BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF042J15

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361420.1|  PREDICTED: uncharacterized protein R102.4 is...    275   5e-88   Solanum tuberosum [potatoes]
ref|XP_009631531.1|  PREDICTED: probable low-specificity L-threon...    275   7e-88   
ref|XP_009798339.1|  PREDICTED: probable low-specificity L-threon...    275   7e-88   Nicotiana sylvestris
ref|XP_010319280.1|  PREDICTED: probable low-specificity L-threon...    274   2e-87   Solanum lycopersicum
ref|NP_001275261.1|  L-allo-threonine aldolase-related protein          273   3e-87   Solanum tuberosum [potatoes]
ref|XP_004236787.1|  PREDICTED: probable low-specificity L-threon...    272   1e-86   Solanum lycopersicum
ref|XP_011101617.1|  PREDICTED: probable low-specificity L-threon...    262   6e-83   Sesamum indicum [beniseed]
gb|EPS60604.1|  hypothetical protein M569_14199                         259   4e-82   Genlisea aurea
ref|XP_008456444.1|  PREDICTED: probable low-specificity L-threon...    259   1e-81   Cucumis melo [Oriental melon]
gb|EYU19887.1|  hypothetical protein MIMGU_mgv1a008896mg                259   1e-81   Erythranthe guttata [common monkey flower]
gb|KDO44518.1|  hypothetical protein CISIN_1g0182432mg                  253   2e-81   Citrus sinensis [apfelsine]
ref|XP_006442684.1|  hypothetical protein CICLE_v10020798mg             255   5e-81   
gb|AGI05087.1|  threonine aldolase                                      254   1e-80   Gossypium aridum
ref|XP_004139254.1|  PREDICTED: L-allo-threonine aldolase-like          256   1e-80   Cucumis sativus [cucumbers]
ref|XP_004170828.1|  PREDICTED: L-allo-threonine aldolase-like          256   1e-80   
ref|XP_006487715.1|  PREDICTED: uncharacterized protein R102.4-li...    256   1e-80   Citrus sinensis [apfelsine]
ref|XP_008388713.1|  PREDICTED: probable low-specificity L-threon...    256   1e-80   
gb|KHG00003.1|  ltaA                                                    255   2e-80   Gossypium arboreum [tree cotton]
gb|KHG00004.1|  ltaA                                                    256   3e-80   Gossypium arboreum [tree cotton]
ref|XP_002325334.2|  L-allo-threonine aldolase-related family pro...    256   3e-80   Populus trichocarpa [western balsam poplar]
ref|XP_011038517.1|  PREDICTED: LOW QUALITY PROTEIN: probable low...    255   3e-80   Populus euphratica
ref|XP_006442676.1|  hypothetical protein CICLE_v10020798mg             255   4e-80   Citrus clementina [clementine]
gb|KCW61514.1|  hypothetical protein EUGRSUZ_H04236                     250   5e-80   Eucalyptus grandis [rose gum]
gb|KCW61513.1|  hypothetical protein EUGRSUZ_H04236                     251   5e-80   Eucalyptus grandis [rose gum]
ref|XP_002319106.2|  L-allo-threonine aldolase-related family pro...    254   7e-80   
gb|KCW61508.1|  hypothetical protein EUGRSUZ_H04236                     254   8e-80   Eucalyptus grandis [rose gum]
ref|XP_009795458.1|  PREDICTED: probable low-specificity L-threon...    254   9e-80   Nicotiana sylvestris
gb|KCW61512.1|  hypothetical protein EUGRSUZ_H04236                     251   9e-80   Eucalyptus grandis [rose gum]
ref|XP_007030425.1|  Threonine aldolase 1 isoform 6                     252   2e-79   
ref|XP_007030422.1|  Threonine aldolase 1 isoform 3                     253   4e-79   
ref|XP_007030420.1|  Threonine aldolase 1 isoform 1                     252   5e-79   
ref|XP_007030424.1|  Threonine aldolase 1 isoform 5                     252   6e-79   
gb|KDP40730.1|  hypothetical protein JCGZ_24729                         245   6e-79   Jatropha curcas
gb|KJB44862.1|  hypothetical protein B456_007G276400                    254   6e-79   Gossypium raimondii
gb|ACJ85466.1|  unknown                                                 247   7e-79   Medicago truncatula
gb|KJB44861.1|  hypothetical protein B456_007G276400                    254   8e-79   Gossypium raimondii
gb|KJB82283.1|  hypothetical protein B456_013G187300                    252   8e-79   Gossypium raimondii
ref|XP_007205422.1|  hypothetical protein PRUPE_ppa007684mg             252   8e-79   Prunus persica
ref|XP_008388714.1|  PREDICTED: probable low-specificity L-threon...    251   1e-78   
ref|XP_010024956.1|  PREDICTED: probable low-specificity L-threon...    251   1e-78   
ref|XP_008218319.1|  PREDICTED: probable low-specificity L-threon...    251   2e-78   Prunus mume [ume]
ref|XP_007030423.1|  L-allo-threonine aldolase isoform 4                251   2e-78   
ref|XP_004495576.1|  PREDICTED: L-allo-threonine aldolase-like is...    251   2e-78   Cicer arietinum [garbanzo]
gb|KCW61511.1|  hypothetical protein EUGRSUZ_H04236                     251   2e-78   Eucalyptus grandis [rose gum]
gb|KJB44863.1|  hypothetical protein B456_007G276400                    249   4e-78   Gossypium raimondii
gb|KJB44860.1|  hypothetical protein B456_007G276400                    250   6e-78   Gossypium raimondii
ref|XP_004495577.1|  PREDICTED: L-allo-threonine aldolase-like is...    249   6e-78   Cicer arietinum [garbanzo]
ref|XP_002521974.1|  l-allo-threonine aldolase, putative                249   6e-78   Ricinus communis
ref|XP_011036295.1|  PREDICTED: probable low-specificity L-threon...    249   1e-77   Populus euphratica
ref|XP_009364444.1|  PREDICTED: probable low-specificity L-threon...    249   1e-77   Pyrus x bretschneideri [bai li]
gb|KDP23711.1|  hypothetical protein JCGZ_23544                         249   1e-77   Jatropha curcas
ref|XP_003590972.1|  L-allo-threonine aldolase                          249   1e-77   Medicago truncatula
ref|XP_003590973.1|  L-allo-threonine aldolase                          250   1e-77   
gb|AES61221.2|  L-allo-threonine aldolase-like protein                  247   4e-77   Medicago truncatula
gb|ACJ84635.1|  unknown                                                 241   5e-77   Medicago truncatula
ref|XP_010694951.1|  PREDICTED: probable low-specificity L-threon...    248   5e-77   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB46043.1|  hypothetical protein B456_007G345500                    247   5e-77   Gossypium raimondii
ref|XP_002266992.1|  PREDICTED: probable low-specificity L-threon...    247   5e-77   Vitis vinifera
gb|KHG25609.1|  L-allo-threonine aldolase                               247   6e-77   Gossypium arboreum [tree cotton]
ref|XP_008802139.1|  PREDICTED: probable low-specificity L-threon...    246   1e-76   Phoenix dactylifera
ref|XP_003590970.1|  L-allo-threonine aldolase                          249   1e-76   
ref|XP_008802141.1|  PREDICTED: probable low-specificity L-threon...    245   1e-76   
gb|AFK38526.1|  unknown                                                 246   2e-76   Medicago truncatula
gb|KJB46045.1|  hypothetical protein B456_007G345500                    246   3e-76   Gossypium raimondii
gb|AFK43649.1|  unknown                                                 245   4e-76   Lotus japonicus
gb|KGN66767.1|  hypothetical protein Csa_1G681130                       240   5e-76   Cucumis sativus [cucumbers]
ref|XP_009389078.1|  PREDICTED: probable low-specificity L-threon...    244   5e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007144017.1|  hypothetical protein PHAVU_007G122200g             245   5e-76   Phaseolus vulgaris [French bean]
emb|CAN82414.1|  hypothetical protein VITISV_039151                     245   9e-76   Vitis vinifera
ref|XP_004151117.1|  PREDICTED: L-allo-threonine aldolase-like          241   1e-75   
gb|KEH24599.1|  L-allo-threonine aldolase-like protein                  243   1e-75   Medicago truncatula
gb|ACJ85157.1|  unknown                                                 245   2e-75   Medicago truncatula
gb|KHN04944.1|  L-allo-threonine aldolase                               243   2e-75   Glycine soja [wild soybean]
ref|XP_010906812.1|  PREDICTED: probable low-specificity L-threon...    243   2e-75   Elaeis guineensis
ref|XP_004494746.1|  PREDICTED: L-allo-threonine aldolase-like is...    243   2e-75   Cicer arietinum [garbanzo]
ref|XP_010906811.1|  PREDICTED: probable low-specificity L-threon...    243   2e-75   
ref|NP_001242307.1|  uncharacterized protein LOC100790890               243   2e-75   
gb|AFK40044.1|  unknown                                                 243   3e-75   Medicago truncatula
ref|XP_006588445.1|  PREDICTED: uncharacterized protein LOC100790...    243   3e-75   Glycine max [soybeans]
ref|XP_006606452.1|  PREDICTED: uncharacterized protein R102.4-li...    243   3e-75   
ref|XP_010246795.1|  PREDICTED: probable low-specificity L-threon...    242   4e-75   Nelumbo nucifera [Indian lotus]
ref|XP_006606453.1|  PREDICTED: uncharacterized protein R102.4-li...    243   5e-75   
ref|XP_008453668.1|  PREDICTED: probable low-specificity L-threon...    243   6e-75   Cucumis melo [Oriental melon]
ref|XP_004155692.1|  PREDICTED: L-allo-threonine aldolase-like          242   6e-75   
ref|XP_003556456.2|  PREDICTED: uncharacterized protein R102.4-li...    243   7e-75   
gb|ADI24921.1|  L-allo-threonine aldolase                               241   8e-75   Carica papaya [mamon]
ref|XP_010906810.1|  PREDICTED: probable low-specificity L-threon...    242   1e-74   
ref|XP_008453667.1|  PREDICTED: probable low-specificity L-threon...    242   1e-74   Cucumis melo [Oriental melon]
ref|XP_010906809.1|  PREDICTED: probable low-specificity L-threon...    242   1e-74   
ref|XP_006606451.1|  PREDICTED: uncharacterized protein R102.4-li...    243   1e-74   
ref|XP_008453666.1|  PREDICTED: probable low-specificity L-threon...    242   2e-74   Cucumis melo [Oriental melon]
ref|XP_004170415.1|  PREDICTED: L-allo-threonine aldolase-like          239   2e-74   
ref|XP_002892465.1|  hypothetical protein ARALYDRAFT_470930             240   2e-74   
ref|XP_010102233.1|  L-allo-threonine aldolase                          239   4e-74   Morus notabilis
ref|XP_010906817.1|  PREDICTED: probable low-specificity L-threon...    238   6e-74   Elaeis guineensis
ref|XP_007147215.1|  hypothetical protein PHAVU_006G105400g             239   7e-74   Phaseolus vulgaris [French bean]
gb|KGN66765.1|  hypothetical protein Csa_1G680120                       238   7e-74   Cucumis sativus [cucumbers]
ref|XP_004142582.1|  PREDICTED: L-allo-threonine aldolase-like          238   1e-73   
ref|XP_010906814.1|  PREDICTED: probable low-specificity L-threon...    238   2e-73   Elaeis guineensis
gb|AAF99780.1|AC003981_30  F22O13.11                                    238   2e-73   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63785.1|  unknown                                                 238   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077492.1|  threonine aldolase                                 237   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489194.1|  PREDICTED: probable low-specificity L-threon...    237   3e-73   Camelina sativa [gold-of-pleasure]
ref|XP_009118358.1|  PREDICTED: probable low-specificity L-threon...    237   3e-73   
ref|NP_563822.1|  threonine aldolase                                    237   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475669.1|  PREDICTED: probable low-specificity L-threon...    237   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010553775.1|  PREDICTED: probable low-specificity L-threon...    237   5e-73   Tarenaya hassleriana [spider flower]
ref|XP_010458106.1|  PREDICTED: probable low-specificity L-threon...    237   6e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006417664.1|  hypothetical protein EUTSA_v10008026mg             236   7e-73   Eutrema salsugineum [saltwater cress]
ref|XP_009148115.1|  PREDICTED: probable low-specificity L-threon...    236   1e-72   Brassica rapa
ref|XP_006305180.1|  hypothetical protein CARUB_v10009546mg             236   1e-72   Capsella rubella
emb|CDX95045.1|  BnaC05g06260D                                          235   2e-72   
emb|CDY06323.1|  BnaA09g48800D                                          235   3e-72   
ref|XP_006577317.1|  PREDICTED: uncharacterized protein R102.4-li...    235   3e-72   Glycine max [soybeans]
ref|XP_003521772.1|  PREDICTED: uncharacterized protein R102.4-li...    235   3e-72   Glycine max [soybeans]
emb|CDY22672.1|  BnaC08g43060D                                          235   3e-72   Brassica napus [oilseed rape]
ref|XP_006577318.1|  PREDICTED: uncharacterized protein R102.4-li...    235   3e-72   Glycine max [soybeans]
ref|XP_008443794.1|  PREDICTED: probable low-specificity L-threon...    235   4e-72   
ref|XP_009110878.1|  PREDICTED: probable low-specificity L-threon...    235   4e-72   Brassica rapa
emb|CDX93548.1|  BnaA06g05000D                                          233   3e-71   
emb|CDY31134.1|  BnaA08g26840D                                          232   7e-71   Brassica napus [oilseed rape]
ref|XP_006857300.1|  hypothetical protein AMTR_s00067p00056150          228   1e-69   Amborella trichopoda
ref|XP_011465993.1|  PREDICTED: probable low-specificity L-threon...    228   2e-69   Fragaria vesca subsp. vesca
emb|CDO99988.1|  unnamed protein product                                225   1e-68   Coffea canephora [robusta coffee]
ref|XP_010262337.1|  PREDICTED: probable low-specificity L-threon...    224   2e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010262335.1|  PREDICTED: probable low-specificity L-threon...    225   2e-68   Nelumbo nucifera [Indian lotus]
gb|AFW58858.1|  putative threonine aldolase family protein              220   4e-67   
ref|XP_008802138.1|  PREDICTED: probable low-specificity L-threon...    221   5e-67   Phoenix dactylifera
emb|CDY42933.1|  BnaC05g47180D                                          221   8e-67   Brassica napus [oilseed rape]
emb|CDY49330.1|  BnaA05g32920D                                          221   1e-66   Brassica napus [oilseed rape]
ref|NP_001189807.1|  threonine aldolase 2                               220   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566228.1|  threonine aldolase 2                                  220   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123981.1|  PREDICTED: probable low-specificity L-threon...    220   2e-66   Brassica rapa
ref|XP_008661960.1|  PREDICTED: L-allo-threonine aldolase isoform X1    220   2e-66   
ref|NP_001149239.1|  L-allo-threonine aldolase                          220   2e-66   Zea mays [maize]
gb|AAF63783.1|  L-allo-threonine aldolase, putative                     220   2e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884450.1|  hypothetical protein ARALYDRAFT_896488             219   5e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_006408182.1|  hypothetical protein EUTSA_v10021036mg             218   9e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010463930.1|  PREDICTED: probable low-specificity L-threon...    217   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010415759.1|  PREDICTED: probable low-specificity L-threon...    215   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010485829.1|  PREDICTED: probable low-specificity L-threon...    215   1e-64   Camelina sativa [gold-of-pleasure]
gb|ACG34432.1|  L-allo-threonine aldolase                               216   1e-64   Zea mays [maize]
ref|XP_010520652.1|  PREDICTED: probable low-specificity L-threon...    215   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_003590971.1|  L-allo-threonine aldolase                          213   8e-64   
emb|CBI22386.3|  unnamed protein product                                212   1e-63   Vitis vinifera
ref|XP_006298023.1|  hypothetical protein CARUB_v10014068mg             211   6e-63   Capsella rubella
gb|ABR18450.1|  unknown                                                 211   1e-62   Picea sitchensis
ref|XP_004976228.1|  PREDICTED: uncharacterized protein R102.4-li...    209   3e-62   Setaria italica
ref|XP_004976227.1|  PREDICTED: uncharacterized protein R102.4-li...    209   4e-62   
gb|EMT09938.1|  hypothetical protein F775_21345                         202   1e-60   
ref|XP_010553776.1|  PREDICTED: probable low-specificity L-threon...    204   1e-60   Tarenaya hassleriana [spider flower]
gb|EMS57977.1|  L-allo-threonine aldolase                               203   1e-60   Triticum urartu
ref|NP_001140767.1|  putative threonine aldolase family protein         201   2e-59   
ref|XP_006652519.1|  PREDICTED: uncharacterized protein R102.4-like     202   2e-59   Oryza brachyantha
ref|NP_001241763.1|  L-allo-threonine aldolase                          201   4e-59   
ref|XP_008667491.1|  PREDICTED: putative threonine aldolase famil...    201   4e-59   
ref|XP_008667492.1|  PREDICTED: putative threonine aldolase famil...    201   4e-59   Zea mays [maize]
gb|EMT23922.1|  hypothetical protein F775_09169                         197   7e-59   
dbj|BAK01917.1|  predicted protein                                      199   2e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03835.1|  predicted protein                                      199   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001141974.1|  putative threonine aldolase family protein i...    193   7e-58   
ref|XP_003580135.1|  PREDICTED: probable low-specificity L-threon...    197   2e-57   Brachypodium distachyon [annual false brome]
gb|EMT28261.1|  hypothetical protein F775_27222                         193   2e-57   
gb|EMS52584.1|  L-allo-threonine aldolase                               196   3e-57   Triticum urartu
dbj|BAJ93201.1|  predicted protein                                      196   4e-57   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002448187.1|  hypothetical protein SORBIDRAFT_06g022630          196   4e-57   Sorghum bicolor [broomcorn]
tpg|DAA36971.1|  TPA: putative threonine aldolase family protein ...    194   2e-56   
ref|NP_001053314.1|  Os04g0516600                                       194   2e-56   
gb|EMT07295.1|  hypothetical protein F775_08681                         192   3e-56   
gb|EMS67121.1|  L-allo-threonine aldolase                               191   5e-55   Triticum urartu
gb|EMS46485.1|  L-allo-threonine aldolase                               187   1e-54   Triticum urartu
emb|CAE05443.2|  OSJNBa0073E02.3                                        189   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004976226.1|  PREDICTED: uncharacterized protein R102.4-like     186   1e-53   Setaria italica
ref|XP_001768407.1|  predicted protein                                  187   2e-53   
ref|XP_004976222.1|  PREDICTED: uncharacterized protein R102.4-like     183   4e-52   Setaria italica
ref|WP_014434736.1|  threonine aldolase                                 168   2e-46   Caldilinea aerophila
ref|XP_003058675.1|  predicted protein                                  171   5e-46   Micromonas pusilla CCMP1545
ref|XP_005989151.1|  PREDICTED: uncharacterized protein R102.4-like     168   6e-46   Latimeria chalumnae
emb|CDQ60587.1|  unnamed protein product                                168   9e-46   Oncorhynchus mykiss
ref|XP_011429035.1|  PREDICTED: probable low-specificity L-threon...    167   9e-46   Crassostrea gigas
ref|XP_002594275.1|  hypothetical protein BRAFLDRAFT_260210             165   2e-45   Branchiostoma floridae
ref|WP_026159079.1|  threonine aldolase                                 164   4e-45   
ref|XP_006635478.1|  PREDICTED: uncharacterized protein R102.4-like     165   7e-45   
ref|XP_010893799.1|  PREDICTED: probable low-specificity L-threon...    165   8e-45   Esox lucius
ref|WP_005011469.1|  Low-specificity L-threonine aldolase               163   1e-44   Nitrospina gracilis
ref|XP_002973664.1|  hypothetical protein SELMODRAFT_99781              162   3e-44   
ref|XP_002975719.1|  hypothetical protein SELMODRAFT_103881             162   3e-44   
ref|WP_026171962.1|  threonine aldolase                                 161   4e-44   
ref|XP_005943923.1|  PREDICTED: uncharacterized protein R102.4-li...    161   5e-44   Haplochromis burtoni
ref|XP_008300571.1|  PREDICTED: probable low-specificity L-threon...    163   7e-44   Stegastes partitus
gb|EKC35640.1|  E3 ubiquitin-protein ligase TRAF7                       169   8e-44   Crassostrea gigas
ref|WP_011697570.1|  threonine aldolase                                 161   8e-44   Syntrophobacter fumaroxidans
ref|XP_004556683.1|  PREDICTED: uncharacterized protein R102.4-like     161   2e-43   Maylandia zebra
ref|XP_005943922.1|  PREDICTED: uncharacterized protein R102.4-li...    161   2e-43   Haplochromis burtoni
ref|WP_020877756.1|  aromatic amino acid beta-eliminating lyase/t...    159   2e-43   Desulfococcus multivorans
ref|WP_013559406.1|  threonine aldolase                                 159   3e-43   Anaerolinea thermophila
ref|XP_002121406.1|  PREDICTED: probable low-specificity L-threon...    160   3e-43   
ref|WP_038087996.1|  threonine aldolase                                 159   5e-43   Acidihalobacter prosperus
ref|XP_007562537.1|  PREDICTED: uncharacterized protein R102.4-like     160   5e-43   Poecilia formosa
ref|XP_003979332.1|  PREDICTED: uncharacterized protein R102.4-like     159   6e-43   
ref|XP_004080515.1|  PREDICTED: probable low-specificity L-threon...    160   7e-43   Oryzias latipes [Japanese rice fish]
ref|WP_036683028.1|  threonine aldolase                                 158   8e-43   
ref|XP_005749741.1|  PREDICTED: uncharacterized protein R102.4-like     160   8e-43   Pundamilia nyererei
ref|XP_002069264.1|  GK21059                                            159   1e-42   Drosophila willistoni
ref|XP_003441921.1|  PREDICTED: uncharacterized protein R102.4-like     159   1e-42   Oreochromis niloticus
ref|WP_037564212.1|  threonine aldolase                                 157   1e-42   Alkalispirochaeta odontotermitis
ref|XP_008312508.1|  PREDICTED: probable low-specificity L-threon...    158   5e-42   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010747733.1|  PREDICTED: probable low-specificity L-threon...    157   1e-41   
ref|XP_003385045.1|  PREDICTED: probable low-specificity L-threon...    154   3e-41   
ref|WP_019902461.1|  hypothetical protein                               153   5e-41   
ref|WP_018052780.1|  hypothetical protein                               153   8e-41   
ref|XP_005794827.1|  PREDICTED: uncharacterized protein R102.4-like     155   1e-40   
ref|XP_001419158.1|  predicted protein                                  153   1e-40   Ostreococcus lucimarinus CCE9901
ref|XP_006814697.1|  PREDICTED: uncharacterized protein R102.4-like     154   1e-40   Saccoglossus kowalevskii
ref|XP_001625551.1|  predicted protein                                  152   1e-40   Nematostella vectensis
ref|WP_013218741.1|  threonine aldolase                                 152   2e-40   Dehalogenimonas lykanthroporepellens
ref|WP_004713360.1|  threonine aldolase                                 151   3e-40   Yersinia rohdei
ref|XP_002777074.1|  L-allo-threonine aldolase, putative                152   4e-40   Perkinsus marinus ATCC 50983
emb|CBN78642.1|  Threonine aldolase                                     157   4e-40   Ectocarpus siliculosus
emb|CEG01512.1|  Aromatic amino acid beta-eliminating lyase/threo...    151   5e-40   Ostreococcus tauri
ref|XP_010795211.1|  PREDICTED: probable low-specificity L-threon...    152   1e-39   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003080829.1|  L-allo-threonine aldolase, putative (ISS)          151   1e-39   
emb|CCO67312.1|  Low-specificity L-threonine aldolase                   150   1e-39   Yersinia enterocolitica IP 10393
ref|XP_001989934.1|  GH19068                                            150   1e-39   Drosophila grimshawi
ref|XP_006841676.1|  hypothetical protein AMTR_s00003p00244760          142   2e-39   
ref|XP_001982124.1|  GG12420                                            149   3e-39   
emb|CBX71679.1|  hypothetical protein YEW_FV24480                       142   3e-39   Yersinia enterocolitica W22703
ref|XP_002001285.1|  GI10703                                            149   4e-39   Drosophila mojavensis
ref|WP_004873721.1|  threonine aldolase                                 148   4e-39   Yersinia mollaretii
ref|WP_032898062.1|  threonine aldolase                                 148   4e-39   Yersinia bercovieri
ref|WP_042663615.1|  threonine aldolase                                 148   4e-39   Yersinia enterocolitica
ref|WP_019079898.1|  threonine aldolase                                 148   5e-39   Yersinia enterocolitica
ref|WP_019083465.1|  threonine aldolase                                 147   6e-39   Yersinia enterocolitica
ref|WP_023160779.1|  L-allo-threonine aldolase                          147   6e-39   Yersinia enterocolitica
ref|WP_005171133.1|  threonine aldolase                                 147   6e-39   Yersinia enterocolitica
ref|WP_011816022.1|  threonine aldolase                                 147   7e-39   Yersinia enterocolitica
ref|WP_005162818.1|  threonine aldolase                                 147   7e-39   Yersinia enterocolitica
emb|CCQ40051.1|  L-allo-threonine aldolase                              147   7e-39   Yersinia enterocolitica (type O:5) str. YE53/03
ref|WP_025383281.1|  threonine aldolase                                 147   7e-39   Yersinia pseudotuberculosis complex
ref|WP_023161056.1|  L-allo-threonine aldolase                          147   7e-39   Yersinia enterocolitica
ref|WP_023377740.1|  Low-specificity L-threonine aldolase               147   9e-39   
ref|NP_651161.1|  CG10184                                               148   1e-38   Drosophila melanogaster
ref|WP_038404710.1|  threonine aldolase                                 142   1e-38   
ref|XP_002053845.1|  GJ23119                                            148   1e-38   Drosophila virilis
ref|XP_002104572.1|  GD18368                                            148   1e-38   
ref|WP_033853305.1|  threonine aldolase                                 147   1e-38   Yersinia pseudotuberculosis complex
ref|WP_012119285.1|  threonine aldolase                                 147   1e-38   Roseiflexus castenholzii
ref|XP_002032362.1|  GM23553                                            148   1e-38   Drosophila sechellia
ref|WP_015671727.1|  threonine aldolase                                 147   1e-38   Serratia sp. FGI94
ref|WP_042819367.1|  threonine aldolase                                 147   1e-38   Yersinia wautersii
ref|XP_002098447.1|  GE23939                                            147   1e-38   Drosophila yakuba
ref|XP_002429180.1|  L-allo-threonine aldolase, putative                147   1e-38   Pediculus humanus corporis [human body lice]
tpg|DAA34403.1|  TPA: threonine aldolase                                143   1e-38   Amblyomma variegatum
ref|WP_042568238.1|  threonine aldolase                                 147   2e-38   Yersinia
ref|WP_034004929.1|  threonine aldolase                                 142   2e-38   
ref|WP_005184761.1|  threonine aldolase                                 146   3e-38   Yersinia intermedia
emb|CDY25132.1|  BnaC07g03750D                                          141   3e-38   Brassica napus [oilseed rape]
ref|XP_008483598.1|  PREDICTED: probable low-specificity L-threon...    143   3e-38   
ref|XP_011503110.1|  PREDICTED: probable low-specificity L-threon...    146   3e-38   Ceratosolen solmsi marchali
gb|KDR08943.1|  hypothetical protein L798_00871                         147   4e-38   Zootermopsis nevadensis
ref|WP_038241504.1|  threonine aldolase                                 145   5e-38   Yersinia ruckeri
ref|WP_042528124.1|  threonine aldolase                                 145   6e-38   Yersinia ruckeri
ref|WP_024917509.1|  threonine aldolase                                 142   6e-38   Pseudomonas aeruginosa
ref|XP_008102407.1|  PREDICTED: LOW QUALITY PROTEIN: probable low...    147   7e-38   
ref|WP_004717312.1|  threonine aldolase                                 145   7e-38   Yersinia ruckeri
ref|XP_001517050.1|  PREDICTED: probable low-specificity L-threon...    145   7e-38   
ref|WP_017892242.1|  threonine aldolase                                 145   8e-38   Serratia sp. S4
ref|WP_012006096.1|  threonine aldolase                                 145   8e-38   Serratia proteamaculans
ref|WP_038632040.1|  MULTISPECIES: threonine aldolase                   144   1e-37   Yersinia
ref|WP_004389601.1|  threonine aldolase                                 144   1e-37   Yersinia kristensenii
ref|WP_043185387.1|  threonine aldolase                                 144   1e-37   Pseudomonas rhizosphaerae
gb|EHJ67858.1|  hypothetical protein KGM_00088                          145   1e-37   
ref|XP_009060249.1|  hypothetical protein LOTGIDRAFT_154302             145   1e-37   Lottia gigantea
ref|WP_026051832.1|  hypothetical protein                               139   1e-37   
ref|WP_020826096.1|  threonine aldolase                                 144   1e-37   Serratia liquefaciens
ref|WP_034078438.1|  threonine aldolase                                 139   1e-37   
ref|WP_035291801.1|  threonine aldolase                                 144   1e-37   Clostridiaceae
ref|WP_035983901.1|  threonine aldolase                                 139   2e-37   
ref|XP_002020170.1|  GL13839                                            145   2e-37   Drosophila persimilis
ref|XP_001357814.2|  GA10138                                            145   2e-37   
emb|CBJ32110.1|  Threonine aldolase                                     146   2e-37   
ref|XP_001955419.1|  GF18752                                            144   2e-37   
ref|XP_002072954.1|  GK13412                                            144   2e-37   
ref|XP_011063702.1|  PREDICTED: probable low-specificity L-threon...    144   3e-37   
emb|CDW81197.1|  threonine aldolase                                     144   3e-37   
ref|WP_009620768.1|  MULTISPECIES: L-threonine aldolase                 143   3e-37   
gb|AAI54202.1|  Zgc:91912                                               144   3e-37   
emb|CEF60693.1|  Aromatic amino acid beta-eliminating lyase/threo...    144   3e-37   
ref|WP_034027655.1|  threonine aldolase                                 143   3e-37   
ref|WP_016263814.1|  hypothetical protein                               143   3e-37   
ref|WP_034016418.1|  threonine aldolase                                 143   4e-37   
ref|WP_044549475.1|  threonine aldolase                                 143   4e-37   
ref|WP_018206339.1|  MULTISPECIES: hypothetical protein                 143   4e-37   
ref|WP_006320879.1|  threonine aldolase                                 143   4e-37   
ref|WP_020675901.1|  hypothetical protein                               143   5e-37   
ref|WP_003111717.1|  MULTISPECIES: threonine aldolase                   142   5e-37   
ref|WP_003134258.1|  threonine aldolase                                 142   5e-37   
ref|WP_019681686.1|  threonine aldolase                                 142   5e-37   
ref|WP_034080189.1|  threonine aldolase                                 142   5e-37   
ref|WP_043267694.1|  threonine aldolase                                 142   5e-37   
ref|WP_012076935.1|  threonine aldolase                                 142   5e-37   
ref|WP_023130163.1|  hypothetical protein                               142   5e-37   
ref|WP_033939139.1|  threonine aldolase                                 142   5e-37   
ref|WP_031756411.1|  threonine aldolase                                 142   5e-37   
ref|WP_003085964.1|  threonine aldolase                                 142   5e-37   
ref|WP_043102813.1|  threonine aldolase                                 142   5e-37   
ref|WP_033956165.1|  threonine aldolase                                 142   5e-37   
gb|ETO06892.1|  hypothetical protein RFI_30498                          144   5e-37   
ref|WP_003153522.1|  hypothetical protein                               142   5e-37   
ref|WP_043094108.1|  threonine aldolase                                 142   5e-37   
ref|WP_023112294.1|  hypothetical protein                               142   6e-37   
ref|XP_004922009.1|  PREDICTED: uncharacterized protein R102.4-like     143   6e-37   
ref|WP_033976545.1|  threonine aldolase                                 142   6e-37   
ref|WP_023409291.1|  hypothetical protein                               142   6e-37   
ref|WP_043250566.1|  threonine aldolase                                 142   7e-37   
ref|XP_011154490.1|  PREDICTED: probable low-specificity L-threon...    143   7e-37   
ref|WP_033971186.1|  threonine aldolase                                 142   7e-37   
gb|EDL66247.1|  L-allo-threonine aldolase                               142   7e-37   
ref|WP_033971346.1|  threonine aldolase                                 139   8e-37   
ref|NP_001002176.1|  threonine aldolase 1                               143   1e-36   
ref|WP_015903146.1|  threonine aldolase                                 142   1e-36   
ref|XP_011332668.1|  PREDICTED: probable low-specificity L-threon...    142   1e-36   
ref|XP_001651472.1|  AAEL005819-PA                                      142   1e-36   
ref|WP_043418899.1|  threonine aldolase                                 142   1e-36   
ref|WP_037426510.1|  threonine aldolase                                 141   2e-36   
ref|WP_042862593.1|  threonine aldolase                                 139   2e-36   
ref|XP_011332667.1|  PREDICTED: probable low-specificity L-threon...    142   2e-36   
ref|WP_003125125.1|  hypothetical protein                               139   2e-36   
ref|WP_003455159.1|  Low-specificity L-threonine aldolase               141   2e-36   
ref|WP_016979789.1|  threonine aldolase                                 140   2e-36   
ref|WP_044022162.1|  threonine aldolase                                 140   4e-36   
ref|WP_028617611.1|  threonine aldolase                                 140   4e-36   
ref|NP_001076701.2|  Protein R102.4, isoform c                          141   4e-36   
gb|KFM60885.1|  Hypothetical protein X975_00033                         140   4e-36   
ref|WP_034085836.1|  threonine aldolase                                 137   4e-36   
ref|WP_034099927.1|  MULTISPECIES: threonine aldolase                   140   4e-36   
ref|WP_029611038.1|  threonine aldolase                                 140   4e-36   
ref|WP_028240749.1|  threonine aldolase                                 140   4e-36   
dbj|BAL53180.1|  threonine aldolase                                     140   4e-36   
ref|WP_021491468.1|  threonine aldolase                                 140   4e-36   
ref|WP_034012492.1|  threonine aldolase                                 140   5e-36   
gb|ELU12248.1|  hypothetical protein CAPTEDRAFT_174489                  140   5e-36   
ref|WP_019342021.1|  threonine aldolase                                 140   5e-36   
ref|WP_029529053.1|  MULTISPECIES: threonine aldolase                   140   5e-36   
gb|ACI16795.2|  threonine aldolase                                      140   5e-36   
ref|NP_501979.3|  Protein R102.4, isoform b                             141   5e-36   
gb|EGT48067.1|  hypothetical protein CAEBREN_30968                      141   5e-36   
ref|WP_023105499.1|  hypothetical protein                               140   5e-36   
ref|WP_003120729.1|  threonine aldolase                                 140   5e-36   
ref|WP_017148803.1|  threonine aldolase                                 140   6e-36   
ref|WP_043552701.1|  threonine aldolase                                 140   6e-36   
ref|WP_023124923.1|  hypothetical protein                               140   6e-36   
ref|WP_034054613.1|  threonine aldolase                                 140   6e-36   
ref|WP_003112603.1|  MULTISPECIES: threonine aldolase                   140   6e-36   
gb|AAT51465.1|  PA0902                                                  140   6e-36   
ref|WP_043087068.1|  threonine aldolase                                 140   6e-36   
ref|WP_023084940.1|  hypothetical protein                               140   6e-36   
ref|WP_012543447.1|  threonine aldolase                                 140   6e-36   
ref|NP_501978.3|  Protein R102.4, isoform a                             141   6e-36   
ref|WP_034053251.1|  threonine aldolase                                 140   6e-36   
ref|WP_033982853.1|  threonine aldolase                                 140   6e-36   
ref|WP_033950956.1|  threonine aldolase                                 139   6e-36   
ref|WP_034041498.1|  threonine aldolase                                 139   7e-36   
ref|WP_010090107.1|  Threonine aldolase                                 135   8e-36   
ref|WP_026145012.1|  threonine aldolase                                 139   8e-36   
ref|WP_038134832.1|  threonine aldolase                                 135   8e-36   
ref|WP_041479261.1|  threonine aldolase                                 139   8e-36   
ref|WP_003123235.1|  threonine aldolase                                 139   8e-36   
ref|WP_034153323.1|  threonine aldolase                                 139   1e-35   
ref|XP_003089462.1|  hypothetical protein CRE_15084                     140   1e-35   
ref|WP_016983961.1|  threonine aldolase                                 139   1e-35   
emb|CEP77559.1|  threonine aldolase                                     139   1e-35   
dbj|GAK54836.1|  L-threonine aldolase                                   139   1e-35   
ref|NP_001255503.1|  Protein R102.4, isoform e                          135   1e-35   
ref|WP_037036076.1|  threonine aldolase                                 139   1e-35   
ref|WP_021443542.1|  threonine aldolase                                 139   1e-35   
ref|WP_027612644.1|  threonine aldolase                                 139   1e-35   
gb|KFJ93194.1|  threonine aldolase                                      139   1e-35   
ref|WP_008086086.1|  threonine aldolase                                 139   1e-35   
ref|WP_039757944.1|  threonine aldolase                                 139   1e-35   
ref|WP_034016761.1|  threonine aldolase                                 139   1e-35   
ref|WP_015878127.1|  threonine aldolase                                 139   1e-35   
ref|WP_033937868.1|  threonine aldolase                                 139   1e-35   
ref|WP_021488633.1|  threonine aldolase                                 139   1e-35   
ref|WP_011335528.1|  threonine aldolase                                 139   1e-35   
ref|WP_018625079.1|  threonine aldolase                                 139   1e-35   
ref|XP_006270755.1|  PREDICTED: uncharacterized protein R102.4-like     139   1e-35   
emb|CBY07632.1|  unnamed protein product                                139   1e-35   
ref|WP_038662087.1|  threonine aldolase                                 139   1e-35   
ref|WP_041066543.1|  threonine aldolase                                 139   1e-35   
ref|WP_034139048.1|  threonine aldolase                                 139   2e-35   
ref|WP_029534189.1|  threonine aldolase                                 139   2e-35   
ref|WP_019362646.1|  threonine aldolase                                 139   2e-35   
ref|WP_007963085.1|  threonine aldolase                                 139   2e-35   
ref|WP_017491720.1|  threonine aldolase                                 139   2e-35   
ref|WP_041686662.1|  threonine aldolase                                 139   2e-35   
ref|WP_041023500.1|  threonine aldolase                                 138   2e-35   
ref|WP_042303392.1|  threonine aldolase                                 138   2e-35   
ref|WP_034789087.1|  threonine aldolase                                 138   2e-35   
ref|WP_003567767.1|  threonine aldolase                                 139   2e-35   
ref|WP_042947303.1|  threonine aldolase                                 138   2e-35   
emb|CDJ95042.1|  unnamed protein product                                139   2e-35   
ref|WP_012208016.1|  threonine aldolase                                 138   2e-35   
ref|WP_027602740.1|  MULTISPECIES: threonine aldolase                   138   2e-35   
ref|WP_024766341.1|  threonine aldolase                                 138   2e-35   
ref|XP_008312591.1|  PREDICTED: probable low-specificity L-threon...    139   3e-35   
ref|WP_015838690.1|  threonine aldolase                                 138   3e-35   
ref|WP_039012790.1|  threonine aldolase                                 138   3e-35   
ref|WP_038669718.1|  threonine aldolase                                 138   3e-35   
ref|XP_005645027.1|  threonine aldolase                                 139   3e-35   
ref|WP_042607199.1|  threonine aldolase                                 138   3e-35   
ref|WP_042135694.1|  threonine aldolase                                 138   3e-35   
emb|CDJ92999.1|  Aromatic amino acid beta-eliminating lyase threo...    139   3e-35   
ref|WP_024077000.1|  threonine aldolase                                 138   3e-35   
ref|WP_034151453.1|  threonine aldolase                                 138   3e-35   
ref|WP_025215100.1|  threonine aldolase                                 137   3e-35   
ref|WP_025112912.1|  threonine aldolase                                 137   3e-35   
ref|WP_034181661.1|  threonine aldolase                                 138   3e-35   
gb|EGT59860.1|  hypothetical protein CAEBREN_31962                      139   3e-35   
ref|WP_033876665.1|  threonine aldolase                                 137   4e-35   
ref|WP_037017247.1|  threonine aldolase                                 137   4e-35   
gb|EYC42451.1|  hypothetical protein Y032_0531g3026                     135   4e-35   
ref|WP_016494100.1|  threonine aldolase                                 137   4e-35   
ref|WP_017517938.1|  threonine aldolase                                 137   4e-35   
ref|XP_003108500.1|  hypothetical protein CRE_10872                     139   4e-35   
ref|WP_021218475.1|  threonine aldolase                                 137   4e-35   
ref|WP_007159104.1|  threonine aldolase                                 137   4e-35   
ref|WP_032625517.1|  threonine aldolase                                 137   4e-35   
ref|WP_024014010.1|  threonine aldolase                                 137   4e-35   
gb|AHF77684.1|  L-threonine aldolase                                    138   4e-35   
ref|WP_044412280.1|  threonine aldolase                                 137   4e-35   
ref|WP_044342725.1|  threonine aldolase                                 137   4e-35   
ref|XP_007515338.1|  L-allo-threonine aldolase                          138   4e-35   
ref|XP_003498871.1|  PREDICTED: probable low-specificity L-threon...    138   4e-35   
gb|EZP31651.1|  L-threonine aldolase                                    137   5e-35   
ref|XP_004433000.1|  PREDICTED: uncharacterized protein R102.4-like     138   5e-35   
ref|WP_041873837.1|  hypothetical protein                               135   5e-35   
ref|WP_025241187.1|  threonine aldolase                                 137   5e-35   
ref|WP_035498848.1|  threonine aldolase                                 137   5e-35   
ref|WP_015886810.1|  threonine aldolase                                 139   5e-35   
ref|WP_027596862.1|  threonine aldolase                                 137   5e-35   
ref|XP_003695428.1|  PREDICTED: L-allo-threonine aldolase-like          138   5e-35   
ref|WP_039772078.1|  threonine aldolase                                 137   5e-35   
gb|EYC42453.1|  hypothetical protein Y032_0531g3026                     135   5e-35   
ref|WP_012103076.1|  threonine aldolase                                 137   5e-35   
ref|WP_021804123.1|  threonine aldolase                                 137   5e-35   
dbj|BAH07479.1|  hypothetical protein                                   137   5e-35   
ref|WP_013574761.1|  MULTISPECIES: threonine aldolase                   137   6e-35   
ref|WP_033901297.1|  threonine aldolase                                 137   6e-35   
ref|WP_017677543.1|  threonine aldolase                                 137   6e-35   
gb|ETK20840.1|  L-allo-threonine aldolase                               137   6e-35   
ref|WP_030100167.1|  threonine aldolase                                 137   6e-35   
ref|WP_007951050.1|  threonine aldolase                                 137   6e-35   
ref|XP_006569822.1|  PREDICTED: uncharacterized protein R102.4-li...    138   6e-35   
ref|WP_015696594.1|  threonine aldolase                                 137   6e-35   
ref|WP_032861573.1|  threonine aldolase                                 137   6e-35   
ref|XP_011254364.1|  PREDICTED: probable low-specificity L-threon...    138   6e-35   
ref|WP_003292028.1|  threonine aldolase                                 137   6e-35   
ref|WP_008523477.1|  threonine aldolase                                 137   6e-35   
ref|WP_029294464.1|  threonine aldolase                                 137   7e-35   
ref|WP_035516512.1|  threonine aldolase                                 137   7e-35   
ref|WP_036001561.1|  threonine aldolase                                 137   7e-35   
ref|WP_016773594.1|  threonine aldolase                                 137   7e-35   
ref|WP_010445472.1|  threonine aldolase                                 137   7e-35   
ref|WP_038366536.1|  threonine aldolase                                 137   7e-35   
ref|WP_038710129.1|  threonine aldolase                                 137   8e-35   
ref|WP_020068089.1|  threonine aldolase                                 137   8e-35   
ref|XP_004655761.1|  PREDICTED: uncharacterized protein R102.4-like     135   8e-35   
ref|XP_001081745.1|  PREDICTED: probable low-specificity L-threon...    138   8e-35   
ref|WP_034128464.1|  threonine aldolase                                 137   8e-35   
ref|WP_042307810.1|  threonine aldolase                                 137   8e-35   
ref|WP_027777464.1|  threonine aldolase                                 137   8e-35   
gb|EIF33356.1|  threonine aldolase                                      137   8e-35   
ref|WP_017775347.1|  threonine aldolase                                 137   8e-35   
ref|WP_007581146.1|  MULTISPECIES: threonine aldolase                   137   8e-35   
ref|WP_014719591.1|  MULTISPECIES: threonine aldolase                   137   8e-35   
ref|WP_015885469.1|  threonine aldolase                                 137   9e-35   
ref|XP_006064168.1|  PREDICTED: uncharacterized protein R102.4-li...    137   9e-35   
ref|WP_025165375.1|  threonine aldolase                                 136   9e-35   
ref|XP_002634311.1|  Hypothetical protein CBG17652                      138   9e-35   
ref|WP_035955780.1|  threonine aldolase                                 136   9e-35   
ref|WP_042560538.1|  threonine aldolase                                 136   9e-35   
ref|WP_006411699.1|  threonine aldolase                                 136   1e-34   
gb|ETY83685.1|  Low-specificity L-threonine aldolase                    137   1e-34   
ref|WP_006416187.1|  threonine aldolase                                 136   1e-34   
ref|WP_011394825.1|  threonine aldolase                                 136   1e-34   
ref|WP_012216292.1|  threonine aldolase                                 136   1e-34   
ref|WP_015476472.1|  L-threonine aldolase                               136   1e-34   
ref|WP_017639701.1|  threonine aldolase                                 136   1e-34   
ref|XP_005351000.1|  PREDICTED: uncharacterized protein R102.4-like     138   1e-34   
gb|EYC42452.1|  hypothetical protein Y032_0531g3026                     135   1e-34   
ref|WP_006406673.1|  threonine aldolase                                 136   1e-34   
ref|WP_041746670.1|  threonine aldolase                                 136   1e-34   
ref|WP_041725412.1|  threonine aldolase                                 136   1e-34   
ref|WP_044314556.1|  threonine aldolase                                 136   1e-34   
ref|WP_006397331.1|  threonine aldolase                                 136   1e-34   
ref|WP_023437901.1|  L-allo-threonine aldolase                          136   1e-34   
ref|WP_044870571.1|  threonine aldolase                                 136   1e-34   
ref|WP_014295561.1|  threonine aldolase                                 136   1e-34   
gb|ABX03684.1|  Threonine aldolase                                      136   1e-34   



