAYYEALP---SFKDVPNAEKQNLFVRKLNLCCVVFD  117

Query  401  FGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCAS  574
            F DP KN  EKD+KRQ L+EL D+V+S + K  E  +  + +M + NLFR    PP+   
Sbjct  118  FTDPTKNLKEKDIKRQTLVELVDYVSSANGKFPEVVMQEMVKMVSANLFRTLTSPPRENK  177

Query  575  HARG-ESEDEELFFDPAWYHLQLVY  646
                 + E+EE   DPAW HLQ+VY
Sbjct  178  VLEAFDLEEEEPSMDPAWPHLQVVY  202



>ref|XP_010228178.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Brachypodium 
distachyon]
Length=449

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = +2

Query  305  SISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASG  484
            S  P   FKDV + +KQ LL+ KLNLCC V+DF DP KN  EK++KRQ LLEL D+VAS 
Sbjct  79   SFEPLPSFKDVPSTKKQHLLIRKLNLCCVVFDFTDPTKNIKEKEIKRQTLLELVDYVASA  138

Query  485  SVKCTESAIAAVCRMCAVNLFRDF--PPKCASHARG-ESEDEELFFDPAWYHLQLVY  646
            + K  E  +  +  M +VNLFR    PP+        + EDEE   DPAW HLQ+VY
Sbjct  139  NGKFPEIVMQEITVMVSVNLFRTLTSPPREKKVLEAFDLEDEEAVTDPAWSHLQIVY  195



>ref|XP_010228176.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Brachypodium 
distachyon]
 ref|XP_010228177.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Brachypodium 
distachyon]
Length=517

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 73/117 (62%), Gaps = 3/117 (3%)
 Frame = +2

Query  305  SISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASG  484
            S  P   FKDV + +KQ LL+ KLNLCC V+DF DP KN  EK++KRQ LLEL D+VAS 
Sbjct  79   SFEPLPSFKDVPSTKKQHLLIRKLNLCCVVFDFTDPTKNIKEKEIKRQTLLELVDYVASA  138

Query  485  SVKCTESAIAAVCRMCAVNLFRDF--PPKCASHARG-ESEDEELFFDPAWYHLQLVY  646
            + K  E  +  +  M +VNLFR    PP+        + EDEE   DPAW HLQ+VY
Sbjct  139  NGKFPEIVMQEITVMVSVNLFRTLTSPPREKKVLEAFDLEDEEAVTDPAWSHLQIVY  195



>ref|XP_002514974.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
 gb|EEF47528.1| protein phosphatase 2a, regulatory subunit, putative [Ricinus 
communis]
Length=527

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 71/110 (65%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EKQ L + KLNLCC V+DF DP KN  EK++KRQ LLEL D+V S + K +E+
Sbjct  96   FRDVPNSEKQNLFIRKLNLCCFVFDFTDPTKNLKEKEIKRQTLLELVDYVTSANAKFSET  155

Query  506  AIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
             +  V +M + NLFR   P+   +   +    E+EE   DPAW HLQLVY
Sbjct  156  VMQEVIKMVSTNLFRILTPQPRENKIIDGVDLEEEEPSMDPAWPHLQLVY  205



>ref|XP_009772668.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
 ref|XP_009772669.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
 ref|XP_009772670.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Nicotiana sylvestris]
Length=524

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 85/147 (58%), Gaps = 12/147 (8%)
 Frame = +2

Query  215  NSCNVIANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSV  394
            N  N +   +N     ++A+FP   +           FKDV + EKQ L + KLNLCC +
Sbjct  65   NHGNRLPQSVNAKVNGNAAVFPCETLPS---------FKDVPSSEKQNLFIKKLNLCCVL  115

Query  395  YDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCAS  574
            +DF DP K+  EKD+KRQ L+EL D+V+S + K TE+ I  + +M + NLFR   P+   
Sbjct  116  FDFTDPTKHLKEKDIKRQTLVELVDYVSSANGKFTETVIQEIVKMVSSNLFRPLTPQPRE  175

Query  575  HARGES---EDEELFFDPAWYHLQLVY  646
            +   E+   E++E   DPAW HLQ+VY
Sbjct  176  NKVLEAFDLEEDEPLMDPAWPHLQIVY  202



>ref|XP_010111637.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
 gb|EXC31382.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
Length=525

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 112/208 (54%), Gaps = 27/208 (13%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPN--------------SCNDPTNSG----NGMQFT  214
            M+KQ+L K+P+K  KS      G                  + N   N G    +G+  T
Sbjct  1    MIKQLLNKLPKKPSKSAENREGGGTSTSSSNANNNSRSGDLASNRHGNPGGPSLSGLNST  60