>ref|XP_006361420.1| PREDICTED: uncharacterized protein R102.4 isoform X1 [Solanum 
tuberosum]
 ref|XP_006361421.1| PREDICTED: uncharacterized protein R102.4 isoform X2 [Solanum 
tuberosum]
 ref|XP_006361422.1| PREDICTED: uncharacterized protein R102.4 isoform X3 [Solanum 
tuberosum]
Length=361

 Score =   275 bits (704),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMV RTVDLRSDTVTKPTEAMR AMA+AEVDDDVLG+DPTAQRLEAE+A+I GKEAGLFV
Sbjct  2    KMVVRTVDLRSDTVTKPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEMARITGKEAGLFV  61

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGIST+GGVHPRT+KNN+DGTMDLD
Sbjct  62   PSGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDLD  121

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIRDP FEIC+PTTRLICL
Sbjct  122  LIEAAIRDPSFEICYPTTRLICL  144



>ref|XP_009631531.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009631532.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009631533.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
tomentosiformis]
Length=359

 Score =   275 bits (703),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTEAMR AMA+AEVDDDVLG+DPTAQRLEAEIA+IMGKEAGLFVP
Sbjct  1    MVMRTVDLRSDTVTKPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEIARIMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGI+T+GGVHPRT+KNN+DGTMDLD 
Sbjct  61   SGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGIATLGGVHPRTVKNNEDGTMDLDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP FEIC+PTTRLICL
Sbjct  121  IEAAIRDPSFEICYPTTRLICL  142



>ref|XP_009798339.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798340.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798341.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798342.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
 ref|XP_009798343.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
Length=359

 Score =   275 bits (703),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTEAMR AMA+AEVDDDVLG+DPTAQRLEAEIA+IMGKEAGLFVP
Sbjct  1    MVMRTVDLRSDTVTKPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEIARIMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGI+T+GGVHPRT+KNN+DGTMDLD 
Sbjct  61   SGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGIATLGGVHPRTVKNNEDGTMDLDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP FEIC+PTTRLICL
Sbjct  121  IEAAIRDPSFEICYPTTRLICL  142



>ref|XP_010319280.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319281.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
 ref|XP_010319282.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Solanum lycopersicum]
Length=361

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMV RTVDLRSDTVT+PTEAMR AMA+AEVDDDVLG+DPTAQRLEAE+A+I GKEAGLFV
Sbjct  2    KMVVRTVDLRSDTVTRPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEMARITGKEAGLFV  61

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGIST+GGVHPRT+KNN+DGTMDLD
Sbjct  62   PSGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDLD  121

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIRDP FEIC+PTTRLICL
Sbjct  122  LIEAAIRDPSFEICYPTTRLICL  144