Query  215  NSCNV-IANRLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCS  391
            +S  V   N+LN  + V+S +   ++ +  E++     F+DV N EKQ L + KLNLCC 
Sbjct  61   SSLGVNYGNKLN--QAVNSKLNGNTLASSYEALP---SFRDVPNSEKQNLFIKKLNLCCV  115

Query  392  VYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPK  565
            ++DF DP KN  EKD+KRQ L+EL D++AS + K  E+ +  + +M + NLFR    PP+
Sbjct  116  LFDFTDPVKNLKEKDIKRQTLVELVDYIASANGKFPEAVLQEIVKMVSANLFRTLTSPPR  175

Query  566  -CASHARGESEDEELFFDPAWYHLQLVY  646
               +    + EDEE   DPAW HLQ+VY
Sbjct  176  ENKALETFDVEDEEPSMDPAWPHLQVVY  203



>ref|XP_006447169.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 ref|XP_006447170.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 ref|XP_006469971.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Citrus sinensis]
 gb|ESR60409.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
 gb|ESR60410.1| hypothetical protein CICLE_v10014898mg [Citrus clementina]
Length=524

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 107/205 (52%), Gaps = 22/205 (11%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGN-----GMQFTNSCNVIANRLNVV  253
            M+KQIL K PRK  KS      G    S +  + +       G ++ N  NV  + +N V
Sbjct  1    MIKQILNKFPRKPSKSSDYREGGGTSTSSSHASANSRNSDLAGNRYANPSNVSNSAINSV  60

Query  254  KRV---SSAIFPASI--------VAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYD  400
              V       FP ++        +A  E++     FKDV N EKQ L V KLNLCC V+D
Sbjct  61   ANVGVNHGNKFPQAVNSKLNGNPLAYYEALP---SFKDVPNAEKQNLFVRKLNLCCVVFD  117

Query  401  FGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCAS  574
            F DP KN  EKD+KRQ L+EL D+V+S + K  E  +  + +M + NLFR    PP+   
Sbjct  118  FTDPTKNLKEKDIKRQTLVELVDYVSSANGKFQEVVMQEMVKMVSANLFRTLTSPPRENK  177

Query  575  HARG-ESEDEELFFDPAWYHLQLVY  646
                 + E+EE   DPAW HLQ+VY
Sbjct  178  VLEAFDLEEEEPSMDPAWPHLQVVY  202



>gb|KJB42861.1| hypothetical protein B456_007G171000 [Gossypium raimondii]
 gb|KJB42862.1| hypothetical protein B456_007G171000 [Gossypium raimondii]
Length=518

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV + EKQ LL+ KLN+CC V+DF DP KN  EKD+K+Q LLEL D+++S + K  E 
Sbjct  74   FRDVPSTEKQILLLKKLNMCCVVFDFSDPTKNLREKDIKKQTLLELVDYISSVTSKFNEL  133

Query  506  AIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
            A+  + RM + NLFR FP     +   E    EDEE   DPAW HLQ+VY
Sbjct  134  AVQEMTRMVSANLFRTFPSPNHDNKLLEIYDLEDEEPAMDPAWPHLQIVY  183



>ref|XP_001758786.1| predicted protein [Physcomitrella patens]
 gb|EDQ76292.1| predicted protein [Physcomitrella patens]
Length=526

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV   ++Q L V KL LCC  +DF DP  +  EK++KRQ+LLEL D+V SGS K TE+
Sbjct  80   FRDVPTSDRQNLFVRKLALCCRTFDFTDPTMDVKEKEIKRQMLLELVDYVTSGSGKFTEA  139

Query  506  AIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
                + RM A NLFR  PP    +   ES   E+EE   +PAW HLQ+VY
Sbjct  140  VFEDITRMLAANLFRTLPPSSHENKGSESFDAEEEEPTMEPAWPHLQIVY  189



>ref|XP_004239176.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Solanum lycopersicum]
Length=502

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 73/109 (67%), Gaps = 2/109 (2%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            F+DV N EKQ L + KLN+CC ++DF DP KN  EK++KRQ LLEL ++V S +VK TE 
Sbjct  75   FRDVPNAEKQNLFIRKLNMCCVLFDFTDPTKNLKEKEIKRQTLLELVEYVTSANVKFTEV  134