>ref|NP_001275261.1| L-allo-threonine aldolase-related protein [Solanum tuberosum]
 ref|XP_006361424.1| PREDICTED: uncharacterized protein R102.4 isoform X5 [Solanum 
tuberosum]
 ref|XP_006361425.1| PREDICTED: uncharacterized protein R102.4 isoform X6 [Solanum 
tuberosum]
 gb|ABB72802.1| L-allo-threonine aldolase-related protein [Solanum tuberosum]
Length=359

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTEAMR AMA+AEVDDDVLG+DPTAQRLEAE+A+I GKEAGLFVP
Sbjct  1    MVVRTVDLRSDTVTKPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEMARITGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGIST+GGVHPRT+KNN+DGTMDLD 
Sbjct  61   SGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDLDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP FEIC+PTTRLICL
Sbjct  121  IEAAIRDPSFEICYPTTRLICL  142



>ref|XP_004236787.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_004236788.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
 ref|XP_004236789.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Solanum lycopersicum]
Length=359

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVT+PTEAMR AMA+AEVDDDVLG+DPTAQRLEAE+A+I GKEAGLFVP
Sbjct  1    MVVRTVDLRSDTVTRPTEAMRNAMANAEVDDDVLGYDPTAQRLEAEMARITGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVLTHC IRGSEIILGDYSHIHIYENGGIST+GGVHPRT+KNN+DGTMDLD 
Sbjct  61   SGTMGNLISVLTHCQIRGSEIILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDLDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP FEIC+PTTRLICL
Sbjct  121  IEAAIRDPSFEICYPTTRLICL  142



>ref|XP_011101617.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Sesamum 
indicum]
 ref|XP_011101618.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Sesamum 
indicum]
Length=359

 Score =   262 bits (670),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTE MRAAMASAEVDDDVLG+DPTA RLE E+A+IMGKEA LFVP
Sbjct  1    MVTRRVDLRSDTVTKPTETMRAAMASAEVDDDVLGYDPTAARLETEMARIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLI VLTHC IRGSE+ILGDYSHIHIYENGGISTIGGVHPRT+KNN+DGTMD++ 
Sbjct  61   SGTMANLICVLTHCQIRGSEVILGDYSHIHIYENGGISTIGGVHPRTVKNNEDGTMDINL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IE AIRDP FEIC+PTTRLICL
Sbjct  121  IEEAIRDPSFEICYPTTRLICL  142



>gb|EPS60604.1| hypothetical protein M569_14199, partial [Genlisea aurea]
Length=322

 Score =   259 bits (661),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV + VDLRSDTVTKPT+ MRAAMA AEVDDDVLG DPTA RLE E+AKIMGKEA LF P
Sbjct  1    MVMKKVDLRSDTVTKPTQTMRAAMADAEVDDDVLGKDPTAARLELEMAKIMGKEAALFTP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVLTHC IRGSE+ILGDYSHIHIYENGGISTIGGVHPRT+KN DDGTMD+D 
Sbjct  61   SGTMANLISVLTHCQIRGSEVILGDYSHIHIYENGGISTIGGVHPRTVKNTDDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPRFEIC+PTTRLICL
Sbjct  121  IEAAIRDPRFEICYPTTRLICL  142



>ref|XP_008456444.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
Length=358

 Score =   259 bits (662),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVL +DPTA RLE E+AKIMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLKYDPTALRLETEMAKIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDNSHIHIYENGGIATIGGVHPRTVRNNGDGTMDLDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR EI FPTTRLICL
Sbjct  121  IEAAIRDPRGEIVFPTTRLICL  142



>gb|EYU19887.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19888.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19889.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
 gb|EYU19890.1| hypothetical protein MIMGU_mgv1a008896mg [Erythranthe guttata]
Length=359

 Score =   259 bits (661),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAMASA+VDDDVLG DPTA RLE E+AKIMGKEA LFVP
Sbjct  1    MVTRRVDLRSDTVTKPTEAMRAAMASADVDDDVLGHDPTAARLEKEMAKIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLI VLTHC IRGSE+ILGDYSHIHIYENGGIST+GGVHPRT+KNN+DGTMD+  
Sbjct  61   SGTMANLICVLTHCQIRGSEVILGDYSHIHIYENGGISTLGGVHPRTVKNNEDGTMDIQL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IE AIRDP FEIC+PTTRLICL
Sbjct  121  IEEAIRDPSFEICYPTTRLICL  142



>gb|KDO44518.1| hypothetical protein CISIN_1g0182432mg, partial [Citrus sinensis]
 gb|KDO44519.1| hypothetical protein CISIN_1g0182432mg, partial [Citrus sinensis]
Length=185

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVL  DPTA RLE E+AK+MGKEAGLFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLMHDPTAFRLETEMAKVMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC  RGSE+ILGD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVILGDNSHIHIYENGGISTIGGVHPRTVKNNQDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ EI +PTTRLICL
Sbjct  121  IEAAIRDPKGEIVYPTTRLICL  142



>ref|XP_006442684.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442685.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442686.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442687.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55924.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55925.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55926.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55927.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
Length=297

 Score =   255 bits (652),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVL  DPTA RLE E+AK+MGKEAGLFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLMHDPTAFRLETEMAKVMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC  RGSE+ILGD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVILGDNSHIHIYENGGISTIGGVHPRTVKNNKDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ EI +PTTRLICL
Sbjct  121  IEAAIRDPKGEIVYPTTRLICL  142



>gb|AGI05087.1| threonine aldolase, partial [Gossypium aridum]
Length=273

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+TVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DPTA RLE+E+AKIMGKEAGLFV 
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMATAEVDDDVLGADPTAARLESEVAKIMGKEAGLFVA  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD  HIHIYENGGISTIGGVHPR +KNNDDGTMD+  
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNCHIHIYENGGISTIGGVHPRPVKNNDDGTMDIGL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR EI +PTTRLICL
Sbjct  121  IEAAIRDPRGEIVYPTTRLICL  142



>ref|XP_004139254.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
 gb|KGN60769.1| hypothetical protein Csa_2G009560 [Cucumis sativus]
Length=359

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTEAMRAAMASAEVDDDVL +DPTA RLE E+AKIMGKEA LFVP
Sbjct  1    MVKRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLKYDPTALRLETEMAKIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDNSHIHIYENGGIATIGGVHPRTVRNNGDGTMDLDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ FPTTRLICL
Sbjct  121  IEAAIRDPRGELVFPTTRLICL  142



>ref|XP_004170828.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=359

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTEAMRAAMASAEVDDDVL +DPTA RLE E+AKIMGKEA LFVP
Sbjct  1    MVKRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLKYDPTALRLETEMAKIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDNSHIHIYENGGIATIGGVHPRTVRNNGDGTMDLDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ FPTTRLICL
Sbjct  121  IEAAIRDPRGELVFPTTRLICL  142



>ref|XP_006487715.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487716.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Citrus 
sinensis]
 ref|XP_006487717.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Citrus 
sinensis]
 ref|XP_006487718.1| PREDICTED: uncharacterized protein R102.4-like isoform X4 [Citrus 
sinensis]
Length=359

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVL  DPTA RLE E+AK+MGKEAGLFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLMHDPTAFRLETEMAKVMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+I+GD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEIRGSEVIIGDNSHIHIYENGGISTIGGVHPRTVKNNQDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ EI +PTTRLICL
Sbjct  121  IEAAIRDPKGEIVYPTTRLICL  142



>ref|XP_008388713.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Malus domestica]
Length=371

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +2

Query  197  WFSRRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKE  376
             FS  KMVTRTVDLRSDTVTKP E MRAAMASAEVDDDVLG DPTA RLE+E+AK+MGKE
Sbjct  7    LFSSPKMVTRTVDLRSDTVTKPCETMRAAMASAEVDDDVLGADPTAFRLESEMAKVMGKE  66

Query  377  AGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDG  556
            A LFVPSGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGI+TIGGVHPRT++NN DG
Sbjct  67   AALFVPSGTMGNLISVLVHCDIRGSEVILGHNSHIHIYENGGIATIGGVHPRTVRNNKDG  126

Query  557  TMDLDQIEAAIRDPRFEICFPTTRLICL  640
            TMDLD IEA+IRDPR E+ +PTTRLICL
Sbjct  127  TMDLDAIEASIRDPRGELVYPTTRLICL  154



>gb|KHG00003.1| ltaA [Gossypium arboreum]
Length=326

 Score =   255 bits (651),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+TVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DPTA RLE+E+AKIMGKEAGLFV 
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMATAEVDDDVLGADPTAARLESEVAKIMGKEAGLFVA  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD  HIHIYENGGISTIGGVHPR +KNNDDGTMD+  
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNCHIHIYENGGISTIGGVHPRPVKNNDDGTMDIGL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR EI +PTTRLICL
Sbjct  121  IEAAIRDPRGEIVYPTTRLICL  142



>gb|KHG00004.1| ltaA [Gossypium arboreum]
Length=362

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 144/176 (82%), Gaps = 8/176 (5%)
 Frame = +2

Query  137  FLSFAFLIRKGTEQSSQFHL-----WFSRRK---MVTRTVDLRSDTVTKPTEAMRAAMAS  292
            FLSF  +    +    +F L     ++ ++K   MVT+TVDLRSDTVTKPTEAMRAAMA+
Sbjct  3    FLSFLGISSTCSWYGIKFPLGGRENFYQKKKCKTMVTKTVDLRSDTVTKPTEAMRAAMAT  62

Query  293  AEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDY  472
            AEVDDDVLG DPTA RLE+E+AKIMGKEAGLFV SGTMGNLISVL HC IRGSE+ILGD 
Sbjct  63   AEVDDDVLGADPTAARLESEVAKIMGKEAGLFVASGTMGNLISVLVHCDIRGSEVILGDN  122

Query  473  SHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICL  640
             HIHIYENGGISTIGGVHPR +KNNDDGTMD+  IEAAIRDPR EI +PTTRLICL
Sbjct  123  CHIHIYENGGISTIGGVHPRPVKNNDDGTMDIGLIEAAIRDPRGEIVYPTTRLICL  178



>ref|XP_002325334.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
 gb|EEE99715.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
Length=359

 Score =   256 bits (653),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMA+AEVDDDVL +DP+A RLE E+AK+ GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLSYDPSALRLETEMAKVTGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL+SVL HC IRGSE+ILG+ SHIHIYENGGISTIGGVHPRT+KNNDDGTMD+D 
Sbjct  61   SGTMGNLVSVLVHCNIRGSEVILGNNSHIHIYENGGISTIGGVHPRTVKNNDDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR EI +PTTRLICL
Sbjct  121  IEAAIRDPRGEIVYPTTRLICL  142



>ref|XP_011038517.1| PREDICTED: LOW QUALITY PROTEIN: probable low-specificity L-threonine 
aldolase 1 [Populus euphratica]
Length=356

 Score =   255 bits (652),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTV+KPTEAMRAAMA+AEVDDDVLG DP+A RLE E+AKIMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVSKPTEAMRAAMANAEVDDDVLGHDPSALRLETEMAKIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC IRGSE+ILG+ SHIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMSNLISVLVHCNIRGSEVILGNKSHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR EI +PTTRLICL
Sbjct  121  IEAAIRDPRGEIVYPTTRLICL  142



>ref|XP_006442676.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442677.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442678.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442679.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442680.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442681.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442682.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 ref|XP_006442683.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55916.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55917.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55918.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55919.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55920.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55921.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55922.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
 gb|ESR55923.1| hypothetical protein CICLE_v10020798mg [Citrus clementina]
Length=359

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVL  DPTA RLE E+AK+MGKEAGLFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLMHDPTAFRLETEMAKVMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC  RGSE+ILGD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVILGDNSHIHIYENGGISTIGGVHPRTVKNNKDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ EI +PTTRLICL
Sbjct  121  IEAAIRDPKGEIVYPTTRLICL  142



>gb|KCW61514.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=209

 Score =   250 bits (638),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLFVP
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+  + +PTTRLICL
Sbjct  121  IEAAIRDPKGALVYPTTRLICL  142



>gb|KCW61513.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=246

 Score =   251 bits (641),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLFVP
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+  + +PTTRLICL
Sbjct  121  IEAAIRDPKGALVYPTTRLICL  142



>ref|XP_002319106.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
 gb|EEE95029.2| L-allo-threonine aldolase-related family protein [Populus trichocarpa]
Length=356

 Score =   254 bits (650),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTV+KPTEAMRAAMA+AEVDDDVLG DP+A RLE E+AKIMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVSKPTEAMRAAMANAEVDDDVLGHDPSALRLETEMAKIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC IRGSE+ILG  SHIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMSNLISVLVHCNIRGSEVILGSKSHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR EI +PTTRLICL
Sbjct  121  IEAAIRDPRGEIVYPTTRLICL  142



>gb|KCW61508.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=362

 Score =   254 bits (650),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  209  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  388
            +KMVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLF
Sbjct  3    KKMVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLF  62

Query  389  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  568
            VPSGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+
Sbjct  63   VPSGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDI  122

Query  569  DQIEAAIRDPRFEICFPTTRLICL  640
            D IEAAIRDP+  + +PTTRLICL
Sbjct  123  DLIEAAIRDPKGALVYPTTRLICL  146



>ref|XP_009795458.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nicotiana 
sylvestris]
Length=372

 Score =   254 bits (650),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M  RTVD RSDTVTKPTE+MR AMA+AEVDDDVLG+DPTAQRLEAE+A+IMGKEAGLFVP
Sbjct  1    MAVRTVDFRSDTVTKPTESMRNAMANAEVDDDVLGYDPTAQRLEAEMARIMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI +LTHC IRGSE+ILGD SHIH+YENGGISTIGGVHPRT+KNN+DGTMDL  
Sbjct  61   SGTMGNLICLLTHCQIRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNNEDGTMDLHL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRD  FEI +PTTRLICL
Sbjct  121  IEAAIRDSSFEILYPTTRLICL  142



>gb|KCW61512.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=275

 Score =   251 bits (642),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLFVP
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+  + +PTTRLICL
Sbjct  121  IEAAIRDPKGALVYPTTRLICL  142



>ref|XP_007030425.1| Threonine aldolase 1 isoform 6 [Theobroma cacao]
 gb|EOY10927.1| Threonine aldolase 1 isoform 6 [Theobroma cacao]
Length=319

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAM +AEVDDDVLG DPTA +LE+E+AKIMGKEAGLFVP
Sbjct  1    MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ +PTTRLICL
Sbjct  121  IEAAIRDPRGELVYPTTRLICL  142



>ref|XP_007030422.1| Threonine aldolase 1 isoform 3, partial [Theobroma cacao]
 gb|EOY10924.1| Threonine aldolase 1 isoform 3, partial [Theobroma cacao]
Length=355

 Score =   253 bits (645),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAM +AEVDDDVLG DPTA +LE+E+AKIMGKEAGLFVP
Sbjct  1    MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ +PTTRLICL
Sbjct  121  IEAAIRDPRGELVYPTTRLICL  142



>ref|XP_007030420.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030421.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 gb|EOY10922.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
 gb|EOY10923.1| Threonine aldolase 1 isoform 1 [Theobroma cacao]
Length=358

 Score =   252 bits (644),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAM +AEVDDDVLG DPTA +LE+E+AKIMGKEAGLFVP
Sbjct  1    MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ +PTTRLICL
Sbjct  121  IEAAIRDPRGELVYPTTRLICL  142



>ref|XP_007030424.1| Threonine aldolase 1 isoform 5 [Theobroma cacao]
 gb|EOY10926.1| Threonine aldolase 1 isoform 5 [Theobroma cacao]
Length=357

 Score =   252 bits (644),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAM +AEVDDDVLG DPTA +LE+E+AKIMGKEAGLFVP
Sbjct  1    MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ +PTTRLICL
Sbjct  121  IEAAIRDPRGELVYPTTRLICL  142



>gb|KDP40730.1| hypothetical protein JCGZ_24729 [Jatropha curcas]
Length=160

 Score =   245 bits (626),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DP A RL+ E+A+IMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLGDDPNALRLQTEMARIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGIST+GGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHDSHIHIYENGGISTLGGVHPRTVKNNKDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP++++ +PTTRLICL
Sbjct  121  IEAAIRDPKWQLVYPTTRLICL  142



>gb|KJB44862.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=413

 Score =   254 bits (648),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 136/165 (82%), Gaps = 9/165 (5%)
 Frame = +2

Query  173  EQSSQFH------LWFS---RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFD  325
            E SS  H      +WFS      MV RTVDLRSDTVTKPTE MRAAMA+AEVDDDVLG D
Sbjct  25   ETSSTCHGINSQIIWFSTLNSSTMVARTVDLRSDTVTKPTETMRAAMATAEVDDDVLGAD  84

Query  326  PTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGI  505
            PTA RLE+E+AKI GKEAGLFV SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI
Sbjct  85   PTAFRLESEVAKITGKEAGLFVSSGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGI  144

Query  506  STIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICL  640
            STIGGVHPR +KNN+DGTMD+D IE AIRDPR E+ FPTT+LICL
Sbjct  145  STIGGVHPRPVKNNEDGTMDIDSIEVAIRDPRGELVFPTTKLICL  189



>gb|ACJ85466.1| unknown [Medicago truncatula]
Length=221

 Score =   247 bits (631),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  209  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  388
             KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LF
Sbjct  14   EKMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALF  73

Query  389  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  568
            VPSGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+
Sbjct  74   VPSGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDI  133

Query  569  DQIEAAIRDPRFEICFPTTRLICL  640
            D IEAAIRDPR E+ FP+TRLICL
Sbjct  134  DLIEAAIRDPRGELMFPSTRLICL  157



>gb|KJB44861.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=417

 Score =   254 bits (648),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 136/165 (82%), Gaps = 9/165 (5%)
 Frame = +2

Query  173  EQSSQFH------LWFS---RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFD  325
            E SS  H      +WFS      MV RTVDLRSDTVTKPTE MRAAMA+AEVDDDVLG D
Sbjct  25   ETSSTCHGINSQIIWFSTLNSSTMVARTVDLRSDTVTKPTETMRAAMATAEVDDDVLGAD  84

Query  326  PTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGI  505
            PTA RLE+E+AKI GKEAGLFV SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI
Sbjct  85   PTAFRLESEVAKITGKEAGLFVSSGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGI  144

Query  506  STIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICL  640
            STIGGVHPR +KNN+DGTMD+D IE AIRDPR E+ FPTT+LICL
Sbjct  145  STIGGVHPRPVKNNEDGTMDIDSIEVAIRDPRGELVFPTTKLICL  189



>gb|KJB82283.1| hypothetical protein B456_013G187300 [Gossypium raimondii]
 gb|KJB82284.1| hypothetical protein B456_013G187300 [Gossypium raimondii]
Length=358

 Score =   252 bits (643),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT++VDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DPTA RLE+E AKIMGKEAGLFV 
Sbjct  1    MVTKSVDLRSDTVTKPTEAMRAAMATAEVDDDVLGADPTAARLESEAAKIMGKEAGLFVA  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD  HIHIYENGGISTIGGVHPR +KNNDDGTMD+  
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNCHIHIYENGGISTIGGVHPRPVKNNDDGTMDIGL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR EI +PTTRLICL
Sbjct  121  IEAAIRDPRGEIVYPTTRLICL  142



>ref|XP_007205422.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 ref|XP_007205423.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 gb|EMJ06621.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
 gb|EMJ06622.1| hypothetical protein PRUPE_ppa007684mg [Prunus persica]
Length=359

 Score =   252 bits (643),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+TVDLRSDTVTKPTE MRAAMASAEVDDDVLG DPTA RLE+E+AKI GKEA LFVP
Sbjct  1    MVTKTVDLRSDTVTKPTETMRAAMASAEVDDDVLGNDPTAFRLESEMAKITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGISTIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHNSHIHIYENGGISTIGGVHPRTVRNNKDGTMDLDS  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ +PTTRLICL
Sbjct  121  IEAAIRDPRGELVYPTTRLICL  142



>ref|XP_008388714.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
 ref|XP_008388715.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
 ref|XP_008388716.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Malus domestica]
Length=359

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKP E MRAAMASAEVDDDVLG DPTA RLE+E+AK+MGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPCETMRAAMASAEVDDDVLGADPTAFRLESEMAKVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGI+TIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHNSHIHIYENGGIATIGGVHPRTVRNNKDGTMDLDA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEA+IRDPR E+ +PTTRLICL
Sbjct  121  IEASIRDPRGELVYPTTRLICL  142



>ref|XP_010024956.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024958.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024959.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024960.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024961.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024962.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 ref|XP_010024963.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Eucalyptus 
grandis]
 gb|KCW61509.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
 gb|KCW61510.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=358

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLFVP
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+  + +PTTRLICL
Sbjct  121  IEAAIRDPKGALVYPTTRLICL  142



>ref|XP_008218319.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218320.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218321.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218322.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
 ref|XP_008218323.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Prunus 
mume]
Length=359

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+TVDLRSDTVTKPTE MRAAMASAEVDDDVLG DPTA RLE+E+AKI GKEA LFVP
Sbjct  1    MVTKTVDLRSDTVTKPTETMRAAMASAEVDDDVLGNDPTAFRLESEMAKITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGIST+GGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHNSHIHIYENGGISTLGGVHPRTVRNNKDGTMDLDS  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ +PTTRLICL
Sbjct  121  IEAAIRDPRGELVYPTTRLICL  142



>ref|XP_007030423.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 ref|XP_007030426.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 gb|EOY10925.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
 gb|EOY10928.1| L-allo-threonine aldolase isoform 4 [Theobroma cacao]
Length=359

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAM +AEVDDDVLG DPTA +LE+E+AKIMGKEAGLFVP
Sbjct  1    MVTRMVDLRSDTVTKPTEAMRAAMVTAEVDDDVLGADPTAFQLESEVAKIMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDINL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ +PTTRLICL
Sbjct  121  IEAAIRDPRGELVYPTTRLICL  142



>ref|XP_004495576.1| PREDICTED: L-allo-threonine aldolase-like isoform X1 [Cicer arietinum]
Length=370

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLG DPTA  LE E+AKIMGKEA LFV
Sbjct  15   KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGNDPTAFLLETEMAKIMGKEAALFV  74

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLI VL HC IRGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNNDDGTMD+D
Sbjct  75   PSGTMGNLICVLVHCDIRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNDDGTMDID  134

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEA IR+PR+++ +PTTRLICL
Sbjct  135  LIEANIRNPRWDLMYPTTRLICL  157



>gb|KCW61511.1| hypothetical protein EUGRSUZ_H04236 [Eucalyptus grandis]
Length=365

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+TVDLRSDTVTKPTEAMRAAMA AEVDDDVL  DPTAQRLE E+AKI GKEAGLFVP
Sbjct  1    MVTKTVDLRSDTVTKPTEAMRAAMADAEVDDDVLCCDPTAQRLETEVAKITGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+  + +PTTRLICL
Sbjct  121  IEAAIRDPKGALVYPTTRLICL  142



>gb|KJB44863.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=339

 Score =   249 bits (637),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTE MRAAMA+AEVDDDVLG DPTA RLE+E+AKI GKEAGLFV 
Sbjct  1    MVARTVDLRSDTVTKPTETMRAAMATAEVDDDVLGADPTAFRLESEVAKITGKEAGLFVS  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDIDS  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IE AIRDPR E+ FPTT+LICL
Sbjct  121  IEVAIRDPRGELVFPTTKLICL  142



>gb|KJB44860.1| hypothetical protein B456_007G276400 [Gossypium raimondii]
Length=370

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTE MRAAMA+AEVDDDVLG DPTA RLE+E+AKI GKEAGLFV 
Sbjct  1    MVARTVDLRSDTVTKPTETMRAAMATAEVDDDVLGADPTAFRLESEVAKITGKEAGLFVS  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGISTIGGVHPR +KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGISTIGGVHPRPVKNNEDGTMDIDS  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IE AIRDPR E+ FPTT+LICL
Sbjct  121  IEVAIRDPRGELVFPTTKLICL  142



>ref|XP_004495577.1| PREDICTED: L-allo-threonine aldolase-like isoform X2 [Cicer arietinum]
Length=355

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLG DPTA  LE E+AKIMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGNDPTAFLLETEMAKIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI VL HC IRGSE+ILGD  HIHIYENGGISTIGGVHPRT+KNNDDGTMD+D 
Sbjct  61   SGTMGNLICVLVHCDIRGSEVILGDNCHIHIYENGGISTIGGVHPRTVKNNDDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEA IR+PR+++ +PTTRLICL
Sbjct  121  IEANIRNPRWDLMYPTTRLICL  142



>ref|XP_002521974.1| l-allo-threonine aldolase, putative [Ricinus communis]
 gb|EEF40378.1| l-allo-threonine aldolase, putative [Ricinus communis]
Length=358

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG+DP+A RLE E+AKIMGKEA L+VP
Sbjct  1    MVMRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLGYDPSAFRLETEMAKIMGKEAALYVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILG  SHIHI+ENGGIST+GGVHPRT++NN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCNIRGSEVILGHNSHIHIFENGGISTLGGVHPRTVQNNKDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ +PTTRLICL
Sbjct  121  IEAAIRDPRGELVYPTTRLICL  142