Query  506  AIAAVCRMCAVNLFRDFPPKCASHAR--GESEDEELFFDPAWYHLQLVY  646
             + AV +M + NLFR+  P+   +     + E++E   DP+W HLQ+VY
Sbjct  135  VMQAVVKMVSTNLFRELMPQPRENKTLAFDVEEDEPAMDPSWPHLQIVY  183



>gb|AFW58632.1| hypothetical protein ZEAMMB73_760675 [Zea mays]
Length=470

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 80/135 (59%), Gaps = 6/135 (4%)
 Frame = +2

Query  260  VSSAIFPASIVAGG---ESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAE  430
            V S + P  ++ G     S  P   FKDV   EKQ L V K++LCC+VYDF DP KN  E
Sbjct  15   VPSGVIPNPVMNGAVVYHSNEPLPAFKDVPMSEKQNLFVKKVSLCCAVYDFVDPTKNLKE  74

Query  431  KDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDE  601
            K++KRQ L+EL D+VAS + K +E  +  + +M ++NLFR   P    +   E    E++
Sbjct  75   KEVKRQTLMELVDYVASANGKFSEVVMLEITKMVSINLFRSSSPTPRENKAIEGVDLEED  134

Query  602  ELFFDPAWYHLQLVY  646
            E   DPAW HLQ+VY
Sbjct  135  EPLMDPAWSHLQIVY  149



>emb|CDX98102.1| BnaA06g08530D [Brassica napus]
Length=463

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KL+LCC ++DF DP KN  EK++KRQ LLEL D+VA+ + K +ES
Sbjct  46   FKDVPNAEKQTLFLKKLSLCCVLFDFSDPSKNVKEKEIKRQTLLELVDYVATANGKFSES  105

Query  506  AIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
             I    RM +VN+FR   P+   +   ++   E+EE   DP+W HLQLVY
Sbjct  106  VIQEAVRMVSVNIFRTLNPQPRENKVIDALDLEEEEPSMDPSWPHLQLVY  155



>emb|CDX90593.1| BnaA03g41880D [Brassica napus]
Length=464

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 96/192 (50%), Gaps = 37/192 (19%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQI  K+P+K+              S + P   G G+   ++    +NR N V     
Sbjct  1    MIKQIFGKLPKKTS------------KSSSHPNGEGGGVNPHHTPPPTSNRPNGV-----  43

Query  269  AIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQ  448
                           P   F+DV   EK  L + KL +CC ++DF DP KN  EK+ KRQ
Sbjct  44   -------------YEPLPSFRDVPASEKPTLFIKKLTMCCVLFDFTDPSKNLREKETKRQ  90

Query  449  VLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGESE------DEELF  610
             LL+L D++A+   K T++A+  + ++ A+NLFR F P  A+H     E      DEEL 
Sbjct  91   TLLDLVDYIATVPTKFTDAAMQEIAKLAAINLFRTF-PTAANHESKVLETLDGNDDEELA  149

Query  611  FDPAWYHLQLVY  646
             +PAW HLQLVY
Sbjct  150  LEPAWPHLQLVY  161



>ref|XP_008230444.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like [Prunus mume]
Length=516

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KLNLCC ++DF DP KN  EKD+KRQ L+EL D++AS + K +E+
Sbjct  85   FKDVPNAEKQNLFIKKLNLCCVIFDFSDPTKNLKEKDIKRQTLVELVDYIASANGKFSET  144

Query  506  AIAAVCRMCAVNLFRDF---PPKCASHARGESEDEELFFDPAWYHLQLVY  646
             +  + +M  VNLFR     P +  +    + E+EE   DPAW HLQ+VY
Sbjct  145  VMQEIVKMVCVNLFRTLTSPPLENKALEAFDLEEEEPSMDPAWPHLQVVY  194



>ref|XP_007215087.1| hypothetical protein PRUPE_ppa004318mg [Prunus persica]
 gb|EMJ16286.1| hypothetical protein PRUPE_ppa004318mg [Prunus persica]
Length=516

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KLNLCC ++DF DP KN  EKD+KRQ L+EL D++AS + K +E+
Sbjct  85   FKDVPNAEKQNLFIKKLNLCCVIFDFSDPTKNLKEKDIKRQTLVELVDYIASANGKFSET  144

Query  506  AIAAVCRMCAVNLFRDF---PPKCASHARGESEDEELFFDPAWYHLQLVY  646
             +  + +M  VNLFR     P +  +    + E+EE   DPAW HLQ+VY
Sbjct  145  VMQEIVKMVCVNLFRTLTSPPLENKALEAFDLEEEEPSMDPAWPHLQVVY  194



>ref|XP_006338659.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X1 [Solanum tuberosum]
 ref|XP_006338660.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X2 [Solanum tuberosum]
 ref|XP_006338661.1| PREDICTED: serine/threonine protein phosphatase 2A 59 kDa regulatory 
subunit B' eta isoform-like isoform X3 [Solanum tuberosum]
Length=520

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 72/110 (65%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV   EKQ L + KLNLCC ++DF DP K+  EKD+KRQ L+EL D+++S +VK TE+
Sbjct  89   FKDVPTAEKQTLFIKKLNLCCVLFDFTDPTKHLKEKDIKRQTLVELVDYISSVNVKFTET  148

Query  506  AIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPAWYHLQLVY  646
             I  + +M + NLFR    +   +   E+   ED+E   DPAW HLQ+VY
Sbjct  149  VIQEIVKMVSSNLFRPLTSQPRENKVLEAFDLEDDEPLMDPAWSHLQIVY  198



>ref|XP_010100283.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
 gb|EXB82417.1| Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit 
B' eta isoform [Morus notabilis]
Length=515

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 106/199 (53%), Gaps = 19/199 (10%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCND----PTNSGN-GMQFT-----NSCNVIAN  238
            M KQIL+K+PRKS KS     S +   S          SGN G  +      N+ N  A 
Sbjct  1    MFKQILSKLPRKSSKSVENRDSSSASTSSRSGELGTRKSGNLGANYALEVGQNNGNKNAR  60

Query  239  RLNVVKRVSSAIFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDK  418
              NV  R +   FP S      S      F+DV + E+Q LL+ KLNLCC V+D+ DP K
Sbjct  61   IANVKSRPNG--FPVS----SSSYEALPAFRDVPSSERQSLLIKKLNLCCVVFDYTDPTK  114

Query  419  NAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES--  592
            +  EK++KRQ LLEL D++ S + K +E+ +    +M + NLFR F P+   H   E   
Sbjct  115  HLKEKEIKRQTLLELVDYLTSSNGKFSETVMQEGIKMVSANLFRSFTPQLREHKVVEGFD  174

Query  593  -EDEELFFDPAWYHLQLVY  646
             E+EE   DPAW HLQ+VY
Sbjct  175  LEEEEPSMDPAWSHLQIVY  193



>ref|XP_009411828.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411829.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KL+LC  V+DF DP KN  EKD+KRQ LLEL D+V+S S K  E+
Sbjct  90   FKDVPNSEKQILFMRKLDLCSVVFDFTDPSKNLKEKDIKRQTLLELVDYVSSASGKFPET  149

Query  506  AIAAVCRMCAVNLFRDF--PPK-CASHARGESEDEELFFDPAWYHLQLVY  646
             +    +M ++NLFR+   PP+      + ++E+EE   DPAW HLQ+VY
Sbjct  150  VMQETTKMVSINLFRNLTIPPREHMVLEKIDAEEEEPVMDPAWTHLQIVY  199



>ref|XP_009411830.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KL+LC  V+DF DP KN  EKD+KRQ LLEL D+V+S S K  E+
Sbjct  90   FKDVPNSEKQILFMRKLDLCSVVFDFTDPSKNLKEKDIKRQTLLELVDYVSSASGKFPET  149

Query  506  AIAAVCRMCAVNLFRDF--PPK-CASHARGESEDEELFFDPAWYHLQLVY  646
             +    +M ++NLFR+   PP+      + ++E+EE   DPAW HLQ+VY
Sbjct  150  VMQETTKMVSINLFRNLTIPPREHMVLEKIDAEEEEPVMDPAWTHLQIVY  199



>ref|XP_006386782.1| hypothetical protein POPTR_0002s21550g [Populus trichocarpa]
 gb|ABK95558.1| unknown [Populus trichocarpa]
 gb|ERP64579.1| hypothetical protein POPTR_0002s21550g [Populus trichocarpa]
Length=541

 Score =   112 bits (280),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 110/228 (48%), Gaps = 61/228 (27%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVI------------  232
            M+KQIL K+PRK           ++P+S ND  N G G+   +S N              
Sbjct  1    MIKQILGKLPRK----------PSKPSS-NDSNNDG-GLHAYSSLNSSNGPSSINNSKLS  48

Query  233  ------------ANRLNVVKRVSSAIFPASIVAGGESISPHL-------------CFKDV  337
                        A+RLN     + ++ P S    G+  +P L              F+DV
Sbjct  49   SNSSKSLNPSSGASRLN-----NGSLVPNSKGNQGKKSAPQLDPLMTSGVYEALPSFRDV  103