>ref|XP_011036295.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036297.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036298.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036299.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
 ref|XP_011036300.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Populus 
euphratica]
Length=359

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTEAMRAAMA+AEVDDDVL  DP+A RLE E+AK+ GKEA LFVP
Sbjct  1    MVARTVDLRSDTVTKPTEAMRAAMANAEVDDDVLSHDPSALRLETEMAKVTGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL+SVL HC IRGSE+ILG+  HIHI+ENGGISTIGGVHPRT+KNNDDGTMD+D 
Sbjct  61   SGTMGNLVSVLVHCNIRGSEVILGNNCHIHIFENGGISTIGGVHPRTVKNNDDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR EI FPTTRLICL
Sbjct  121  IEAAIRDPRGEIVFPTTRLICL  142



>ref|XP_009364444.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
 ref|XP_009364445.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
 ref|XP_009364446.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Pyrus 
x bretschneideri]
Length=359

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKP E MR AMASAEVDDDVLG DPTA RLE+E+AK+MGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPCETMRTAMASAEVDDDVLGADPTAFRLESEMAKVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILG  SHIH+YENGGI+TIGGVHPRT++NN DGTMDLD 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHNSHIHVYENGGIATIGGVHPRTVRNNKDGTMDLDA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEA+IRDPR E+ +PTTRLICL
Sbjct  121  IEASIRDPRGELVYPTTRLICL  142



>gb|KDP23711.1| hypothetical protein JCGZ_23544 [Jatropha curcas]
Length=354

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DP A RL+ E+A+IMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANAEVDDDVLGDDPNALRLQTEMARIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILG  SHIHIYENGGIST+GGVHPRT+KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGHDSHIHIYENGGISTLGGVHPRTVKNNKDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP++++ +PTTRLICL
Sbjct  121  IEAAIRDPKWQLVYPTTRLICL  142



>ref|XP_003590972.1| L-allo-threonine aldolase [Medicago truncatula]
 gb|AES61223.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=370

 Score =   249 bits (636),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFV
Sbjct  15   KMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFV  74

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+D
Sbjct  75   PSGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDID  134

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIRDPR E+ FP+TRLICL
Sbjct  135  LIEAAIRDPRGELMFPSTRLICL  157



>ref|XP_003590973.1| L-allo-threonine aldolase [Medicago truncatula]
 gb|AES61224.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=396

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFV
Sbjct  41   KMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFV  100

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+D
Sbjct  101  PSGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDID  160

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIRDPR E+ FP+TRLICL
Sbjct  161  LIEAAIRDPRGELMFPSTRLICL  183



>gb|AES61221.2| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=355

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFVP
Sbjct  1    MVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+D 
Sbjct  61   SGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ FP+TRLICL
Sbjct  121  IEAAIRDPRGELMFPSTRLICL  142



>gb|ACJ84635.1| unknown [Medicago truncatula]
Length=166

 Score =   241 bits (614),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTE MR AMA+AEVDDDVLG DP+  RLE E+AKI GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTETMRVAMANAEVDDDVLGRDPSCFRLEEEMAKITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHPRT++NN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPRTVRNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ E+ +PTTRLICL
Sbjct  121  IEAAIRDPKGELVYPTTRLICL  142



>ref|XP_010694951.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010694952.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Beta 
vulgaris subsp. vulgaris]
Length=371

 Score =   248 bits (632),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            +MV R VD+RSDTVTKPTEAMRAAMA AEVDDDVLG+DPTA RLE E+A+IMGKEAGLFV
Sbjct  12   EMVKRVVDMRSDTVTKPTEAMRAAMAIAEVDDDVLGYDPTALRLETEMARIMGKEAGLFV  71

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLI VL HC +RGSE+ILGD SHIHIYENGGIST+GGVHPRT+KNN DGTMDLD
Sbjct  72   PSGTMGNLICVLVHCDVRGSEVILGDISHIHIYENGGISTLGGVHPRTVKNNIDGTMDLD  131

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIRDP+ E+ +P TRLIC+
Sbjct  132  LIEAAIRDPKGELYYPRTRLICI  154



>gb|KJB46043.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
 gb|KJB46044.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
Length=358

 Score =   247 bits (631),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M TRTVDLRSDTVTKPTEAMRAAMA+AEVDDDV G DPTA +L++E+AK+MGKEAGLFVP
Sbjct  1    MATRTVDLRSDTVTKPTEAMRAAMATAEVDDDVFGADPTAVKLQSEVAKMMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILG+ SHIHIYENGGI+TIGGVHPR +KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGNNSHIHIYENGGIATIGGVHPRPVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IE AIRDPR E+ +PTTRLICL
Sbjct  121  IEDAIRDPRGELVYPTTRLICL  142



>ref|XP_002266992.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_003633695.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_003633696.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
 ref|XP_010660226.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Vitis 
vinifera]
Length=364

 Score =   247 bits (631),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTE MRAAMA AEVDDDVL  DPTA+RLE E+A+I GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTETMRAAMAIAEVDDDVLVCDPTAERLETEMARITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIHIYENGGIST+GGVHPRT+KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHIYENGGISTLGGVHPRTVKNNEDGTMDINL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ +PTTRLICL
Sbjct  121  IEAAIRDPRGELVYPTTRLICL  142



>gb|KHG25609.1| L-allo-threonine aldolase [Gossypium arboreum]
Length=358

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M TRTVDLRSDTVTKPTEAMRAAMA+AEVDDDV G DPTA +L++E+AK+MGKEAGLFVP
Sbjct  1    MATRTVDLRSDTVTKPTEAMRAAMATAEVDDDVFGADPTAVKLQSEVAKMMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILG+ SHIHIYENGGI+TIGGVHPR +KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGNNSHIHIYENGGIATIGGVHPRPVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IE AIRDPR E+ +PTTRLICL
Sbjct  121  IEDAIRDPRGELVYPTTRLICL  142



>ref|XP_008802139.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Phoenix dactylifera]
Length=359

 Score =   246 bits (629),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKPTEAMRAAMASA+VDDDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  1    MVMRIVDLRSDTVTKPTEAMRAAMASADVDDDVLGSDPTAHRFESEMARVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMDLDQ
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDLDQ  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR P   + +PTTRLICL
Sbjct  121  IEAAIRHPEGALYYPTTRLICL  142



>ref|XP_003590970.1| L-allo-threonine aldolase [Medicago truncatula]
Length=463

 Score =   249 bits (636),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFV
Sbjct  57   KMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFV  116

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+D
Sbjct  117  PSGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDID  176

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIRDPR E+ FP+TRLICL
Sbjct  177  LIEAAIRDPRGELMFPSTRLICL  199



>ref|XP_008802141.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Phoenix dactylifera]
Length=333

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKPTEAMRAAMASA+VDDDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  1    MVMRIVDLRSDTVTKPTEAMRAAMASADVDDDVLGSDPTAHRFESEMARVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMDLDQ
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDLDQ  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR P   + +PTTRLICL
Sbjct  121  IEAAIRHPEGALYYPTTRLICL  142



>gb|AFK38526.1| unknown [Medicago truncatula]
Length=370

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFV
Sbjct  15   KMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFV  74

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLI VL HC IRGSE+ILGD   I+IYENGGISTIGGVHPR +KNNDDGT+D+D
Sbjct  75   PSGTMGNLICVLVHCDIRGSEVILGDNCRINIYENGGISTIGGVHPRQVKNNDDGTIDID  134

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIRDPR E+ FP+TRLICL
Sbjct  135  LIEAAIRDPRGELMFPSTRLICL  157



>gb|KJB46045.1| hypothetical protein B456_007G345500 [Gossypium raimondii]
Length=388

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M TRTVDLRSDTVTKPTEAMRAAMA+AEVDDDV G DPTA +L++E+AK+MGKEAGLFVP
Sbjct  1    MATRTVDLRSDTVTKPTEAMRAAMATAEVDDDVFGADPTAVKLQSEVAKMMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILG+ SHIHIYENGGI+TIGGVHPR +KNN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGNNSHIHIYENGGIATIGGVHPRPVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IE AIRDPR E+ +PTTRLICL
Sbjct  121  IEDAIRDPRGELVYPTTRLICL  142



>gb|AFK43649.1| unknown [Lotus japonicus]
Length=358

 Score =   245 bits (625),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M TRTVDLRSDTVTKPTEAMR AMA+A+VDDDVLG DPT  RLE E+AKIMGKEA LFVP
Sbjct  1    MATRTVDLRSDTVTKPTEAMRTAMANADVDDDVLGHDPTCFRLETEMAKIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVHPRT++NN+DGTMD+D 
Sbjct  61   SGTMANLISVLVHCDIRGSEVILGDNSHIHIYENGGIATIGGVHPRTVRNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR+P  E+ +PTTRLICL
Sbjct  121  IEAAIRNPNLELIYPTTRLICL  142



>gb|KGN66767.1| hypothetical protein Csa_1G681130 [Cucumis sativus]
Length=229

 Score =   240 bits (613),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE E+AKIMGKE GLFVP
Sbjct  1    MVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEEMAKIMGKEEGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR+P+ ++ FPTTRLICL
Sbjct  121  IEAAIRNPKGQLFFPTTRLICL  142



>ref|XP_009389078.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Musa 
acuminata subsp. malaccensis]
Length=359

 Score =   244 bits (624),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMASA+VDDDVL  DPTAQR E E+A+IMGKEA +FVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMASADVDDDVLSGDPTAQRFEEEVARIMGKEAAVFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIHIYENGGIS+IGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHIYENGGISSIGGVHPRTVKNNPDGTMDIDR  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR P   + +PTTRLICL
Sbjct  121  IEAAIRHPDGALYYPTTRLICL  142



>ref|XP_007144017.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 ref|XP_007144018.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 gb|ESW16011.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
 gb|ESW16012.1| hypothetical protein PHAVU_007G122200g [Phaseolus vulgaris]
Length=365

 Score =   245 bits (625),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG DPTA RLEAE+AK MGKEA LFVP
Sbjct  1    MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGNDPTAFRLEAEMAKTMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI VL HC +RGSE+ILGD  HI+IYENGGI+TIGGVHPR +KNNDDGTMD+D 
Sbjct  61   SGTMGNLICVLVHCDVRGSEVILGDNCHIYIYENGGIATIGGVHPRPVKNNDDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IE AIRDPR E+ +PTT+LICL
Sbjct  121  IETAIRDPRGELLYPTTKLICL  142



>emb|CAN82414.1| hypothetical protein VITISV_039151 [Vitis vinifera]
Length=397

 Score =   245 bits (626),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTE MRAAMA AEVDDDVL  DPTA+RLE E+A+I GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTETMRAAMAIAEVDDDVLVCDPTAERLETEMARITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIHIYENGGIST+GGVHPRT+KNN+DGTMD++ 
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHIYENGGISTLGGVHPRTVKNNEDGTMDINL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDPR E+ +PTTRLICL
Sbjct  121  IEAAIRDPRGELVYPTTRLICL  142



>ref|XP_004151117.1| PREDICTED: L-allo-threonine aldolase-like, partial [Cucumis sativus]
Length=290

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE E+AKIMGKE GLFVP
Sbjct  1    MVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEEMAKIMGKEEGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR+P+ ++ FPTTRLICL
Sbjct  121  IEAAIRNPKGQLFFPTTRLICL  142



>gb|KEH24599.1| L-allo-threonine aldolase-like protein [Medicago truncatula]
Length=358

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTE MR AMA+AEVDDDVLG DP+  RLE E+AKI GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTETMRVAMANAEVDDDVLGRDPSCFRLEEEMAKITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHPRT++NN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPRTVRNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ E+ +PTTRLICL
Sbjct  121  IEAAIRDPKGELVYPTTRLICL  142



>gb|ACJ85157.1| unknown [Medicago truncatula]
 gb|AFK44463.1| unknown [Medicago truncatula]
Length=421

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPT   LE E+AK+MGKEA LFV
Sbjct  66   KMVTRNVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTVLLLETEMAKMMGKEAALFV  125

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLI VL HC IRGSE+ILGD  HI+IYENGGISTIGGVHPR  KNNDDGT+D+D
Sbjct  126  PSGTMGNLICVLVHCDIRGSEVILGDNCHINIYENGGISTIGGVHPRQAKNNDDGTIDID  185

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIRDPR E+ FP+TRLICL
Sbjct  186  LIEAAIRDPRGELMFPSTRLICL  208



>gb|KHN04944.1| L-allo-threonine aldolase [Glycine soja]
Length=360

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGK+A LFVP
Sbjct  1    MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKDAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGDTCHINIFENGGIATIGGVHPRQVKNNDDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP  E+ +PTT+LICL
Sbjct  121  IEAAIRDPMGELFYPTTKLICL  142



>ref|XP_010906812.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X4 [Elaeis guineensis]
 ref|XP_010906813.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X4 [Elaeis guineensis]
Length=359

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKPTEAMRAAMASA+V+DDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  1    MVMRRVDLRSDTVTKPTEAMRAAMASADVEDDVLGSDPTAHRFESEMARVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KN  DGTMDLDQ
Sbjct  61   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNKSDGTMDLDQ  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR P   + +PTTRLICL
Sbjct  121  IEAAIRHPEGALYYPTTRLICL  142



>ref|XP_004494746.1| PREDICTED: L-allo-threonine aldolase-like isoform X1 [Cicer arietinum]
 ref|XP_004494747.1| PREDICTED: L-allo-threonine aldolase-like isoform X2 [Cicer arietinum]
Length=358

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M TRTVD+RSDTVTKPTE+MR AMA+A+VDDDVLG DP+  RLE E+AKIMGKEAGLFVP
Sbjct  1    MATRTVDIRSDTVTKPTESMRVAMANADVDDDVLGRDPSCFRLENEVAKIMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYE GGI+TIGGVHPRT++NN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYELGGIATIGGVHPRTVRNNEDGTMDVDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ E+ +PTTRLICL
Sbjct  121  IEAAIRDPKAELAYPTTRLICL  142



>ref|XP_010906811.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X3 [Elaeis guineensis]
Length=365

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKPTEAMRAAMASA+V+DDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  7    MVMRRVDLRSDTVTKPTEAMRAAMASADVEDDVLGSDPTAHRFESEMARVMGKEAALFVP  66

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KN  DGTMDLDQ
Sbjct  67   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNKSDGTMDLDQ  126

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR P   + +PTTRLICL
Sbjct  127  IEAAIRHPEGALYYPTTRLICL  148



>ref|NP_001242307.1| uncharacterized protein LOC100790890 [Glycine max]
 gb|ACU17690.1| unknown [Glycine max]
Length=360

 Score =   243 bits (620),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGKEA LFVP
Sbjct  1    MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL+SVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGT+D+D 
Sbjct  61   SGTMGNLVSVLVHCDVRGSEVILGDNCHINIFENGGIATIGGVHPRQVKNNDDGTIDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP  E+ +PTT+LICL
Sbjct  121  IEAAIRDPMGELFYPTTKLICL  142



>gb|AFK40044.1| unknown [Medicago truncatula]
Length=358

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTE MR AMA+AEVDDDVLG DP+  RLE E+AKI GKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTETMRVAMANAEVDDDVLGRDPSCFRLEEEMAKITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHPRT++NN+DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPRTVRNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ E+ +PTTRLICL
Sbjct  121  IEAAIRDPKGELVYPTTRLICL  142



>ref|XP_006588445.1| PREDICTED: uncharacterized protein LOC100790890 isoform X1 [Glycine 
max]
 gb|KHN14818.1| L-allo-threonine aldolase [Glycine soja]
Length=360

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGKEA LFVP
Sbjct  1    MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL+SVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGT+D+D 
Sbjct  61   SGTMGNLVSVLVHCDVRGSEVILGDNCHINIFENGGIATIGGVHPRQVKNNDDGTIDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP  E+ +PTT+LICL
Sbjct  121  IEAAIRDPMGELFYPTTKLICL  142



>ref|XP_006606452.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Glycine 
max]
Length=390

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGL  385
            +  MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGK+A L
Sbjct  8    QENMVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKDAAL  67

Query  386  FVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMD  565
            FVPSGTMGNLISVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGTMD
Sbjct  68   FVPSGTMGNLISVLVHCDVRGSEVILGDTCHINIFENGGIATIGGVHPRQVKNNDDGTMD  127

Query  566  LDQIEAAIRDPRFEICFPTTRLICL  640
            +D IEAAIRDP  E+ +PTT+LICL
Sbjct  128  IDLIEAAIRDPMGELFYPTTKLICL  152



>ref|XP_010246795.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Nelumbo 
nucifera]
Length=358

 Score =   242 bits (618),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKPTEAMRAAMA+AEVDDDVLG DPTA R EAEIA+I GKEA LFVP
Sbjct  1    MVVRKVDLRSDTVTKPTEAMRAAMANAEVDDDVLGADPTACRFEAEIARITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIH+YENGGISTIG VH RT+KNN DGTMD+  
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDISHIHVYENGGISTIGHVHSRTVKNNSDGTMDISL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ E+ +PTTRLICL
Sbjct  121  IEAAIRDPKGELFYPTTRLICL  142



>ref|XP_006606453.1| PREDICTED: uncharacterized protein R102.4-like isoform X4 [Glycine 
max]
Length=380

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGK+A LFVP
Sbjct  1    MVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKDAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGDTCHINIFENGGIATIGGVHPRQVKNNDDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP  E+ +PTT+LICL
Sbjct  121  IEAAIRDPMGELFYPTTKLICL  142



>ref|XP_008453668.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X3 [Cucumis melo]
Length=382

 Score =   243 bits (619),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE ++AKIMGKE GLFV
Sbjct  42   KMVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEKMAKIMGKEGGLFV  101

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLIS+L HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D
Sbjct  102  PSGTMGNLISILVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDID  161

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIR+P+ ++ FPTTRLICL
Sbjct  162  LIEAAIRNPKGQLFFPTTRLICL  184



>ref|XP_004155692.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=358

 Score =   242 bits (617),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE E+AKIMGKE GLFVP
Sbjct  1    MVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEEMAKIMGKEEGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D 
Sbjct  61   SGTMGNLISVLVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR+P+ ++ FPTTRLICL
Sbjct  121  IEAAIRNPKGQLFFPTTRLICL  142



>ref|XP_003556456.2| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Glycine 
max]
Length=421

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGL  385
            +  MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGK+A L
Sbjct  59   QENMVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKDAAL  118

Query  386  FVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMD  565
            FVPSGTMGNLISVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGTMD
Sbjct  119  FVPSGTMGNLISVLVHCDVRGSEVILGDTCHINIFENGGIATIGGVHPRQVKNNDDGTMD  178

Query  566  LDQIEAAIRDPRFEICFPTTRLICL  640
            +D IEAAIRDP  E+ +PTT+LICL
Sbjct  179  IDLIEAAIRDPMGELFYPTTKLICL  203



>gb|ADI24921.1| L-allo-threonine aldolase [Carica papaya]
Length=360

 Score =   241 bits (616),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVT+PTE MRAAM +AEVDDDVL  DPTA  LE+E+AKIMGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTRPTEEMRAAMVTAEVDDDVLAHDPTAFLLESEMAKIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IR SE++LGD SHIHIYENGGI+TIGGVHPRT+KNN+DGTMD+  
Sbjct  61   SGTMGNLISVLVHCDIRASEVVLGDNSHIHIYENGGIATIGGVHPRTVKNNEDGTMDIHS  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP  E+ FPTTRLICL
Sbjct  121  IEAAIRDPAGELLFPTTRLICL  142



>ref|XP_010906810.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Elaeis guineensis]
Length=384

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKPTEAMRAAMASA+V+DDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  26   MVMRRVDLRSDTVTKPTEAMRAAMASADVEDDVLGSDPTAHRFESEMARVMGKEAALFVP  85

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KN  DGTMDLDQ
Sbjct  86   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNKSDGTMDLDQ  145

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR P   + +PTTRLICL
Sbjct  146  IEAAIRHPEGALYYPTTRLICL  167



>ref|XP_008453667.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Cucumis melo]
Length=392

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE ++AKIMGKE GLFV
Sbjct  42   KMVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEKMAKIMGKEGGLFV  101

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLIS+L HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D
Sbjct  102  PSGTMGNLISILVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDID  161

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIR+P+ ++ FPTTRLICL
Sbjct  162  LIEAAIRNPKGQLFFPTTRLICL  184



>ref|XP_010906809.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
Length=387

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKPTEAMRAAMASA+V+DDVLG DPTA R E+E+A++MGKEA LFVP
Sbjct  29   MVMRRVDLRSDTVTKPTEAMRAAMASADVEDDVLGSDPTAHRFESEMARVMGKEAALFVP  88

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+KN  DGTMDLDQ
Sbjct  89   SGTMGNLISVLVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVKNKSDGTMDLDQ  148

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR P   + +PTTRLICL
Sbjct  149  IEAAIRHPEGALYYPTTRLICL  170



>ref|XP_006606451.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Glycine 
max]
Length=441

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  206  RRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGL  385
            +  MVTR VDLRSDTVTKPTEAMRAAMASAEVDDDVLG+DPTA RLE E+AK MGK+A L
Sbjct  59   QENMVTRIVDLRSDTVTKPTEAMRAAMASAEVDDDVLGYDPTAFRLETEMAKTMGKDAAL  118

Query  386  FVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMD  565
            FVPSGTMGNLISVL HC +RGSE+ILGD  HI+I+ENGGI+TIGGVHPR +KNNDDGTMD
Sbjct  119  FVPSGTMGNLISVLVHCDVRGSEVILGDTCHINIFENGGIATIGGVHPRQVKNNDDGTMD  178

Query  566  LDQIEAAIRDPRFEICFPTTRLICL  640
            +D IEAAIRDP  E+ +PTT+LICL
Sbjct  179  IDLIEAAIRDPMGELFYPTTKLICL  203



>ref|XP_008453666.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Cucumis melo]
Length=400

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            KMV+R VDLRSDTVTKPTE+MRAAMA AEVDDDVLG+DPTA  LE ++AKIMGKE GLFV
Sbjct  42   KMVSRKVDLRSDTVTKPTESMRAAMAMAEVDDDVLGYDPTALELEEKMAKIMGKEGGLFV  101

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLIS+L HC  RGSE+I+GD SHIHI ENGGI+TIGGVHPRT+KN DDGTMD+D
Sbjct  102  PSGTMGNLISILVHCETRGSEVIVGDNSHIHILENGGIATIGGVHPRTVKNKDDGTMDID  161

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             IEAAIR+P+ ++ FPTTRLICL
Sbjct  162  LIEAAIRNPKGQLFFPTTRLICL  184



>ref|XP_004170415.1| PREDICTED: L-allo-threonine aldolase-like, partial [Cucumis sativus]
Length=326

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = +2

Query  212  KMVT-RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  388
            KMV+ R +DLRSDTVTKPTE MRAAMA AEVDDDVLG DP A  LE E+AKIMGKE GLF
Sbjct  2    KMVSSRKIDLRSDTVTKPTETMRAAMAMAEVDDDVLGNDPIAVELEEEMAKIMGKEGGLF  61

Query  389  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  568
            VPSGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVH RT+KN DDGTMD+
Sbjct  62   VPSGTMGNLISVLVHCEIRGSEVILGDSSHIHIYENGGIATIGGVHSRTVKNKDDGTMDI  121

Query  569  DQIEAAIRDPRFEICFPTTRLICL  640
            D IEAAIRDP+ ++ FPTTRLICL
Sbjct  122  DLIEAAIRDPKGDLFFPTTRLICL  145



>ref|XP_002892465.1| hypothetical protein ARALYDRAFT_470930 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68724.1| hypothetical protein ARALYDRAFT_470930 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R+VDLRSDTVTKPT+AMR AM SAEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRSVDLRSDTVTKPTDAMREAMCSAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL+ 
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLEA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>ref|XP_010102233.1| L-allo-threonine aldolase [Morus notabilis]
 gb|EXB93176.1| L-allo-threonine aldolase [Morus notabilis]
Length=358

 Score =   239 bits (611),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTR VDLRSDTVTKPTE MRAAMA+AEVDDDVLG DPTA RLE E+A I GKEA LFVP
Sbjct  1    MVTRRVDLRSDTVTKPTETMRAAMAAAEVDDDVLGNDPTAFRLEKEMAAIAGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVHPR +KNN DGTMD+D 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIYENGGIATIGGVHPRPVKNNPDGTMDIDS  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I +AIRDP+ E+ +PTTRLICL
Sbjct  121  IVSAIRDPKGELVYPTTRLICL  142



>ref|XP_010906817.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Elaeis guineensis]
Length=335

 Score =   238 bits (608),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTEAMRAAMASA+VDDDVLG DPTA  LE+E+AK+ GKEA LFVP
Sbjct  1    MVKRTVDLRSDTVTKPTEAMRAAMASADVDDDVLGSDPTAHHLESEMAKLTGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIH+ ENGGISTIGGVHP+ +KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGDTSHIHVLENGGISTIGGVHPKAVKNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR P   + FPTTRLICL
Sbjct  121  IEAAIRSPDGALFFPTTRLICL  142



>ref|XP_007147215.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 ref|XP_007147216.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 gb|ESW19209.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
 gb|ESW19210.1| hypothetical protein PHAVU_006G105400g [Phaseolus vulgaris]
Length=362

 Score =   239 bits (610),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M  + VDLRSDTVTKPTEAMR+AMASAEVDDDVLG DP+  RLE EIAK+ GKEA LFVP
Sbjct  1    MGAKIVDLRSDTVTKPTEAMRSAMASAEVDDDVLGRDPSCFRLETEIAKLFGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHPRT+KNN+DGTMD+D 
Sbjct  61   SGTMANLISVLVHCDIRGSEVILGDDSHIHIYENGGIATLGGVHPRTVKNNEDGTMDIDL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ E+ +PTTRLICL
Sbjct  121  IEAAIRDPKGELVYPTTRLICL  142



>gb|KGN66765.1| hypothetical protein Csa_1G680120 [Cucumis sativus]
Length=331

 Score =   238 bits (608),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
            +R +DLRSDTVTKPTE MRAAMA AEVDDDVLG DP A  LE E+AKIMGKE GLFVPSG
Sbjct  4    SRKIDLRSDTVTKPTETMRAAMAMAEVDDDVLGNDPIAVELEEEMAKIMGKEGGLFVPSG  63

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVH RT+KN DDGTMD+D IE
Sbjct  64   TMGNLISVLVHCEIRGSEVILGDSSHIHIYENGGIATIGGVHSRTVKNKDDGTMDIDLIE  123

Query  581  AAIRDPRFEICFPTTRLICL  640
            AAIRDP+ ++ FPTTRLICL
Sbjct  124  AAIRDPKGDLFFPTTRLICL  143



>ref|XP_004142582.1| PREDICTED: L-allo-threonine aldolase-like [Cucumis sativus]
Length=365

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
            +R +DLRSDTVTKPTE MRAAMA AEVDDDVLG DP A  LE E+AKIMGKE GLFVPSG
Sbjct  4    SRKIDLRSDTVTKPTETMRAAMAMAEVDDDVLGNDPIAVELEEEMAKIMGKEGGLFVPSG  63

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TMGNLISVL HC IRGSE+ILGD SHIHIYENGGI+TIGGVH RT+KN DDGTMD+D IE
Sbjct  64   TMGNLISVLVHCEIRGSEVILGDSSHIHIYENGGIATIGGVHSRTVKNKDDGTMDIDLIE  123

Query  581  AAIRDPRFEICFPTTRLICL  640
            AAIRDP+ ++ FPTTRLICL
Sbjct  124  AAIRDPKGDLFFPTTRLICL  143



>ref|XP_010906814.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
 ref|XP_010906816.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Elaeis guineensis]
Length=359

 Score =   238 bits (607),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTEAMRAAMASA+VDDDVLG DPTA  LE+E+AK+ GKEA LFVP
Sbjct  1    MVKRTVDLRSDTVTKPTEAMRAAMASADVDDDVLGSDPTAHHLESEMAKLTGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIH+ ENGGISTIGGVHP+ +KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGDTSHIHVLENGGISTIGGVHPKAVKNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR P   + FPTTRLICL
Sbjct  121  IEAAIRSPDGALFFPTTRLICL  142



>gb|AAF99780.1|AC003981_30 F22O13.11 [Arabidopsis thaliana]
Length=352

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R+VDLRSDTVT+PT+AMR AM +AEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCNAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+T+KN +DGTMDL+ 
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTVKNEEDGTMDLEA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>gb|AAM63785.1| unknown [Arabidopsis thaliana]
Length=358

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R+VDLRSDTVT+PT+AMR AM +AEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCNAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+T+KN +DGTMDL+ 
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTVKNEEDGTMDLEA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>ref|NP_001077492.1| threonine aldolase [Arabidopsis thaliana]
 dbj|BAH19728.1| AT1G08630 [Arabidopsis thaliana]
 gb|AEE28324.1| threonine aldolase [Arabidopsis thaliana]
Length=344

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R+VDLRSDTVT+PT+AMR AM +AEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCNAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+T+KN +DGTMDL+ 
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTVKNEEDGTMDLEA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>ref|XP_010489194.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010489200.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010489206.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R+VDLRSDTVT+PT+AMR AM  AEVDDDVLG+DPTA+RLE E+AK+MGKEAGLFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCGAEVDDDVLGYDPTARRLEDEMAKMMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLAA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>ref|XP_009118358.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118360.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118361.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118362.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009118363.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=358

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVT+PT+AMR AM SAEVDDDVLG+DPTA+RLE EIAK+MGKEA LFVP
Sbjct  1    MVMRTVDLRSDTVTRPTDAMREAMGSAEVDDDVLGYDPTARRLEEEIAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI ++ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICIMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLGA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>ref|NP_563822.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_849614.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_849615.1| threonine aldolase [Arabidopsis thaliana]
 ref|NP_001031001.2| threonine aldolase [Arabidopsis thaliana]
 sp|Q8RXU4.1|THA1_ARATH RecName: Full=Probable low-specificity L-threonine aldolase 1; 
AltName: Full=Threonine aldolase 1 [Arabidopsis thaliana]
 gb|AAL86346.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51302.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01898.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28320.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28321.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28322.1| threonine aldolase [Arabidopsis thaliana]
 gb|AEE28323.1| threonine aldolase [Arabidopsis thaliana]
Length=358

 Score =   237 bits (605),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R+VDLRSDTVT+PT+AMR AM +AEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCNAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+T+KN +DGTMDL+ 
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTVKNEEDGTMDLEA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>ref|XP_010475669.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010475670.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVT+PT+AMR AM  AEVDDDVLG+DPTA+RLE E+AK+MGKEAGLFVP
Sbjct  1    MVMRNVDLRSDTVTRPTDAMREAMCGAEVDDDVLGYDPTARRLEDEMAKMMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLAA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>ref|XP_010553775.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Tarenaya hassleriana]
Length=365

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            K V RTVDLRSDTVTKPTE+M++AMA AEVDDDVLG DPTA++LE E+AKI GKEAGLFV
Sbjct  7    KTVARTVDLRSDTVTKPTESMQSAMARAEVDDDVLGHDPTARKLEQEMAKITGKEAGLFV  66

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLISV+ HC +RGSE+ILGD  HIHIYENGG++T+GG+HPRT++NN+DGTMD+D
Sbjct  67   PSGTMGNLISVMAHCEVRGSEVILGDNCHIHIYENGGVATVGGIHPRTVRNNEDGTMDID  126

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             +EAAIRDP+  + +P TRLICL
Sbjct  127  DVEAAIRDPKGGMFYPRTRLICL  149



>ref|XP_010458106.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010458107.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
 ref|XP_010458108.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Camelina 
sativa]
Length=358

 Score =   237 bits (604),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R+VDLRSDTVT+PT+AMR AM  AEVDDDVLG+DPTA+RLE E+AK+MGKEAGLFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCGAEVDDDVLGYDPTARRLEDEMAKMMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLAA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>ref|XP_006417664.1| hypothetical protein EUTSA_v10008026mg [Eutrema salsugineum]
 gb|ESQ36017.1| hypothetical protein EUTSA_v10008026mg [Eutrema salsugineum]
Length=358

 Score =   236 bits (603),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV ++VDLRSDTVT+PT+AMR AM SAEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMKSVDLRSDTVTRPTDAMREAMGSAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI V+ HC +RGSE+ILGD SHIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPKTIKNEEDGTMDLAA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>ref|XP_009148115.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009148116.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
 ref|XP_009148118.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=358

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVT+PT+AMR AMASAEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRIVDLRSDTVTRPTDAMREAMASAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI V+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCDVRGSEVILGDTCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLVA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>ref|XP_006305180.1| hypothetical protein CARUB_v10009546mg [Capsella rubella]
 gb|EOA38078.1| hypothetical protein CARUB_v10009546mg [Capsella rubella]
Length=358

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R+VDLRSDTVT+PT+AMR AM +AEVDDDVLG+DPTA+RLE E+AK+MGKEAGLFVP
Sbjct  1    MVMRSVDLRSDTVTRPTDAMREAMCNAEVDDDVLGYDPTARRLEDEMAKMMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISV+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN  DGTMDL  
Sbjct  61   SGTMGNLISVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEPDGTMDLAA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>emb|CDX95045.1| BnaC05g06260D [Brassica napus]
Length=358

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVT+PT+AMR AMASAEVDDDVLG+DPTA+RLE E+AK+MGKEA LFVP
Sbjct  1    MVMRIVDLRSDTVTRPTDAMREAMASAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI V+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TI+N +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCDVRGSEVILGDTCHIHVYENGGISTIGGVHPKTIRNEEDGTMDLVA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTLYPSTRLICL  142



>emb|CDY06323.1| BnaA09g48800D [Brassica napus]
Length=358

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVT+PT+AMR AM SAEVDDDVLG+DPTA+RLE EIAK+MGKEA LFVP
Sbjct  1    MVMRTVDLRSDTVTRPTDAMREAMGSAEVDDDVLGYDPTARRLEEEIAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI V+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+T+KN +DGTM+L  
Sbjct  61   SGTMGNLICVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTVKNEEDGTMELGA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P TRLICL
Sbjct  121  IEAAIRDPKGSTFYPLTRLICL  142



>ref|XP_006577317.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Glycine 
max]
Length=368

 Score =   235 bits (600),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKP+EAMRAAMASAEVDDDVLG DP+  RLE E+AKI+GKE  LFVP
Sbjct  1    MVPRIVDLRSDTVTKPSEAMRAAMASAEVDDDVLGRDPSCFRLETEMAKILGKEGALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHP T++NN+DGTMD+  
Sbjct  61   SGTMANLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPTTVRNNEDGTMDIHL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ E+ +PTTRLICL
Sbjct  121  IEAAIRDPKGELVYPTTRLICL  142



>ref|XP_003521772.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Glycine 
max]
 gb|KHN31499.1| L-allo-threonine aldolase [Glycine soja]
Length=358

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKP+EAMRAAMASAEVDDDVLG DP+  RLE E+AKI+GKE  LFVP
Sbjct  1    MVPRIVDLRSDTVTKPSEAMRAAMASAEVDDDVLGRDPSCFRLETEMAKILGKEGALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHP T++NN+DGTMD+  
Sbjct  61   SGTMANLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPTTVRNNEDGTMDIHL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ E+ +PTTRLICL
Sbjct  121  IEAAIRDPKGELVYPTTRLICL  142



>emb|CDY22672.1| BnaC08g43060D [Brassica napus]
Length=358

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVT+PT+AMR AM SAEVDDDVLG+DPTA+ LE EIAK+MGKEA LFVP
Sbjct  1    MVMRTVDLRSDTVTRPTDAMREAMGSAEVDDDVLGYDPTARHLEEEIAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI V+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCDVRGSEVILGDNCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLGA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            +EAAIRDP+    +P+TRLICL
Sbjct  121  VEAAIRDPKGSTFYPSTRLICL  142



>ref|XP_006577318.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Glycine 
max]
Length=357

 Score =   235 bits (599),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKP+EAMRAAMASAEVDDDVLG DP+  RLE E+AKI+GKE  LFVP
Sbjct  1    MVPRIVDLRSDTVTKPSEAMRAAMASAEVDDDVLGRDPSCFRLETEMAKILGKEGALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC IRGSE+ILGD SHIHIYENGGI+T+GGVHP T++NN+DGTMD+  
Sbjct  61   SGTMANLISVLVHCDIRGSEVILGDNSHIHIYENGGIATLGGVHPTTVRNNEDGTMDIHL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+ E+ +PTTRLICL
Sbjct  121  IEAAIRDPKGELVYPTTRLICL  142



>ref|XP_008443794.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
 ref|XP_008443795.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Cucumis 
melo]
Length=360

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             R +DLRSDTVTKPTE MRAAMA AEVDDDVLG DP A  LE E+AKIMGKE GLFVPSG
Sbjct  4    NRKIDLRSDTVTKPTETMRAAMAMAEVDDDVLGNDPIALELEEEMAKIMGKEEGLFVPSG  63

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TMGNLISVL HC IRGSE+I+GD SHIHIYENGGI+TIGGVH RT+KN DDGTMD+D IE
Sbjct  64   TMGNLISVLVHCEIRGSEVIVGDNSHIHIYENGGIATIGGVHSRTVKNKDDGTMDIDLIE  123

Query  581  AAIRDPRFEICFPTTRLICL  640
            AAIR+P+ ++ FPTTRLICL
Sbjct  124  AAIRNPKGQLFFPTTRLICL  143



>ref|XP_009110878.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Brassica 
rapa]
Length=369

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R+VDLRSDTVT+PT+AMR AMA AEVDDD+LG+DPTA+ LE E+AK+MGKEA LFVP
Sbjct  1    MVIRSVDLRSDTVTRPTDAMREAMAGAEVDDDILGYDPTARHLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI V+ HC +RGSE+ILGD SHIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPKTIKNEEDGTMDLGD  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>emb|CDX93548.1| BnaA06g05000D [Brassica napus]
Length=358

 Score =   233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVT+PT+AMR AMASAEVDDDVLG+DPTA+ LE E+AK+MGKEA LFVP
Sbjct  1    MVMRIVDLRSDTVTRPTDAMREAMASAEVDDDVLGYDPTARGLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI V+ HC +RGSE+ILGD  HIH+YENGGISTIGGVHP+TIKN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCDVRGSEVILGDTCHIHVYENGGISTIGGVHPKTIKNEEDGTMDLVA  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P+TRLICL
Sbjct  121  IEAAIRDPKGSTFYPSTRLICL  142



>emb|CDY31134.1| BnaA08g26840D [Brassica napus]
Length=369

 Score =   232 bits (591),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R+VDLRSDTVT+PT+AMR AMA AEVDDD+LG+DPTA+ LE E+AK+MGKEA LFVP
Sbjct  1    MVIRSVDLRSDTVTRPTDAMREAMAGAEVDDDILGYDPTARHLEEEMAKMMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLI V+ HC +RGSE+ILGD SHIH+YENGGISTIGGVHP+T KN +DGTMDL  
Sbjct  61   SGTMGNLICVMVHCEVRGSEVILGDNSHIHVYENGGISTIGGVHPKTTKNEEDGTMDLGD  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP+    +P TRLICL
Sbjct  121  IEAAIRDPKESTFYPYTRLICL  142



>ref|XP_006857300.1| hypothetical protein AMTR_s00067p00056150 [Amborella trichopoda]
 gb|ERN18767.1| hypothetical protein AMTR_s00067p00056150 [Amborella trichopoda]
Length=358

 Score =   228 bits (582),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV R VDLRSDTVTKPTEAM AAMA+AEVDDDVLGFDPTAQ+LE E+A+I+GKEA LFVP
Sbjct  1    MVRRIVDLRSDTVTKPTEAMIAAMANAEVDDDVLGFDPTAQKLETEVARIVGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLIS++ HC IRGSE+ILGD SHIH+ ENGGISTIG  H RT+ NN DGTMD++ 
Sbjct  61   SGTMSNLISIMVHCEIRGSEVILGDQSHIHLLENGGISTIGCAHSRTVPNNSDGTMDINL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIRDP   + +PTTRLICL
Sbjct  121  IEAAIRDPTEAMYYPTTRLICL  142



>ref|XP_011465993.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465994.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011465995.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Fragaria 
vesca subsp. vesca]
Length=359

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+TVDLRSDTVTKPTE MRAAMA+A VDDDVLG DPTA RLE+E+AKIMGKEA LFVP
Sbjct  1    MVTQTVDLRSDTVTKPTETMRAAMAAAVVDDDVLGSDPTAFRLESEMAKIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIHI+ENGGISTIGGVHPRT+KNN+DGTMDL+ 
Sbjct  61   SGTMGNLISVLVHCDIRGSEVILGDNSHIHIFENGGISTIGGVHPRTVKNNNDGTMDLNL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEA IRDPR E+ FPTTRLICL
Sbjct  121  IEATIRDPRGELVFPTTRLICL  142



>emb|CDO99988.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/123 (84%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  272  MRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGS  451
            MR AMA+AEVDDDVL  DPTA+RLE E+A+I GKEA LFVPSGTMGNLI VLTHCPIRGS
Sbjct  1    MRTAMANAEVDDDVLSHDPTARRLETEMARITGKEAALFVPSGTMGNLICVLTHCPIRGS  60

Query  452  EIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRL  631
            E+ILGD  HIHIYENGGISTIGGVHPRT+KNN+DGTMD++Q+EAAIRDPRFEIC+PTTRL
Sbjct  61   EVILGDSCHIHIYENGGISTIGGVHPRTVKNNEDGTMDINQMEAAIRDPRFEICYPTTRL  120

Query  632  ICL  640
            ICL
Sbjct  121  ICL  123



>ref|XP_010262337.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Nelumbo nucifera]
Length=341

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMA+A+VDDDVLG DPTA R EAE+AK+MGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANADVDDDVLGVDPTAYRFEAEMAKVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIH+YENGGISTIG VH +T+KNN DGTMD+  
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDNSHIHVYENGGISTIGNVHSKTVKNNSDGTMDISL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEA+IRDP  E+ +PTTRLICL
Sbjct  121  IEASIRDPEEELYYPTTRLICL  142



>ref|XP_010262335.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Nelumbo nucifera]
 ref|XP_010262336.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X1 [Nelumbo nucifera]
Length=358

 Score =   225 bits (573),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVTRTVDLRSDTVTKPTEAMRAAMA+A+VDDDVLG DPTA R EAE+AK+MGKEA LFVP
Sbjct  1    MVTRTVDLRSDTVTKPTEAMRAAMANADVDDDVLGVDPTAYRFEAEMAKVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC IRGSE+ILGD SHIH+YENGGISTIG VH +T+KNN DGTMD+  
Sbjct  61   SGTMGNLISVLVHCEIRGSEVILGDNSHIHVYENGGISTIGNVHSKTVKNNSDGTMDISL  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEA+IRDP  E+ +PTTRLICL
Sbjct  121  IEASIRDPEEELYYPTTRLICL  142



>gb|AFW58858.1| putative threonine aldolase family protein [Zea mays]
Length=298

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +2

Query  215  MVTRTV-DLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            M T+ V DLRSDTVTKP+EAMRA+MA+A+VDDDV G DPTA+R + E+A +MGKEA LFV
Sbjct  1    MATKVVVDLRSDTVTKPSEAMRASMAAADVDDDVRGADPTARRFQEEMAALMGKEAALFV  60

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHP+T++NN DGTMD+D
Sbjct  61   PSGTMGNLVSVLAHCDVRGSEVILGDDSHIHLYENGGISTLGGVHPKTVRNNSDGTMDID  120

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             I AAIR P   + +PTTRLICL
Sbjct  121  SIVAAIRPPGGGLYYPTTRLICL  143



>ref|XP_008802138.1| PREDICTED: probable low-specificity L-threonine aldolase 1 [Phoenix 
dactylifera]
Length=359

 Score =   221 bits (564),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MV RTVDLRSDTVTKPTEAMRAAMA A+VDDDVLG DPTA  LE+E+AK+ GKEA LFVP
Sbjct  1    MVKRTVDLRSDTVTKPTEAMRAAMARADVDDDVLGSDPTAYHLESEMAKLTGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+I+GD SHIH+ ENGGISTIGGVHP+T+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLIHCDVRGSEVIIGDTSHIHVLENGGISTIGGVHPKTVKNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            IEAAIR P  E+ FPTTRLICL
Sbjct  121  IEAAIRSPDGELFFPTTRLICL  142



>emb|CDY42933.1| BnaC05g47180D [Brassica napus]
Length=360

 Score =   221 bits (563),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  218  VTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPS  397
            V RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA  LE E+A+I GKEA +FVPS
Sbjct  5    VIRTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTAVLLEREVAEIAGKEAAMFVPS  64

Query  398  GTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQI  577
            GTMGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  I
Sbjct  65   GTMGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEISSI  124

Query  578  EAAIRDPRFEICFPTTRLICL  640
            EAA+R P+ ++ +P T+LICL
Sbjct  125  EAAVRSPKGDLHYPVTKLICL  145



>emb|CDY49330.1| BnaA05g32920D [Brassica napus]
Length=360

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  218  VTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPS  397
            V RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA  LE E+A+I GKEA +FVPS
Sbjct  5    VIRTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTAVILEREVAEIAGKEAAMFVPS  64

Query  398  GTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQI  577
            GTMGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  I
Sbjct  65   GTMGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEISSI  124

Query  578  EAAIRDPRFEICFPTTRLICL  640
            EAA+R P+ ++ +P T+LICL
Sbjct  125  EAAVRSPKGDLHYPVTKLICL  145



>ref|NP_001189807.1| threonine aldolase 2 [Arabidopsis thaliana]
 gb|AEE74092.1| threonine aldolase 2 [Arabidopsis thaliana]
Length=354

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSGT
Sbjct  8    RTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTALRLEKEVAEIAGKEAAMFVPSGT  67

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  IEA
Sbjct  68   MGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEIGAIEA  127

Query  584  AIRDPRFEICFPTTRLICL  640
            A+R P+ ++  P T+LICL
Sbjct  128  AVRSPKGDLHHPVTKLICL  146



>ref|NP_566228.1| threonine aldolase 2 [Arabidopsis thaliana]
 sp|Q9FPH3.1|THA2_ARATH RecName: Full=Probable low-specificity L-threonine aldolase 2; 
AltName: Full=Threonine aldolase 2 [Arabidopsis thaliana]
 gb|AAG40385.1|AF325033_1 AT3g04520 [Arabidopsis thaliana]
 gb|AAM14044.1| putative L-allo-threonine aldolase [Arabidopsis thaliana]
 gb|AAM62682.1| L-allo-threonine aldolase, putative [Arabidopsis thaliana]
 gb|AAM67566.1| putative L-allo-threonine aldolase [Arabidopsis thaliana]
 dbj|BAD43108.1| L-allo-threonine aldolase like protein [Arabidopsis thaliana]
 gb|AEE74091.1| threonine aldolase 2 [Arabidopsis thaliana]
Length=355

 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSGT
Sbjct  8    RTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTALRLEKEVAEIAGKEAAMFVPSGT  67

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  IEA
Sbjct  68   MGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEIGAIEA  127

Query  584  AIRDPRFEICFPTTRLICL  640
            A+R P+ ++  P T+LICL
Sbjct  128  AVRSPKGDLHHPVTKLICL  146



>ref|XP_009123981.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brassica 
rapa]
 ref|XP_009123982.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brassica 
rapa]
Length=360

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  218  VTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPS  397
            V RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA  LE E+A+I GKEA +FVPS
Sbjct  5    VIRTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTAVILEREVAEIAGKEAAMFVPS  64

Query  398  GTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQI  577
            GTMGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  I
Sbjct  65   GTMGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEISSI  124

Query  578  EAAIRDPRFEICFPTTRLICL  640
            EAA+R P+ ++ +P T+LICL
Sbjct  125  EAAVRSPKGDLHYPVTKLICL  145



>ref|XP_008661960.1| PREDICTED: L-allo-threonine aldolase isoform X1 [Zea mays]
 ref|XP_008661961.1| PREDICTED: L-allo-threonine aldolase isoform X1 [Zea mays]
 gb|ACG33933.1| L-allo-threonine aldolase [Zea mays]
 gb|AFW58856.1| putative threonine aldolase family protein [Zea mays]
Length=377

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +2

Query  215  MVTRTV-DLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            M T+ V DLRSDTVTKP+EAMRA+MA+A+VDDDV G DPTA+R + E+A +MGKEA LFV
Sbjct  1    MATKVVVDLRSDTVTKPSEAMRASMAAADVDDDVRGADPTARRFQEEMAALMGKEAALFV  60

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHP+T++NN DGTMD+D
Sbjct  61   PSGTMGNLVSVLAHCDVRGSEVILGDDSHIHLYENGGISTLGGVHPKTVRNNSDGTMDID  120

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             I AAIR P   + +PTTRLICL
Sbjct  121  SIVAAIRPPGGGLYYPTTRLICL  143



>ref|NP_001149239.1| L-allo-threonine aldolase [Zea mays]
 gb|ACG34688.1| L-allo-threonine aldolase [Zea mays]
 gb|AFW58857.1| putative threonine aldolase family protein [Zea mays]
Length=375

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +2

Query  215  MVTRTV-DLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            M T+ V DLRSDTVTKP+EAMRA+MA+A+VDDDV G DPTA+R + E+A +MGKEA LFV
Sbjct  1    MATKVVVDLRSDTVTKPSEAMRASMAAADVDDDVRGADPTARRFQEEMAALMGKEAALFV  60