Query  338  SNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTESAIAA  517
             N EK  L + KLN+CC V+DF DP KN  EKD+KRQ L EL D++++ + K  E A+  
Sbjct  104  PNSEKHNLFMKKLNMCCVVFDFSDPSKNLKEKDIKRQTLHELLDYISTVTSKFNEIAMQE  163

Query  518  VCRMCAVNLFRDFPPKCASHARG-----ESEDEELFFDPAWYHLQLVY  646
            + RM A NLFR  P    +H +      + EDEE   +PAW HLQ+VY
Sbjct  164  ITRMVAANLFRTLP--SMNHDKKILEMFDPEDEEPAMEPAWPHLQIVY  209



>ref|XP_009411832.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=513

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = +2

Query  326  FKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQVLLELNDFVASGSVKCTES  505
            FKDV N EKQ L + KL+LC  V+DF DP KN  EKD+KRQ LLEL D+V+S S K  E+
Sbjct  90   FKDVPNSEKQILFMRKLDLCSVVFDFTDPSKNLKEKDIKRQTLLELVDYVSSASGKFPET  149

Query  506  AIAAVCRMCAVNLFRDF--PPK-CASHARGESEDEELFFDPAWYHLQLVY  646
             +    +M ++NLFR+   PP+      + ++E+EE   DPAW HLQ+VY
Sbjct  150  VMQETTKMVSINLFRNLTIPPREHMVLEKIDAEEEEPVMDPAWTHLQIVY  199



>emb|CDY48287.1| BnaC01g31410D [Brassica napus]
Length=496

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 99/188 (53%), Gaps = 23/188 (12%)
 Frame = +2

Query  92   LKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSSA  271
            +KQI  K+P+K+ KS + +  G      + P+NS       N+ N               
Sbjct  1    MKQIFGKLPKKTSKSSNPNVEGHHVPPSSKPSNS-------NAPN-------------GT  40

Query  272  IFPASIVAGGESISPHLCFKDVSNGEKQGLLVSKLNLCCSVYDFGDPDKNAAEKDLKRQV  451
            I P+S  A          F+DV   EK  L + KL LCC V+DF DP KN  EK++KRQ 
Sbjct  41   IAPSSNRATNGVFEALPSFRDVPTSEKPNLFIKKLTLCCVVFDFTDPSKNLREKEIKRQT  100

Query  452  LLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDFPPKCASHARGES---EDEELFFDPA  622
            LLEL D++++ S K T++A+  + ++  VNLFR+FP         E+   +DEE   +PA
Sbjct  101  LLELVDYISTVSTKFTDAAMQEIAKLAVVNLFREFPSANQESKILETLDGDDEEPALEPA  160

Query  623  WYHLQLVY  646
            W HLQ+VY
Sbjct  161  WPHLQVVY  168



>ref|XP_008799952.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Phoenix dactylifera]
 ref|XP_008799954.1| PREDICTED: serine/threonine protein phosphatase 2A 57 kDa regulatory 
subunit B' theta isoform-like isoform X1 [Phoenix dactylifera]
Length=519

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/200 (38%), Positives = 106/200 (53%), Gaps = 17/200 (9%)
 Frame = +2

Query  89   MLKQILAKIPRkslksdsldssGAQPNSCNDPTNSGNGMQFTNSCNVIANRLNVVKRVSS  268
            M+KQIL ++PRK  KS      G    S N   NS    + +    V+     V+  ++ 
Sbjct  1    MIKQILGRLPRKPSKSADNR--GQSGGSANSLPNSSTSSR-SGDLPVVGLNSQVLPGLNQ  57

Query  269  AI-----FPASIVA--GGESISPHL----CFKDVSNGEKQGLLVSKLNLCCSVYDFGDPD  415
             +     +P +I +   G S+S        F+DV N EKQ L + KLNLC  V++F DP 
Sbjct  58   GLNHGSKYPPAINSKLNGNSVSLSYEALPSFRDVPNSEKQNLFIKKLNLCSVVFNFTDPT  117

Query  416  KNAAEKDLKRQVLLELNDFVASGSVKCTESAIAAVCRMCAVNLFRDF--PPKCASHARG-  586
            KN  EKD+KRQ LLEL D+V S + K  E+ +  + RM ++NLFR    PP+        
Sbjct  118  KNLKEKDVKRQTLLELVDYVTSANGKFPENIMQEIIRMVSINLFRSLTSPPRENKVLEAF  177

Query  587  ESEDEELFFDPAWYHLQLVY  646
            + E+EE   DPAW HLQ+VY
Sbjct  178  DLEEEEAVMDPAWPHLQIVY  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625