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHP+T++NN DGTMD+D
Sbjct  61   PSGTMGNLVSVLAHCDVRGSEVILGDDSHIHLYENGGISTLGGVHPKTVRNNSDGTMDID  120

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             I AAIR P   + +PTTRLICL
Sbjct  121  SIVAAIRPPGGGLYYPTTRLICL  143



>gb|AAF63783.1| L-allo-threonine aldolase, putative [Arabidopsis thaliana]
Length=370

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSGT
Sbjct  8    RTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTALRLEKEVAEIAGKEAAMFVPSGT  67

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  IEA
Sbjct  68   MGNLISVLVHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEIGAIEA  127

Query  584  AIRDPRFEICFPTTRLICL  640
            A+R P+ ++  P T+LICL
Sbjct  128  AVRSPKGDLHHPVTKLICL  146



>ref|XP_002884450.1| hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60709.1| hypothetical protein ARALYDRAFT_896488 [Arabidopsis lyrata subsp. 
lyrata]
Length=353

 Score =   219 bits (557),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            RTVDLRSDTVTKPTE+MR+AMA+AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSGT
Sbjct  8    RTVDLRSDTVTKPTESMRSAMANAEVDDDVLGNDPTALRLEKEVAEIAGKEAAMFVPSGT  67

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNLISVL HC  RGSE+ILGD SHIHIYENGGIS++GGVHPRT+KN +DGTM++  IEA
Sbjct  68   MGNLISVLVHCDERGSEVILGDDSHIHIYENGGISSLGGVHPRTVKNEEDGTMEIGAIEA  127

Query  584  AIRDPRFEICFPTTRLICL  640
             +R P+ ++  P T+LICL
Sbjct  128  VVRSPKGDLHHPVTKLICL  146



>ref|XP_006408182.1| hypothetical protein EUTSA_v10021036mg [Eutrema salsugineum]
 gb|ESQ49635.1| hypothetical protein EUTSA_v10021036mg [Eutrema salsugineum]
Length=352

 Score =   218 bits (555),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 124/145 (86%), Gaps = 3/145 (2%)
 Frame = +2

Query  215  MVT---RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGL  385
            MVT   RTVDLRSDTVTKPTE+MR AMA+AEVDDDVLG DPTA RLE E+A+I GKEA +
Sbjct  1    MVTPTIRTVDLRSDTVTKPTESMRLAMANAEVDDDVLGNDPTAVRLEREVAEIAGKEAAM  60

Query  386  FVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMD  565
            FVPSGTMGNLISVL HC  RGSE+I GD SHIHIYENGG+S++GGVHPRT+KN +DGTM+
Sbjct  61   FVPSGTMGNLISVLVHCDERGSEVIRGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTME  120

Query  566  LDQIEAAIRDPRFEICFPTTRLICL  640
            +  IEAA+R P+ ++ +P T+LICL
Sbjct  121  IGSIEAAVRSPKGDLHYPVTKLICL  145



>ref|XP_010463930.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             RTVDLRSDTVTKPTE+MR+AMA AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSG
Sbjct  7    VRTVDLRSDTVTKPTESMRSAMAIAEVDDDVLGSDPTAMRLEKEMAEIAGKEAAMFVPSG  66

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM++  IE
Sbjct  67   TMANLISVLIHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMEIGSIE  126

Query  581  AAIRDPRFEICFPTTRLICL  640
            AA+R P+ ++  P T+LICL
Sbjct  127  AAVRGPKGDLHHPVTKLICL  146



>ref|XP_010415759.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             RTVDLRSDTVTKPTE+MR+AMA AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSG
Sbjct  7    VRTVDLRSDTVTKPTESMRSAMAIAEVDDDVLGNDPTAMRLEKEMAEIAGKEAAMFVPSG  66

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM +  IE
Sbjct  67   TMANLISVLIHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMKIGSIE  126

Query  581  AAIRDPRFEICFPTTRLICL  640
            AA+R P+ ++  P T+LICL
Sbjct  127  AAVRGPKGDLHHPVTKLICL  146



>ref|XP_010485829.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Camelina 
sativa]
Length=353

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             RTVDLRSDTVTKPTE+MR+AMA AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSG
Sbjct  7    VRTVDLRSDTVTKPTESMRSAMAKAEVDDDVLGSDPTAMRLEKEMAEIAGKEAAMFVPSG  66

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NLISVL HC  RGSE+ILGD SHIHIYENGG+S++GGVHPRT+KN +DGTM +  IE
Sbjct  67   TMANLISVLIHCDERGSEVILGDDSHIHIYENGGVSSLGGVHPRTVKNEEDGTMVIGSIE  126

Query  581  AAIRDPRFEICFPTTRLICL  640
            AA+R P+ ++  P T+LICL
Sbjct  127  AAVRGPKGDLHHPVTKLICL  146



>gb|ACG34432.1| L-allo-threonine aldolase [Zea mays]
Length=377

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +2

Query  215  MVTRTV-DLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            M T+ V DLRSDTVTKP+EAMRA+MA+A+VD DV G DPTA+R + ++A++MGKEA LFV
Sbjct  1    MATKVVVDLRSDTVTKPSEAMRASMAAADVDYDVRGADPTARRFQEKMAELMGKEAALFV  60

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHP+T++NN DGTMD+D
Sbjct  61   PSGTMGNLVSVLAHCDVRGSEVILGDDSHIHLYENGGISTLGGVHPKTVRNNSDGTMDID  120

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
             I AAIR P   + +PTTRLICL
Sbjct  121  SIVAAIRPPGGGLYYPTTRLICL  143



>ref|XP_010520652.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Tarenaya 
hassleriana]
Length=349

 Score =   215 bits (547),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = +2

Query  218  VTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPS  397
            + +TVDLRSDTVTKPTE+MR+ MA AEVDDDVLG DPTA RLE E+A+I GKEA +FVPS
Sbjct  20   INKTVDLRSDTVTKPTESMRSEMAKAEVDDDVLGHDPTALRLEQEMAEIAGKEAAIFVPS  79

Query  398  GTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQI  577
            GTMGNLISVL HC  RGSE+ILGD SHIH+YENGGI+T+GGVHPRT+KN +DGTM +  I
Sbjct  80   GTMGNLISVLVHCDERGSEVILGDNSHIHVYENGGIATLGGVHPRTVKNEEDGTMGISAI  139

Query  578  EAAIRDPRFEICFPTTRLICL  640
            E A+R P+ ++  P T+LICL
Sbjct  140  EEAVRTPKGDLHHPVTKLICL  160



>ref|XP_003590971.1| L-allo-threonine aldolase [Medicago truncatula]
Length=336

 Score =   213 bits (541),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  272  MRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGS  451
            MRAAMASAEVDDDVLG+DPTA  LE E+AK+MGKEA LFVPSGTMGNLI VL HC IRGS
Sbjct  1    MRAAMASAEVDDDVLGYDPTALLLETEMAKMMGKEAALFVPSGTMGNLICVLVHCDIRGS  60

Query  452  EIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRL  631
            E+ILGD  HI+IYENGGISTIGGVHPR +KNNDDGT+D+D IEAAIRDPR E+ FP+TRL
Sbjct  61   EVILGDNCHINIYENGGISTIGGVHPRQVKNNDDGTIDIDLIEAAIRDPRGELMFPSTRL  120

Query  632  ICL  640
            ICL
Sbjct  121  ICL  123



>emb|CBI22386.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   212 bits (540),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +2

Query  272  MRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGS  451
            MRAAMA AEVDDDVL  DPTA+RLE E+A+I GKEA LFVPSGTMGNLISVL HC +RGS
Sbjct  1    MRAAMAIAEVDDDVLVCDPTAERLETEMARITGKEAALFVPSGTMGNLISVLVHCEVRGS  60

Query  452  EIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRL  631
            E+ILGD SHIHIYENGGIST+GGVHPRT+KNN+DGTMD++ IEAAIRDPR E+ +PTTRL
Sbjct  61   EVILGDNSHIHIYENGGISTLGGVHPRTVKNNEDGTMDINLIEAAIRDPRGELVYPTTRL  120

Query  632  ICL  640
            ICL
Sbjct  121  ICL  123



>ref|XP_006298023.1| hypothetical protein CARUB_v10014068mg [Capsella rubella]
 gb|EOA30921.1| hypothetical protein CARUB_v10014068mg [Capsella rubella]
Length=353

 Score =   211 bits (536),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             RTVDLRSDTVTKPTE+MR+AMA AEVDDDVLG DPTA RLE E+A+I GKEA +FVPSG
Sbjct  7    VRTVDLRSDTVTKPTESMRSAMAKAEVDDDVLGNDPTAMRLEKEMAEIAGKEAAMFVPSG  66

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NLISVL HC  RGSE+ILGD  HIHIYENGG+S++GGVHPRT+KN +DGTM +  IE
Sbjct  67   TMANLISVLIHCDERGSEVILGDDCHIHIYENGGVSSLGGVHPRTVKNEEDGTMKIGSIE  126

Query  581  AAIRDPRFEICFPTTRLICL  640
            AA+R  + ++  P T+LICL
Sbjct  127  AAVRGHKGDLHHPVTKLICL  146



>gb|ABR18450.1| unknown [Picea sitchensis]
Length=379

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 2/143 (1%)
 Frame = +2

Query  212  KMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFV  391
            K   R VDLRSDTVT+PT+ MRAAMA A+VDDDVLG DPTA +L+ ++AK+MGKEAGLFV
Sbjct  18   KSAPRVVDLRSDTVTRPTDTMRAAMAKADVDDDVLGSDPTADQLQRQVAKLMGKEAGLFV  77

Query  392  PSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLD  571
            PSGTMGNLISVL HC +RGSE+ILG  SHIH+YENGGISTIG VHPR + N +DGTMDL 
Sbjct  78   PSGTMGNLISVLVHCEVRGSEVILGSDSHIHVYENGGISTIGHVHPRVVPNKEDGTMDLR  137

Query  572  QIEAAIRDPRFEICFPTTRLICL  640
            +IEA+IR P+ E+ + TTRLIC+
Sbjct  138  KIEASIR-PK-ELLYATTRLICI  158



>ref|XP_004976228.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Setaria 
italica]
Length=372

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+ VDLRSDTVTKPTEAMRAAMA+A+VDDDVLG DPTAQR EAE+AK+MGKEA LFVP
Sbjct  1    MVTKVVDLRSDTVTKPTEAMRAAMAAADVDDDVLGADPTAQRFEAEMAKLMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NL+SVL HC +RGSE+ILGD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMANLVSVLVHCDVRGSEVILGDNSHIHIYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR+    + +PTTRLICL
Sbjct  121  IVAAIRNRAGALLYPTTRLICL  142



>ref|XP_004976227.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Setaria 
italica]
Length=374

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+ VDLRSDTVTKPTEAMRAAMA+A+VDDDVLG DPTAQR EAE+AK+MGKEA LFVP
Sbjct  1    MVTKVVDLRSDTVTKPTEAMRAAMAAADVDDDVLGADPTAQRFEAEMAKLMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NL+SVL HC +RGSE+ILGD SHIHIYENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMANLVSVLVHCDVRGSEVILGDNSHIHIYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR+    + +PTTRLICL
Sbjct  121  IVAAIRNRAGALLYPTTRLICL  142



>gb|EMT09938.1| hypothetical protein F775_21345 [Aegilops tauschii]
Length=267

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M T+ VDLRSDTVTKP+EAMRAAMA+A+V+DD+LG DPTA+R EAE+A+IMGKEA LFVP
Sbjct  1    MATKVVDLRSDTVTKPSEAMRAAMAAADVEDDILGSDPTARRFEAEMARIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC  RGSE ILGD SHIH+YE+GGIST+GGVHPR + NN DGTMD+D+
Sbjct  61   SGTMANLISVLVHCDTRGSEAILGDNSHIHVYEHGGISTLGGVHPRIVANNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR     + +PTTRLICL
Sbjct  121  IVAAIRSRDGSLYYPTTRLICL  142



>ref|XP_010553776.1| PREDICTED: probable low-specificity L-threonine aldolase 1 isoform 
X2 [Tarenaya hassleriana]
Length=339

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 110/123 (89%), Gaps = 0/123 (0%)
 Frame = +2

Query  272  MRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGS  451
            M++AMA AEVDDDVLG DPTA++LE E+AKI GKEAGLFVPSGTMGNLISV+ HC +RGS
Sbjct  1    MQSAMARAEVDDDVLGHDPTARKLEQEMAKITGKEAGLFVPSGTMGNLISVMAHCEVRGS  60

Query  452  EIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRL  631
            E+ILGD  HIHIYENGG++T+GG+HPRT++NN+DGTMD+D +EAAIRDP+  + +P TRL
Sbjct  61   EVILGDNCHIHIYENGGVATVGGIHPRTVRNNEDGTMDIDDVEAAIRDPKGGMFYPRTRL  120

Query  632  ICL  640
            ICL
Sbjct  121  ICL  123



>gb|EMS57977.1| L-allo-threonine aldolase [Triticum urartu]
Length=302

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M T+ VDLRSDTVTKP+EAMRAAMA+A+V+DD+LG DPTA+R EAE+A+IMGKEA LFVP
Sbjct  1    MATKVVDLRSDTVTKPSEAMRAAMAAADVEDDILGSDPTARRFEAEMARIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC  RGSE ILGD SHIH+YE+GGIST+GGVHPR + NN DGTMD+D+
Sbjct  61   SGTMANLISVLVHCDTRGSEAILGDNSHIHVYEHGGISTLGGVHPRIVANNADGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR     + +PTTRLICL
Sbjct  121  IVAAIRSRDGSLYYPTTRLICL  142



>ref|NP_001140767.1| putative threonine aldolase family protein [Zea mays]
 gb|ACF84582.1| unknown [Zea mays]
 tpg|DAA36967.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=321

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M ++ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A +MGKEA LFVP
Sbjct  1    MASKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFEAEMAAVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEAILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR P  ++ +PTTRLICL
Sbjct  121  IVAAIRHP--DLHYPTTRLICL  140



>ref|XP_006652519.1| PREDICTED: uncharacterized protein R102.4-like [Oryza brachyantha]
Length=372

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R E E+A+IMGKEA LFVP
Sbjct  1    MVTKLVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFETEMARIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC  RGSE+ILGD SHIHIYENGGISTIGGVHP+T++NN DGTMD+D+
Sbjct  61   SGTMANLISVLVHCDTRGSEVILGDNSHIHIYENGGISTIGGVHPKTVRNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR P   + +PTTRLICL
Sbjct  121  IVAAIRHPDGALYYPTTRLICL  142



>ref|NP_001241763.1| L-allo-threonine aldolase [Zea mays]
 gb|ACG36649.1| L-allo-threonine aldolase [Zea mays]
Length=370

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M ++ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A +MGKEA LFVP
Sbjct  1    MASKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFEAEMAAVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEAILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR P  ++ +PTTRLICL
Sbjct  121  IVAAIRHP--DLHYPTTRLICL  140



>ref|XP_008667491.1| PREDICTED: putative threonine aldolase family protein isoform 
X1 [Zea mays]
 tpg|DAA36968.1| TPA: putative threonine aldolase family protein [Zea mays]
Length=370

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M ++ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A +MGKEA LFVP
Sbjct  1    MASKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFEAEMAAVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEAILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR P  ++ +PTTRLICL
Sbjct  121  IVAAIRHP--DLHYPTTRLICL  140



>ref|XP_008667492.1| PREDICTED: putative threonine aldolase family protein isoform 
X2 [Zea mays]
Length=360

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M ++ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A +MGKEA LFVP
Sbjct  1    MASKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFEAEMAAVMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE ILGD SHIH+YENGGISTIGGVHPRT+KNN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEAILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR P  ++ +PTTRLICL
Sbjct  121  IVAAIRHP--DLHYPTTRLICL  140



>gb|EMT23922.1| hypothetical protein F775_09169 [Aegilops tauschii]
Length=261

 Score =   197 bits (502),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 130/168 (77%), Gaps = 9/168 (5%)
 Frame = +2

Query  143  SFAFLIRKGTEQSSQFHLWFSRRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGF  322
            S+ FL+++  +   Q        +MVT+ V   SDTVT P+EAMRAAMA+AEVDDDVLG 
Sbjct  25   SYEFLLKRELQLRRQG-------RMVTKVVAPGSDTVTNPSEAMRAAMAAAEVDDDVLGA  77

Query  323  DPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGG  502
            DPTAQRLEAE+A++ GKEA LFVPSGTMGNL+SVLT C  RGSE+ILGD SHIH+ ENGG
Sbjct  78   DPTAQRLEAEMARVTGKEAALFVPSGTMGNLVSVLTQCDTRGSEVILGDSSHIHMCENGG  137

Query  503  ISTIGGVHPRTIKNNDDGTMDLDQIEAAIRD--PRFEICFPTTRLICL  640
            ISTIGGVHPRT++NN DGTMD+D I AAIR       + +PTTRLICL
Sbjct  138  ISTIGGVHPRTVRNNPDGTMDIDMIVAAIRHHVGAGALHYPTTRLICL  185



>dbj|BAK01917.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+ VDLRSDTVTKP+EAMRAAMA+AEVDDDVLG DPTAQR EAE+A+I GKEA LFVP
Sbjct  1    MVTKVVDLRSDTVTKPSEAMRAAMAAAEVDDDVLGADPTAQRFEAEMARITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL+SVLTHC  RGSE+ILGD SHIH+ ENGGISTIGGVH   + NN DGTMD+D+
Sbjct  61   SGTMGNLVSVLTHCDTRGSEVILGDSSHIHMCENGGISTIGGVHSMPVVNNPDGTMDIDK  120

Query  575  IEAAIRD--PRFEICFPTTRLICL  640
            I AAIR       + +PTTRLICL
Sbjct  121  IVAAIRHRVGAGALHYPTTRLICL  144



>dbj|BAK03835.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 121/144 (84%), Gaps = 2/144 (1%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+ VDLRSDTVTKP+EAMRAAMA+AEVDDDVLG DPTAQR EAE+A+I GKEA LFVP
Sbjct  1    MVTKVVDLRSDTVTKPSEAMRAAMAAAEVDDDVLGADPTAQRFEAEMARITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL+SVLTHC  RGSE+ILGD SHIH+ ENGGISTIGGVH   + NN DGTMD+D+
Sbjct  61   SGTMGNLVSVLTHCDTRGSEVILGDSSHIHMCENGGISTIGGVHSMPVVNNPDGTMDIDK  120

Query  575  IEAAIRD--PRFEICFPTTRLICL  640
            I AAIR       + +PTTRLICL
Sbjct  121  IVAAIRHRVGAGALHYPTTRLICL  144



>ref|NP_001141974.1| putative threonine aldolase family protein isoform 1 [Zea mays]
 gb|ACF87405.1| unknown [Zea mays]
 tpg|DAA36969.1| TPA: putative threonine aldolase family protein isoform 1 [Zea 
mays]
 tpg|DAA36970.1| TPA: putative threonine aldolase family protein isoform 2 [Zea 
mays]
Length=221

 Score =   193 bits (491),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT  VDLRSDTVTKP++AMRAAMA+A+VDDDVLG DPTA+R EAE+A ++GKEA LFVP
Sbjct  1    MVTNVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTARRFEAEMAALLGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHPRT+ NN DGTMDL +
Sbjct  61   SGTMANLVSVLAHCDVRGSEVILGDASHIHVYENGGISTLGGVHPRTVPNNPDGTMDLAR  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I  AIR+P   + +PTTRLICL
Sbjct  121  IVDAIRNPDGALLYPTTRLICL  142



>ref|XP_003580135.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brachypodium 
distachyon]
 ref|XP_010240138.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Brachypodium 
distachyon]
Length=372

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+ VDLRSDTVTKP++AMRAAMA+A+VDDDVLG DPTAQR EAE+A+IMGKEA LFVP
Sbjct  1    MVTKVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTAQRFEAEMARIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NL+SVL HC  RGSEIILGD SHIHIYENGGIS++GGVHP+T+ NN DGTMD+D+
Sbjct  61   SGTMANLVSVLVHCDTRGSEIILGDTSHIHIYENGGISSLGGVHPKTLPNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR     + +PTTRLICL
Sbjct  121  IVAAIRHQDGALYYPTTRLICL  142



>gb|EMT28261.1| hypothetical protein F775_27222 [Aegilops tauschii]
Length=259

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  MASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIIL  463
            MA+AEVDDDVLG DPTAQR EAE+A+IMGKEA LFVPSGTMGNL+SVL HC  RGSE+IL
Sbjct  1    MAAAEVDDDVLGADPTAQRFEAEMARIMGKEAALFVPSGTMGNLVSVLAHCDTRGSEVIL  60

Query  464  GDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICL  640
            GD SHIHIYENGGI+T+GGVHPRT+ NN DGTMD+D+I AAIR     + +PTTRLICL
Sbjct  61   GDNSHIHIYENGGIATLGGVHPRTVPNNPDGTMDVDKIVAAIRHRDGAMYYPTTRLICL  119



>gb|EMS52584.1| L-allo-threonine aldolase [Triticum urartu]
Length=349

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  MASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIIL  463
            MA+AEVDDDVLG DPTAQR EAE+A+IMGKEA LFVPSGTMGNL+SVL HC  RGSE+IL
Sbjct  1    MAAAEVDDDVLGADPTAQRFEAEMARIMGKEAALFVPSGTMGNLVSVLAHCDTRGSEVIL  60

Query  464  GDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICL  640
            GD SHIHIYENGGIST+GGVHPRT+ NN DGTMD+ +I AAIR P   + +PTTRLICL
Sbjct  61   GDNSHIHIYENGGISTLGGVHPRTVPNNPDGTMDIHKIVAAIRHPDGAMYYPTTRLICL  119



>dbj|BAJ93201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M  + VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA+R EAE+A+IMGKEA LFVP
Sbjct  1    MAAKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTARRFEAEMARIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC  RGSE+ILGD SHIH+YE+GGIST+GGVHPRT+ NN DGTMD+D+
Sbjct  61   SGTMANLISVLAHCDARGSEVILGDDSHIHVYEHGGISTLGGVHPRTVPNNPDGTMDVDR  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR P   + +PTTRLICL
Sbjct  121  IVAAIRSPDGALYYPTTRLICL  142



>ref|XP_002448187.1| hypothetical protein SORBIDRAFT_06g022630 [Sorghum bicolor]
 gb|EES12515.1| hypothetical protein SORBIDRAFT_06g022630 [Sorghum bicolor]
Length=372

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT+ VDLRSDTVTKP++AMRAAMA+A+VDDDVLG DPTA+R E E+A + GK+A LFVP
Sbjct  1    MVTKVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTARRFEGEMAALTGKDAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHPRT+ NN DGTMD+D+
Sbjct  61   SGTMANLISVLVHCDVRGSEVILGDNSHIHVYENGGISTIGGVHPRTVPNNPDGTMDVDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR+P   + +PTTRLICL
Sbjct  121  ILAAIRNPDGALLYPTTRLICL  142



>tpg|DAA36971.1| TPA: putative threonine aldolase family protein isoform 1 [Zea 
mays]
 tpg|DAA36972.1| TPA: putative threonine aldolase family protein isoform 2 [Zea 
mays]
Length=372

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT  VDLRSDTVTKP++AMRAAMA+A+VDDDVLG DPTA+R EAE+A ++GKEA LFVP
Sbjct  1    MVTNVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTARRFEAEMAALLGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NL+SVL HC +RGSE+ILGD SHIH+YENGGIST+GGVHPRT+ NN DGTMDL +
Sbjct  61   SGTMANLVSVLAHCDVRGSEVILGDASHIHVYENGGISTLGGVHPRTVPNNPDGTMDLAR  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I  AIR+P   + +PTTRLICL
Sbjct  121  IVDAIRNPDGALLYPTTRLICL  142



>ref|NP_001053314.1| Os04g0516600 [Oryza sativa Japonica Group]
 emb|CAD41482.2| OSJNBb0072M01.18 [Oryza sativa Japonica Group]
 dbj|BAF15228.1| Os04g0516600 [Oryza sativa Japonica Group]
 emb|CAH67219.1| OSIGBa0145M07.1 [Oryza sativa Indica Group]
 dbj|BAG94039.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87066.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC77644.1| hypothetical protein OsI_16646 [Oryza sativa Indica Group]
 gb|EEE61341.1| hypothetical protein OsJ_15466 [Oryza sativa Japonica Group]
Length=372

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            MVT  VDLRSDTVTKP++AMRAAMA+A+VDDDVLG DPTA R E E+A+I GKEA LFVP
Sbjct  1    MVTNVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTAHRFEMEMARITGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC  RGSE+ILGD SHIHIYENGGISTIGGVHP+T++NN DGTMD+D+
Sbjct  61   SGTMANLISVLVHCDTRGSEVILGDNSHIHIYENGGISTIGGVHPKTVRNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I  AIR P   + +PTTRLICL
Sbjct  121  IVVAIRHPDGALYYPTTRLICL  142



>gb|EMT07295.1| hypothetical protein F775_08681 [Aegilops tauschii]
Length=317

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M T+ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A+IMGKEA LFVP
Sbjct  1    MATKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTACRFEAEMARIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC  RGSE+ILGD SH+H+YE+GGIST+GGVHPRT+ NN DGTMD+D+
Sbjct  61   SGTMANLISVLAHCDARGSEVILGDDSHVHVYEHGGISTLGGVHPRTVPNNPDGTMDVDR  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR     + +PTTRLICL
Sbjct  121  IVAAIRSTDGALYYPTTRLICL  142



>gb|EMS67121.1| L-allo-threonine aldolase [Triticum urartu]
Length=367

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M T+ VDLRSDTVTKP+EAMRAAMA+A+VDDDVLG DPTA R EAE+A+IMGKEA LFVP
Sbjct  1    MATKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTACRFEAEMARIMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTM NLISVL HC  RGSE+ILG  SHIH+YE+GGIST+GGVHPRT+ NN DGTMD+D+
Sbjct  61   SGTMANLISVLAHCDARGSEVILGHDSHIHVYEHGGISTLGGVHPRTVPNNPDGTMDVDR  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR     + +PTTRLICL
Sbjct  121  IVAAIRSTDGALYYPTTRLICL  142



>gb|EMS46485.1| L-allo-threonine aldolase [Triticum urartu]
Length=272

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +2

Query  284  MASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIIL  463
            MA+AEVDDDVLG DPTAQR EAE+A+I GKEA LFVPSGTMGNLISVLTHC  RGSE+IL
Sbjct  1    MAAAEVDDDVLGADPTAQRFEAEMARITGKEAALFVPSGTMGNLISVLTHCDTRGSEVIL  60

Query  464  GDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRD--PRFEICFPTTRLIC  637
            GD SHIH+ ENGGISTIGGVHPRT++NN DGTMD+D I AAIR       + +PTTRLIC
Sbjct  61   GDTSHIHMCENGGISTIGGVHPRTVRNNPDGTMDIDMIVAAIRHHVGAGALHYPTTRLIC  120

Query  638  L  640
            L
Sbjct  121  L  121



>emb|CAE05443.2| OSJNBa0073E02.3 [Oryza sativa Japonica Group]
Length=349

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +2

Query  284  MASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIIL  463
            MA+A+VDDDVLG DPTA R E E+A+I GKEA LFVPSGTM NLISVL HC  RGSE+IL
Sbjct  1    MAAADVDDDVLGADPTAHRFEMEMARITGKEAALFVPSGTMANLISVLVHCDTRGSEVIL  60

Query  464  GDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICL  640
            GD SHIHIYENGGISTIGGVHP+T++NN DGTMD+D+I  AIR P   + +PTTRLICL
Sbjct  61   GDNSHIHIYENGGISTIGGVHPKTVRNNPDGTMDIDKIVVAIRHPDGALYYPTTRLICL  119



>ref|XP_004976226.1| PREDICTED: uncharacterized protein R102.4-like [Setaria italica]
Length=321

 Score =   186 bits (471),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M ++ VDLRSDTVTKP++AMRAAMA+A VDDDV+G DPTAQ+ + E+A +MGKEA LFVP
Sbjct  1    MASKVVDLRSDTVTKPSDAMRAAMAAAVVDDDVVGVDPTAQQFQEEMAALMGKEAALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNLISVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHP+T++NN DGTMD+D+
Sbjct  61   SGTMGNLISVLVHCDVRGSEVILGDDSHIHVYENGGISTIGGVHPKTVRNNPDGTMDIDK  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            I AAIR P  ++ +PTTRLICL
Sbjct  121  IVAAIRHP--DLHYPTTRLICL  140



>ref|XP_001768407.1| predicted protein [Physcomitrella patens]
 gb|EDQ66769.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 113/139 (81%), Gaps = 1/139 (1%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            R VD RSDTVTKPT AMRAAMA+AEVDDD+LG DPT   L+ ++A +MGKEAGLFVPSGT
Sbjct  14   RVVDFRSDTVTKPTAAMRAAMANAEVDDDILGVDPTMNELQKQVATVMGKEAGLFVPSGT  73

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNLI+VL HC +RGSE+I+G+ SHI  YE GGIST+GGVHPRT+ NN DGT DL ++EA
Sbjct  74   MGNLIAVLVHCEVRGSEVIIGEESHIMHYEQGGISTLGGVHPRTVPNNADGTFDLKKVEA  133

Query  584  AIRDPRFEICFPTTRLICL  640
            AIR    +  FP TRLICL
Sbjct  134  AIR-YELDDHFPITRLICL  151



>ref|XP_004976222.1| PREDICTED: uncharacterized protein R102.4-like [Setaria italica]
Length=372

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 119/137 (87%), Gaps = 1/137 (1%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            VDLRSDT+TKPTEAMRAAMA+A+VDDDV   DPTA+R +AE+A +MGKEA LFVPSGTM 
Sbjct  7    VDLRSDTITKPTEAMRAAMAAADVDDDVRDGDPTARRFQAEMAALMGKEAALFVPSGTMA  66

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+SVL HC +RGSE+ILGD SHIH+YENGGISTIGGVHP T+++N DGTMD+D+I AAI
Sbjct  67   NLVSVLVHCDVRGSEVILGDDSHIHLYENGGISTIGGVHPTTVRSNPDGTMDIDKIVAAI  126

Query  590  RDPRFEICFPTTRLICL  640
            R P   I +PTTRLICL
Sbjct  127  RRPDV-IYYPTTRLICL  142



>ref|WP_014434736.1| threonine aldolase [Caldilinea aerophila]
 dbj|BAM01510.1| putative threonine aldolase [Caldilinea aerophila DSM 14535 = 
NBRC 104270]
Length=346

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 104/139 (75%), Gaps = 3/139 (2%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            + +DLRSDTVTKPT AMR AMA AEV DDV G DPT  RLEA +A+ +GKEA LFVPSGT
Sbjct  3    KVIDLRSDTVTKPTPAMRRAMAEAEVGDDVYGEDPTVNRLEALVAERLGKEAALFVPSGT  62

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNLIS+L+HC  RG E++LGD +HI  YE GG + +GGVHPR + N  DGT+DL Q+ +
Sbjct  63   MGNLISILSHCG-RGDEMLLGDQAHIFHYEQGGSAAVGGVHPRILPNCPDGTIDLHQLNS  121

Query  584  AIRDPRFEICFPTTRLICL  640
            +IR    +  FP TRLI L
Sbjct  122  SIRGD--DEHFPVTRLIAL  138



>ref|XP_003058675.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57130.1| predicted protein [Micromonas pusilla CCMP1545]
Length=640

 Score =   171 bits (434),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 101/139 (73%), Gaps = 2/139 (1%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            R +DLRSDTVTKPT+ MRAAMA+A   DDV G DPT + LE  +A   GKEA LFVPSGT
Sbjct  290  RIIDLRSDTVTKPTQTMRAAMATAICGDDVFGDDPTVKDLEIVVAAAFGKEAALFVPSGT  349

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNLI+V  HC +RGSE I GD SH+HIYE GG+ST+ G HPR +KN DDGT+DL +I  
Sbjct  350  MGNLIAVGVHCEVRGSEFICGDLSHVHIYEQGGLSTLMGAHPRALKNEDDGTIDLQRIRN  409

Query  584  AIRDPRFEICFPTTRLICL  640
            A R    +  FP T ++C+
Sbjct  410  AFRSD--DQHFPRTTVLCI  426



>ref|XP_005989151.1| PREDICTED: uncharacterized protein R102.4-like [Latimeria chalumnae]
Length=417

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 103/139 (74%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            R VDLRSDTVTKP  AMR+AMA A+V DDV G DPT   LE   A++ G EA LFVPSGT
Sbjct  48   RCVDLRSDTVTKPGPAMRSAMAQAQVGDDVYGEDPTVYELERRGAELFGMEATLFVPSGT  107

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNLISV+ HC  RG+E+++GD +H+H+YE GGI+ + G+H RT+KN  DGT DL +++ 
Sbjct  108  MGNLISVMCHCRERGAELVVGDQAHVHLYEQGGIAQLAGIHSRTVKNLPDGTFDLREVKT  167

Query  584  AIRDPRFEICFPTTRLICL  640
             +RD   +  +P +RLIC+
Sbjct  168  KLRDGYPDPHYPRSRLICV  186



>emb|CDQ60587.1| unnamed protein product [Oncorhynchus mykiss]
Length=432

 Score =   168 bits (425),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             RTVDLRSDTVTKP  AMR AMA AEV DDV G DPT   L+   A++ G EA L+VPSG
Sbjct  62   ARTVDLRSDTVTKPGAAMRQAMAEAEVGDDVFGEDPTVNELQKMAAEVFGMEAALYVPSG  121

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+ N  DGT DLDQ+E
Sbjct  122  TMANLIAVMVHCRERGDEMIVGDLSHLHIYEQGGSAQLAGVHSTTVTNLPDGTFDLDQLE  181

Query  581  AAIRDPRFEICFPTTRLICL  640
            + IR    +  +P +RL+C+
Sbjct  182  SKIRHGYPDAHYPRSRLVCV  201



>ref|XP_011429035.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Crassostrea 
gigas]
Length=402

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 103/140 (74%), Gaps = 7/140 (5%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            VDLRSDTVTKP+  MR AMA+AEV DDV+G DPT   L+  I+K+  KEA LFVP+GTMG
Sbjct  43   VDLRSDTVTKPSPGMRNAMATAEVGDDVMGEDPTVNALQNRISKLFDKEAALFVPTGTMG  102

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NLISV THCP RG E++LG  SHI ++E G I+  GG+   T++NNDDGTMDL++++  I
Sbjct  103  NLISVFTHCPERGLEVVLGHKSHIFVHEQGNIAQFGGLLTSTVENNDDGTMDLEKMKERI  162

Query  590  R---DPRFEICFPTTRLICL  640
            R   DP     FP TRLIC+
Sbjct  163  RLSDDPH----FPYTRLICV  178



>ref|XP_002594275.1| hypothetical protein BRAFLDRAFT_260210 [Branchiostoma floridae]
 gb|EEN50286.1| hypothetical protein BRAFLDRAFT_260210 [Branchiostoma floridae]
Length=360

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 100/137 (73%), Gaps = 6/137 (4%)
 Frame = +2

Query  236  LRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNL  415
            +RSDT+TKPT AMR AMA AEV DDV G DPT   L+ + AK+ G EA LFVP+GTMGN 
Sbjct  1    MRSDTITKPTPAMRRAMAEAEVGDDVYGEDPTVNALQEKAAKLFGMEAALFVPTGTMGNF  60

Query  416  ISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIR-  592
             S++ HC  RGSE++LGD +HI IYE GG + +GG+HPRT++N  DGT DLD++E+ +R 
Sbjct  61   CSIMAHCWERGSEMLLGDCAHIFIYEQGGSAQLGGIHPRTVRNKPDGTFDLDEVESKVRT  120

Query  593  -DPRFEICFPTTRLICL  640
             DP      P TRLIC+
Sbjct  121  SDPH----LPITRLICV  133



>ref|WP_026159079.1| threonine aldolase [Nitrospina sp. SCGC AAA288-L16]
Length=344

 Score =   164 bits (415),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 101/138 (73%), Gaps = 3/138 (2%)
 Frame = +2

Query  227  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  406
            T+DLRSDT+T+PTE+MR AMA AEV DDV G DPT  RLE   A  MGKEA +FVPSGTM
Sbjct  3    TIDLRSDTLTQPTESMRKAMAEAEVGDDVFGEDPTVNRLEKIAADRMGKEAAIFVPSGTM  62

Query  407  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  586
            GNLI +L+HC  RG E+ILGD SHI + E GGI+ +GG+HP  I N  DGT++L+ +E  
Sbjct  63   GNLIGMLSHCN-RGDEVILGDQSHIFLNEVGGIAALGGIHPHIISNESDGTLNLETVEKK  121

Query  587  IRDPRFEICFPTTRLICL  640
            IR    ++ +P TRLI L
Sbjct  122  IRAS--DLHYPPTRLIAL  137



>ref|XP_006635478.1| PREDICTED: uncharacterized protein R102.4-like [Lepisosteus oculatus]
Length=398

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 103/153 (67%), Gaps = 4/153 (3%)
 Frame = +2

Query  194  LWFSRRKMVT----RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAK  361
            L++   K VT    RTVDLRSDTVTKP  AMR AMA AEV DDV G DPT   L+   A 
Sbjct  15   LYYVSPKSVTGNSFRTVDLRSDTVTKPGPAMRRAMAEAEVGDDVFGEDPTVNELQKRAAD  74

Query  362  IMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIK  541
            + G EA LFVP+GTM NLI+V+ HC  RG EII+GD SH+H+YE GG +   GVH  T+ 
Sbjct  75   VFGMEAALFVPTGTMSNLIAVMVHCSERGDEIIVGDQSHLHVYEQGGSAQCAGVHSTTVS  134

Query  542  NNDDGTMDLDQIEAAIRDPRFEICFPTTRLICL  640
            N  DGT DL+++E+ IR    +  +P +RL+C+
Sbjct  135  NLPDGTFDLEEMESKIRHGYPDAHYPRSRLVCV  167



>ref|XP_010893799.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Esox 
lucius]
Length=429

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 98/139 (71%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            RTVDLRSDTVTKP  AMR AMA AEV DDV G DPT   L+   A++ G EA L+VPSGT
Sbjct  60   RTVDLRSDTVTKPGAAMRQAMAEAEVGDDVFGEDPTVNELQKMAAELFGMEAALYVPSGT  119

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            M NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DLDQ+E+
Sbjct  120  MANLIAVMVHCRERGDEMIVGDLSHLHIYEQGGTAQLAGVHSTTVTTLPDGTFDLDQLES  179

Query  584  AIRDPRFEICFPTTRLICL  640
             IR    +  +P +RL+C+
Sbjct  180  KIRHGYPDAHYPRSRLVCV  198



>ref|WP_005011469.1| Low-specificity L-threonine aldolase [Nitrospina gracilis]
 emb|CCQ92024.1| Low-specificity L-threonine aldolase [Nitrospina gracilis 3/211]
Length=344

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 105/139 (76%), Gaps = 3/139 (2%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            + +D RSDT+T+PT+AMR AMA+A+V DDV   DPT  RL+   A+  GKEA LFVPSGT
Sbjct  2    QIIDYRSDTLTQPTDAMRQAMANAKVGDDVFDEDPTVHRLQELAAEKTGKEAALFVPSGT  61

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNL+S+LTHC  RG EIILG  SHI I E GG+S +GG+HP  + N DDGT+D+ +++A
Sbjct  62   MGNLVSLLTHCQ-RGDEIILGRRSHIFINEVGGLSALGGIHPHPVANRDDGTLDMGEVKA  120

Query  584  AIRDPRFEICFPTTRLICL  640
            AIR  + ++ +P TRLICL
Sbjct  121  AIR--KDDVHYPPTRLICL  137



>ref|XP_002973664.1| hypothetical protein SELMODRAFT_99781 [Selaginella moellendorffii]
 gb|EFJ25324.1| hypothetical protein SELMODRAFT_99781 [Selaginella moellendorffii]
Length=358

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 106/139 (76%), Gaps = 1/139 (1%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            R VD RSDT+TKPT AMRAAMASAEVDDD++  DPT   L+ E+A+I GKEA LFVPSGT
Sbjct  10   RIVDFRSDTITKPTAAMRAAMASAEVDDDIVTVDPTMDELQKEMARIFGKEAALFVPSGT  69

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNLISVL HC  R SE I+G  SHI++YE GG++T+GGV P  + NN DGTMDL  +E 
Sbjct  70   MGNLISVLVHCEARASEAIIGSESHINVYEQGGMATLGGVFPSIVPNNPDGTMDLRAVEN  129

Query  584  AIRDPRFEICFPTTRLICL  640
            AI+ P  +  F TTRLIC+
Sbjct  130  AIK-PLDDEHFATTRLICI  147



>ref|XP_002975719.1| hypothetical protein SELMODRAFT_103881 [Selaginella moellendorffii]
 gb|EFJ23348.1| hypothetical protein SELMODRAFT_103881 [Selaginella moellendorffii]
Length=358

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 106/139 (76%), Gaps = 1/139 (1%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            R VD RSDT+TKPT AMRAAMASAEVDDD++  DPT   L+ E+A+I GKEA LFVPSGT
Sbjct  10   RIVDFRSDTITKPTAAMRAAMASAEVDDDIVTVDPTMDELQKEMARIFGKEAALFVPSGT  69

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNLISVL HC  R SE I+G  SHI++YE GG++T+GGV P  + NN DGTMDL  +E 
Sbjct  70   MGNLISVLVHCEARASEAIIGSESHINVYEQGGMATLGGVFPSIVPNNPDGTMDLRAVEN  129

Query  584  AIRDPRFEICFPTTRLICL  640
            AI+ P  +  F TTRLIC+
Sbjct  130  AIK-PLDDEHFATTRLICI  147



>ref|WP_026171962.1| threonine aldolase [Nitrospina sp. AB-629-B18]
Length=344

 Score =   161 bits (408),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 101/138 (73%), Gaps = 3/138 (2%)
 Frame = +2

Query  227  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  406
            T+DLRSDT+T+PTE+MR A+A AEV DDV   DPT  RLE   A  MGKE  +FVPSGTM
Sbjct  3    TIDLRSDTLTQPTESMRKAIAEAEVGDDVFSEDPTVNRLEKIAADRMGKETAVFVPSGTM  62

Query  407  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  586
            GNLIS+L+HC  RG E++LGD SHI + E GGI+ +GG+HP TI N  DGT++L+ IE  
Sbjct  63   GNLISMLSHCN-RGDEVLLGDQSHIFLNEVGGIAALGGIHPHTISNESDGTLNLETIEKK  121

Query  587  IRDPRFEICFPTTRLICL  640
            IR    ++ +P TRLI L
Sbjct  122  IRAS--DLHYPPTRLIAL  137



>ref|XP_005943923.1| PREDICTED: uncharacterized protein R102.4-like isoform X2 [Haplochromis 
burtoni]
 ref|XP_005943924.1| PREDICTED: uncharacterized protein R102.4-like isoform X3 [Haplochromis 
burtoni]
Length=336

 Score =   161 bits (407),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = +2

Query  209  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  388
            R    R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA LF
Sbjct  54   RAAHVRVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFGMEAALF  113

Query  389  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  568
            VPSGTM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DL
Sbjct  114  VPSGTMSNLIAVMVHCRERGDEVIVGDLSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDL  173

Query  569  DQIEAAIRDPRFEICFPTTRLICL  640
            +Q+E+ IR    +  +P +RL+C+
Sbjct  174  EQLESKIRHGYPDPHYPRSRLVCV  197



>ref|XP_008300571.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Stegastes 
partitus]
Length=431

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 96/140 (69%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA LFVPSG
Sbjct  61   VRVVDLRSDTVTKPGPAMRRAMAEAEVGDDVMGEDPTVNELQKMTADLFGMEAALFVPSG  120

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TMGNLI+V+ HC  RG E+I+GD  HIHIYE G  + + GVH  T+    DGT DLDQ+E
Sbjct  121  TMGNLIAVMVHCRERGDEMIVGDRCHIHIYEQGSSAQLAGVHSTTVTTLPDGTFDLDQLE  180

Query  581  AAIRDPRFEICFPTTRLICL  640
            + IR    +  +P +RLICL
Sbjct  181  SKIRHGYPDPHYPRSRLICL  200



>gb|EKC35640.1| E3 ubiquitin-protein ligase TRAF7 [Crassostrea gigas]
Length=1658

 Score =   169 bits (427),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 103/140 (74%), Gaps = 7/140 (5%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            VDLRSDTVTKP+  MR AMA+AEV DDV+G DPT   L+  I+K+  KEA LFVP+GTMG
Sbjct  694  VDLRSDTVTKPSPGMRNAMATAEVGDDVMGEDPTVNALQNRISKLFDKEAALFVPTGTMG  753

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NLISV THCP RG E++LG  SHI ++E G I+  GG+   T++NNDDGTMDL++++  I
Sbjct  754  NLISVFTHCPERGLEVVLGHKSHIFVHEQGNIAQFGGLLTSTVENNDDGTMDLEKMKERI  813

Query  590  R---DPRFEICFPTTRLICL  640
            R   DP     FP TRLIC+
Sbjct  814  RLSDDPH----FPYTRLICV  829



>ref|WP_011697570.1| threonine aldolase [Syntrophobacter fumaroxidans]
 gb|ABK16397.1| L-threonine aldolase [Syntrophobacter fumaroxidans MPOB]
Length=353

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 101/137 (74%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+PT++MR AMA A+V DDV G DPT   L+ + A+ +GKEA LFV SGTM 
Sbjct  4    IDLRSDTVTQPTQSMRRAMAEAKVGDDVFGEDPTVNTLQEKAAERLGKEAALFVASGTMA  63

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+S+LTHC  RG E+ILGD SHI +YE GG + +GG+HPRT+ N   GTM +  IEAAI
Sbjct  64   NLVSLLTHCG-RGDEVILGDRSHIFLYEQGGTAALGGIHPRTVPNEPHGTMSVCGIEAAI  122

Query  590  RDPRFEICFPTTRLICL  640
            R+    + FP TRLI L
Sbjct  123  REE--NVHFPPTRLIAL  137



>ref|XP_004556683.1| PREDICTED: uncharacterized protein R102.4-like [Maylandia zebra]
Length=428

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = +2

Query  209  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  388
            R    R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA LF
Sbjct  54   RAAHVRVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFGMEAALF  113

Query  389  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  568
            VPSGTM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DL
Sbjct  114  VPSGTMSNLIAVMVHCRERGDEVIVGDLSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDL  173

Query  569  DQIEAAIRDPRFEICFPTTRLICL  640
            +Q+E+ IR    +  +P +RL+C+
Sbjct  174  EQLESKIRHGYPDPHYPRSRLVCV  197



>ref|XP_005943922.1| PREDICTED: uncharacterized protein R102.4-like isoform X1 [Haplochromis 
burtoni]
Length=428

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = +2

Query  209  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  388
            R    R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA LF
Sbjct  54   RAAHVRVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFGMEAALF  113

Query  389  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  568
            VPSGTM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DL
Sbjct  114  VPSGTMSNLIAVMVHCRERGDEVIVGDLSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDL  173

Query  569  DQIEAAIRDPRFEICFPTTRLICL  640
            +Q+E+ IR    +  +P +RL+C+
Sbjct  174  EQLESKIRHGYPDPHYPRSRLVCV  197



>ref|WP_020877756.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Desulfococcus multivorans]
 gb|EPR35940.1| aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Desulfococcus multivorans DSM 2059]
Length=347

 Score =   159 bits (403),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 98/139 (71%), Gaps = 3/139 (2%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            + ++LRSDT+T+PT AMR AMA A V DDV G DPT  RLEA  A+  GK A L VPSGT
Sbjct  2    QVIELRSDTLTRPTPAMRRAMAEAPVGDDVFGEDPTVNRLEAMAAECTGKAAALLVPSGT  61

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNL++ LTHC  RG E ILGD SH+  YE GG + +GG+HPRTI N  DGT+DL+   A
Sbjct  62   MGNLVAQLTHCG-RGCETILGDQSHVFYYEQGGAAALGGIHPRTIPNRPDGTLDLEATTA  120

Query  584  AIRDPRFEICFPTTRLICL  640
            AIR    ++ FP TRLI L
Sbjct  121  AIRPD--DLHFPRTRLILL  137



>ref|WP_013559406.1| threonine aldolase [Anaerolinea thermophila]
 dbj|BAJ63015.1| threonine aldolase [Anaerolinea thermophila UNI-1]
Length=347

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 102/144 (71%), Gaps = 7/144 (5%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M+   +DLRSDTVT PT  MR AMA AEV DDV+G DPT  RLE   A+ MGKEAGLFVP
Sbjct  1    MINHFIDLRSDTVTHPTPEMRQAMAQAEVGDDVMGEDPTVNRLEELAAEKMGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL ++LTHC  RG E+I+G  SH +++E GG + +GGVHP  ++N  DGT+ L+ 
Sbjct  61   SGTMGNLTAILTHCG-RGDEMIVGHLSHTYLFEAGGSAALGGVHPFVLQNQPDGTLRLED  119

Query  575  IEAAIR--DPRFEICFPTTRLICL  640
            +  A+R  DP     +PTTRLI L
Sbjct  120  LRHAVREDDPH----YPTTRLIIL  139



>ref|XP_002121406.1| PREDICTED: probable low-specificity L-threonine aldolase 2 isoform 
X1 [Ciona intestinalis]
Length=365

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 101/142 (71%), Gaps = 1/142 (1%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M   TVDLRSDT++ PT  MR AMA AE+ DDV G DPT  RL+   A++ GKE  LFVP
Sbjct  1    MEVVTVDLRSDTLSLPTADMRCAMAEAELGDDVYGEDPTVNRLQMLAAELFGKEDALFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            +GTMGNLISV+ HC  RGSE++LGD SHIH +E GGI+ + GVHP+TI+N  DGT  L +
Sbjct  61   TGTMGNLISVMCHCWQRGSEVLLGDQSHIHRFEQGGIAQLAGVHPKTIRNLPDGTFQLSE  120

Query  575  IEAAIRDPRFEICFPTTRLICL  640
            ++A  +    ++ F +T LIC+
Sbjct  121  LQAKYQTSA-DVHFASTSLICV  141



>ref|WP_038087996.1| threonine aldolase [Thiobacillus prosperus]
 gb|KFZ90980.1| L-allo-threonine aldolase [Thiobacillus prosperus]
Length=356

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 98/138 (71%), Gaps = 3/138 (2%)
 Frame = +2

Query  227  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  406
            TVDLRSDT+T+PT++MR AMA AEV DDV G DPT   LEA  A+ +GK A LFVPSGTM
Sbjct  11   TVDLRSDTLTRPTDSMREAMARAEVGDDVYGEDPTVNALEALAAERLGKAAALFVPSGTM  70

Query  407  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  586
            GNLISVL  C  RG E+ILG  +HI  YE GG +  GGV PRT+ N  DGT+DL ++EAA
Sbjct  71   GNLISVLAQCG-RGDEMILGADAHIFYYEQGGAAGFGGVQPRTLANRADGTLDLAEVEAA  129

Query  587  IRDPRFEICFPTTRLICL  640
            IR       +P TRLI L
Sbjct  130  IRADNDH--YPVTRLIAL  145



>ref|XP_007562537.1| PREDICTED: uncharacterized protein R102.4-like [Poecilia formosa]
Length=418

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 96/140 (69%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A++ G EA LFVPSG
Sbjct  51   VRVVDLRSDTVTKPGPAMRQAMAQAEVGDDVMGEDPTVNELQKLAAEMFGMEASLFVPSG  110

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NLI+V+ HC  R  E+I+GD SH+HIYE GG + + GVH  T+    DGT DL Q+E
Sbjct  111  TMSNLIAVMVHCRERSDEMIVGDLSHMHIYEQGGSAQLAGVHATTVTTRPDGTFDLKQLE  170

Query  581  AAIRDPRFEICFPTTRLICL  640
            + IR    +  +P TRLIC+
Sbjct  171  SKIRHGYPDPHYPRTRLICV  190



>ref|XP_003979332.1| PREDICTED: uncharacterized protein R102.4-like, partial [Takifugu 
rubripes]
Length=394

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
            TR VDLRSDTVTKPT AMR AMASAEV DDV+G DPT   L+   A++   EA LFV SG
Sbjct  25   TRVVDLRSDTVTKPTPAMRQAMASAEVGDDVMGEDPTVNELQKVAAELFRMEAALFVTSG  84

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TMGNL++ + HC  R  E+I+GD SHIH+YE GG + + GVH  T++   DGT DL ++E
Sbjct  85   TMGNLLAAMVHCRRRDDEMIVGDLSHIHVYEQGGSAYLAGVHSTTVRTQPDGTFDLTELE  144

Query  581  AAIRDPRFEICFPTTRLICL  640
            + IR    +  +P TRLIC+
Sbjct  145  SKIRHGYPDPHYPRTRLICV  164



>ref|XP_004080515.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Oryzias 
latipes]
Length=428

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 96/140 (69%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA +FVPSG
Sbjct  60   ARVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNDLQQTAADLFGMEAAIFVPSG  119

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DL Q+E
Sbjct  120  TMSNLIAVMVHCRERGDEMIVGDLSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDLKQLE  179

Query  581  AAIRDPRFEICFPTTRLICL  640
            A IR    +  +P +RLIC+
Sbjct  180  AKIRHGYPDPHYPRSRLICV  199



>ref|WP_036683028.1| threonine aldolase [Pelobacter seleniigenes]
Length=350

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 99/138 (72%), Gaps = 3/138 (2%)
 Frame = +2

Query  227  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  406
            T+DLRSDTVT+P+ AMR AMA A V DDV G DPT  +L+   A++ G+EA L V SGT 
Sbjct  8    TIDLRSDTVTQPSAAMRQAMAEAAVGDDVYGEDPTVNQLQQRAAELFGQEAALLVTSGTQ  67

Query  407  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  586
            GNL+++LTH P RGSE+ILGD SHI +YE GGI+ +GG+ P TI    DGT+ LD IEAA
Sbjct  68   GNLVAMLTHAP-RGSEVILGDKSHIFLYEQGGIAALGGIMPHTITVQQDGTLRLDDIEAA  126

Query  587  IRDPRFEICFPTTRLICL  640
            +R     + FP TR+I L
Sbjct  127  VRGD--NVHFPRTRVIAL  142



>ref|XP_005749741.1| PREDICTED: uncharacterized protein R102.4-like [Pundamilia nyererei]
Length=428

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 98/144 (68%), Gaps = 0/144 (0%)
 Frame = +2

Query  209  RKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLF  388
            R    R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A + G EA LF
Sbjct  54   RAAHVRVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFGMEAALF  113

Query  389  VPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  568
            VPSGTM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT +L
Sbjct  114  VPSGTMSNLIAVMVHCRERGDEVIVGDLSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFEL  173

Query  569  DQIEAAIRDPRFEICFPTTRLICL  640
            +Q+E+ IR    +  +P +RL+C+
Sbjct  174  EQLESKIRHGYPDPHYPRSRLVCV  197



>ref|XP_002069264.1| GK21059 [Drosophila willistoni]
 gb|EDW80250.1| GK21059 [Drosophila willistoni]
Length=379

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 94/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M TR VDLRSDT+T+PTE MRA M+SA V DDV G DPT   LE++IA + GKEAGLFV 
Sbjct  1    MSTRIVDLRSDTLTQPTEEMRARMSSAVVGDDVYGEDPTVNELESKIASMFGKEAGLFVA  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL++++ HCP RGSEII+GD SH+ +YE GG + + GV   TIKN  DGT  L +
Sbjct  61   SGTMGNLLAIMVHCPSRGSEIIIGDQSHVFLYEQGGPAQLAGVQVATIKNEIDGTFSLAE  120

Query  575  IEAAIR  592
            ++  IR
Sbjct  121  LQRKIR  126



>ref|XP_003441921.1| PREDICTED: uncharacterized protein R102.4-like [Oreochromis niloticus]
Length=428

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             R VDLRSDTVTKP  AMR AMA A+V DDV+G DPT   L+   A + G EA LFVPSG
Sbjct  58   VRVVDLRSDTVTKPGPAMRQAMAEAKVGDDVMGEDPTVNELQKIAADMFGMEAALFVPSG  117

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    DGT DL+Q+E
Sbjct  118  TMSNLIAVMVHCRERGDEVIVGDSSHLHIYEQGGSAQLAGVHSTTVTTLPDGTFDLEQLE  177

Query  581  AAIRDPRFEICFPTTRLICL  640
            + IR    +  +P +RL+C+
Sbjct  178  SKIRHGYPDPHYPRSRLVCV  197



>ref|WP_037564212.1| threonine aldolase [Spirochaeta sp. JC202]
 gb|KGM38782.1| threonine aldolase [Spirochaeta sp. JC202]
Length=345

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 97/139 (70%), Gaps = 3/139 (2%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            R VDLRSDT+T+PT AM  AMA A+V DDV G DPT  +LE   A  +GKEA L+V SGT
Sbjct  2    RIVDLRSDTMTRPTPAMSKAMAEADVGDDVFGEDPTVNKLEEMAAARLGKEAALYVASGT  61

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNL+S+L HC  RG EIILG  SH   +E GG + +GG+HPRTI N  DGT+ L +IEA
Sbjct  62   MGNLVSLLAHCG-RGEEIILGSLSHTFFFEQGGSAAVGGIHPRTIPNQPDGTLPLPEIEA  120

Query  584  AIRDPRFEICFPTTRLICL  640
            AIR     + FP TRLI L
Sbjct  121  AIRAD--NVHFPQTRLIVL  137



>ref|XP_008312508.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Cynoglossus 
semilaevis]
Length=434

 Score =   158 bits (399),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            R VDLRSDTVTKP  AMR A+A AEV DDV+G DPT   L+   A + G EA LFVP+GT
Sbjct  65   RVVDLRSDTVTKPGAAMRQAIAEAEVGDDVMGEDPTVNELQRIAADMFGMEAALFVPTGT  124

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            M NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T     DGT DL+Q+E+
Sbjct  125  MSNLIAVMVHCRERGDEMIVGDLSHLHIYEQGGSAQLAGVHATTATTRPDGTFDLEQLES  184

Query  584  AIRDPRFEICFPTTRLICL  640
             IR    +  +P +RLIC+
Sbjct  185  KIRHGYPDPHYPRSRLICV  203



>ref|XP_010747733.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Larimichthys 
crocea]
Length=433

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 96/140 (69%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             R VDLRSDTVTKP  AMR AMA AEV DDV+G DPT   L+   A +   EA LFVP+G
Sbjct  63   ARVVDLRSDTVTKPGPAMRQAMAEAEVGDDVMGEDPTVNELQKIAADMFQMEAALFVPTG  122

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NLI+V+ HC  RG E+I+GD SH+HIYE GG + + GVH  T+    +GT DL+Q+E
Sbjct  123  TMSNLIAVMVHCRERGDEMIVGDLSHLHIYEQGGSAQLAGVHATTVTTLPNGTFDLEQLE  182

Query  581  AAIRDPRFEICFPTTRLICL  640
            + IR    +  +P TRLIC+
Sbjct  183  SKIRHGYPDPHYPRTRLICV  202



>ref|XP_003385045.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Amphimedon 
queenslandica]
Length=366

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
            TR VD+RSDTVT PTE MRAAMA A V DDV G DPTA  L+ ++A ++GKEAGLF+P+G
Sbjct  4    TRVVDMRSDTVTTPTEPMRAAMAGAAVGDDVYGEDPTAIALQGKMASLLGKEAGLFLPTG  63

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NL +++ H   RG E+ILGD SHI I+E G I+++GG+ PR ++NN DGT+DLD++ 
Sbjct  64   TMSNLAALMCHANGRGEEVILGDRSHISIWEQGAIASLGGIFPRQVRNNPDGTLDLDELV  123

Query  581  AAI  589
            + I
Sbjct  124  SKI  126



>ref|WP_019902461.1| hypothetical protein [Chloroflexi bacterium SCGC AB-629-P13]
Length=344

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 7/141 (5%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            + +DLRSDTVT PT +MR+AMA+AE+ DD  G DPT   L+  +A +MGKE+ LFVPSGT
Sbjct  2    KEIDLRSDTVTHPTNSMRSAMANAELGDDGHGDDPTVNHLQERVADMMGKESALFVPSGT  61

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            M NL+++L+HC  RG EII+GD+SH+++YE GG S++GG+  R ++ + DGT+D  +IE 
Sbjct  62   MANLVAILSHCE-RGDEIIVGDWSHVYLYEYGGASSLGGLIYRQVETSRDGTLDPGKIED  120

Query  584  AIR--DPRFEICFPTTRLICL  640
            AIR   PR    FP T L+CL
Sbjct  121  AIRPSSPR----FPKTSLVCL  137



>ref|WP_018052780.1| hypothetical protein [Marinimicrobia bacterium SCGC AB-629-J13]
Length=342

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 96/139 (69%), Gaps = 3/139 (2%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            + +DLRSDTVT P+  M  A+ SAE+ DDV   DPT   L+ +  +I GKEAGL VPSGT
Sbjct  2    KLIDLRSDTVTLPSPEMYEAIVSAELGDDVFAEDPTVNALQEKATEITGKEAGLLVPSGT  61

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            MGNL+S+LTHC  RG+E ILGD SH  +YE GGIS  GG+H R +KN+ DGTM+L  I  
Sbjct  62   MGNLVSILTHCK-RGTEAILGDQSHTFLYECGGISAYGGIHSRQLKNHPDGTMELSDIRK  120

Query  584  AIRDPRFEICFPTTRLICL  640
            A+R    +  FP T LICL
Sbjct  121  AVRS--HDDHFPVTSLICL  137



>ref|XP_005794827.1| PREDICTED: uncharacterized protein R102.4-like [Xiphophorus maculatus]
Length=475

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
             R VDLRSDTVTKP  AMR AMA AEV DDV G DPT   L+   A++ G EA LFVPSG
Sbjct  108  VRVVDLRSDTVTKPGPAMRQAMAQAEVGDDVKGEDPTVNELQKLAAEMFGMEASLFVPSG  167

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NLI+V+ HC  RG E+I+GD SH+H+ E GG + + GVH  T+    DGT DL Q+E
Sbjct  168  TMSNLIAVMVHCRERGDEMIVGDLSHLHLCEQGGSAQLAGVHAPTVTTRPDGTFDLKQLE  227

Query  581  AAIRDPRFEICFPTTRLICL  640
            + I+    +  +P TRLIC+
Sbjct  228  SKIQHGYPDSHYPHTRLICV  247



>ref|XP_001419158.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97451.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=368

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            VD RSDTVTKPT  MR AMA AEV DDVLG D T + LE ++A++ G EA +F PSGTM 
Sbjct  8    VDARSDTVTKPTARMREAMARAEVGDDVLGDDRTVKALERKMAEMFGFEAAVFTPSGTMA  67

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++ T C  RGSE I+GD SH+H+YE GG+S++ GVH RT+KN +DGT+ L+ I AAI
Sbjct  68   NLLAIATWCDERGSEAIIGDKSHVHLYEQGGMSSLMGVHSRTLKNREDGTLALEDIRAAI  127

Query  590  RDPRFEICFPTTRLICL  640
            R    +  FP T+++ L
Sbjct  128  RTVSDD-HFPVTKVVTL  143



>ref|XP_006814697.1| PREDICTED: uncharacterized protein R102.4-like [Saccoglossus 
kowalevskii]
Length=416

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 98/137 (72%), Gaps = 1/137 (1%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            VDLR+DT+T+P   MR AM +A++ DDVL  DPT + LE   A ++GKEAGL+V SGTMG
Sbjct  53   VDLRTDTLTEPDSEMRNAMVNAKIGDDVLDEDPTVKELERTAAAMLGKEAGLYVLSGTMG  112

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+SV+ HC  RG E++LGD SHI I+E GG + +GG+HPR + N  DGT DL ++E  I
Sbjct  113  NLLSVMCHCNHRGEEMLLGDQSHIFIHEQGGAAFLGGIHPRPVTNLPDGTFDLQELEEKI  172

Query  590  RDPRFEICFPTTRLICL  640
            R P  +   P T+LICL
Sbjct  173  R-PDGDFHAPKTKLICL  188



>ref|XP_001625551.1| predicted protein [Nematostella vectensis]
 gb|EDO33451.1| predicted protein [Nematostella vectensis]
Length=353

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 96/135 (71%), Gaps = 1/135 (1%)
 Frame = +2

Query  236  LRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNL  415
            +RSDTVT+PT+ MR  MA+AEV DDV G DPT   L+ + AK+M KE  +FVPSG+MGNL
Sbjct  1    MRSDTVTQPTQEMRQFMAAAEVGDDVFGDDPTVNSLQEKAAKLMRKETAIFVPSGSMGNL  60

Query  416  ISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAIRD  595
            IS++ HCP RG E+I GD SHI  +E G  S  GGVH R ++ N DGT+DLD+I++ I D
Sbjct  61   ISMMAHCPHRGDELIAGDMSHIVQWEQGSASQFGGVHSRQVRTNPDGTLDLDEIKSKIHD  120

Query  596  PRFEICFPTTRLICL  640
               +  +  T++ICL
Sbjct  121  GS-DSHYTHTKVICL  134



>ref|WP_013218741.1| threonine aldolase [Dehalogenimonas lykanthroporepellens]
 gb|ADJ26605.1| Threonine aldolase [Dehalogenimonas lykanthroporepellens BL-DC-9]
Length=340

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 96/137 (70%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDT+T PT  MR AM  AEV DDV G DPT  RLEA  A++ GKEAGL+ PSGTM 
Sbjct  4    IDLRSDTITHPTPEMRRAMFEAEVGDDVFGEDPTVNRLEALSAEMTGKEAGLYTPSGTMS  63

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NLI+VL H   RG EIILGD SHI + E GG +  GG+  RT+ N DDGT++LD IE A+
Sbjct  64   NLIAVLAHTR-RGDEIILGDRSHIFLNEAGGAAVFGGLSLRTVPNADDGTIELDVIEQAV  122

Query  590  RDPRFEICFPTTRLICL  640
            RD    I FP + L+CL
Sbjct  123  RDD--NIHFPPSTLLCL  137



>ref|WP_004713360.1| threonine aldolase [Yersinia rohdei]
 gb|EEQ04671.1| L-allo-threonine aldolase [Yersinia rohdei ATCC 43380]
 gb|AJJ11649.1| low specificity L-threonine aldolase [Yersinia rohdei]
Length=339

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEAE AK+ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPNAAMRQAMANAEVGDDVYGDDPTVNALEAEAAKLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVAAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|XP_002777074.1| L-allo-threonine aldolase, putative [Perkinsus marinus ATCC 50983]
 gb|EER08890.1| L-allo-threonine aldolase, putative [Perkinsus marinus ATCC 50983]
Length=375

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 94/140 (67%), Gaps = 2/140 (1%)
 Frame = +2

Query  221  TRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSG  400
            T  V+LRSDT T+PT  MR AMA AE  DDV G DPT    + E A+  G +  L++P+ 
Sbjct  4    THIVELRSDTFTQPTSEMRRAMAEAECGDDVWGLDPTVNAFQKEAAEKFGFKTALYLPTA  63

Query  401  TMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIE  580
            TM NL+++L HC  +GSEIILGD +H+HIYE GG STI G H RT+ N  DGT+ L+ +E
Sbjct  64   TMSNLVAMLVHCEKKGSEIILGDKAHMHIYEQGGYSTIAGAHCRTVPNQPDGTLRLEDVE  123

Query  581  AAIRDPRFEICFPTTRLICL  640
             AIR   FE  +P TR +C+
Sbjct  124  FAIRP--FEPHYPITRAVCV  141



>emb|CBN78642.1| Threonine aldolase [Ectocarpus siliculosus]
Length=1025

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 101/154 (66%), Gaps = 7/154 (5%)
 Frame = +2

Query  179  SSQFHLWFSRRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIA  358
            S +  LW  R      T+DLRSDTVT+PT  MR AM  AEV DDVLG DPT QRLEAE A
Sbjct  176  SERRGLWPGRP-----TIDLRSDTVTQPTGGMRKAMQKAEVGDDVLGEDPTVQRLEAETA  230

Query  359  KIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTI  538
            +++GKEA LFVPSGTM NLI  L  C  RGSE+I+GD SH  ++E    +  GG+  R +
Sbjct  231  ELLGKEAALFVPSGTMANLICHLIWCSNRGSEMIVGDQSHSFLWEQANAAQFGGIGYRPL  290

Query  539  KNNDDGTMDLDQIEAAIRDPRFEICFPTTRLICL  640
             N  DGTMDL  +EAA+R      CFP +RL+ +
Sbjct  291  TNLPDGTMDLRAVEAAVRG--NNPCFPVSRLVTV  322



>emb|CEG01512.1| Aromatic amino acid beta-eliminating lyase/threonine aldolase 
[Ostreococcus tauri]
Length=372

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 97/137 (71%), Gaps = 1/137 (1%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            VD RSDTVTKPT  MR AMA A V DDVLG D T + LE  +AK  G E+ ++ PSGTM 
Sbjct  10   VDARSDTVTKPTANMRRAMADAVVGDDVLGDDATVKALERAMAKRFGFESAVYTPSGTMA  69

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL++V THC  RGSE I GD SH+H+YE GG+S++ GVH RT+ N DDGT+ ++ I+ AI
Sbjct  70   NLLAVATHCDERGSECICGDKSHVHLYEQGGMSSLMGVHSRTLANRDDGTIAIEDIKGAI  129

Query  590  RDPRFEICFPTTRLICL  640
            R    +  FP T+++CL
Sbjct  130  R-AVGDDHFPVTKVVCL  145



>ref|XP_010795211.1| PREDICTED: probable low-specificity L-threonine aldolase 2 [Notothenia 
coriiceps]
Length=431

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = +2

Query  224  RTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGT  403
            R VDLRSDTVTKP  AMR AMA AEV DDV+  DP    L+   A++   EA LFVP+GT
Sbjct  62   RVVDLRSDTVTKPGPAMRQAMAVAEVGDDVMREDPCVNELQEIAAEMFQMEAALFVPTGT  121

Query  404  MGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEA  583
            M NLI+V+ HC  RG E+I+G+ SH+HIYE GG + + GVH  T+ N  DG+ DL+Q+E+
Sbjct  122  MSNLIAVMVHCRERGDEMIVGNLSHLHIYEQGGSAQLAGVHATTVDNLPDGSFDLEQLES  181

Query  584  AIRDPRFEICFPTTRLICL  640
             IR    +  +P +RLIC+
Sbjct  182  KIRHGYPDPHYPRSRLICV  200



>ref|XP_003080829.1| L-allo-threonine aldolase, putative (ISS) [Ostreococcus tauri]
Length=412

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 97/137 (71%), Gaps = 1/137 (1%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            VD RSDTVTKPT  MR AMA A V DDVLG D T + LE  +AK  G E+ ++ PSGTM 
Sbjct  50   VDARSDTVTKPTANMRRAMADAVVGDDVLGDDATVKALERAMAKRFGFESAVYTPSGTMA  109

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL++V THC  RGSE I GD SH+H+YE GG+S++ GVH RT+ N DDGT+ ++ I+ AI
Sbjct  110  NLLAVATHCDERGSECICGDKSHVHLYEQGGMSSLMGVHSRTLANRDDGTIAIEDIKGAI  169

Query  590  RDPRFEICFPTTRLICL  640
            R    +  FP T+++CL
Sbjct  170  R-AVGDDHFPVTKVVCL  185



>emb|CCO67312.1| Low-specificity L-threonine aldolase [Yersinia enterocolitica 
IP 10393]
 emb|CCV62190.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:2) 
str. YE3094/96]
Length=351

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 103/147 (70%), Gaps = 4/147 (3%)
 Frame = +2

Query  200  FSRRKMVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEA  379
            FS R+ V   +DLRSDTVT+P  AMR+AM +AEV DDV G DPT   LEA+ AK+ GKEA
Sbjct  6    FSSREKVM-LIDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEA  64

Query  380  GLFVPSGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGT  559
             LF+P+GT  NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT
Sbjct  65   ALFLPTGTQANLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGT  123

Query  560  MDLDQIEAAIRDPRFEICFPTTRLICL  640
            + LD++ AAI+    +I F  TRL+ L
Sbjct  124  LPLDKVLAAIKPD--DIHFAQTRLLSL  148



>ref|XP_001989934.1| GH19068 [Drosophila grimshawi]
 gb|EDV92996.1| GH19068 [Drosophila grimshawi]
Length=379

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M    VDLRSDTVT+PT  MR  MA+A V DDV G DPT   LE++ A I GKEAGLFVP
Sbjct  1    MSNNIVDLRSDTVTQPTPEMRQRMATAVVGDDVFGEDPTIAELESKTAAIFGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL++++ HC  RGSE I+GD SH  +YE GG S I GV   TI+N  DGT  L +
Sbjct  61   SGTMGNLLAIMVHCNRRGSEAIVGDLSHTFLYEQGGASFIAGVQLATIRNQPDGTFSLAE  120

Query  575  IEAAIRDPRFEICF-PTTRLICL  640
            +   IR  ++E C  P T LI +
Sbjct  121  LRQKIR--QYEDCHEPVTSLIVV  141



>ref|XP_006841676.1| hypothetical protein AMTR_s00003p00244760 [Amborella trichopoda]
 gb|ERN03351.1| hypothetical protein AMTR_s00003p00244760 [Amborella trichopoda]
Length=106

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/95 (71%), Positives = 79/95 (83%), Gaps = 0/95 (0%)
 Frame = +2

Query  284  MASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMGNLISVLTHCPIRGSEIIL  463
            MA+AEVDDDVLGF+PT Q+LE  +A+IMGKEA LFVPSGTM NLISV+ HC IRGSE+IL
Sbjct  1    MANAEVDDDVLGFNPTTQKLETGMARIMGKEAALFVPSGTMTNLISVMVHCEIRGSEVIL  60

Query  464  GDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDL  568
            GD SH H+ +NGGISTIG  H  T+ +N DGTMD+
Sbjct  61   GDQSHTHLLDNGGISTIGCAHSITVPSNLDGTMDI  95



>ref|XP_001982124.1| GG12420 [Drosophila erecta]
 gb|EDV53994.1| GG12420 [Drosophila erecta]
Length=384

 Score =   149 bits (377),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 88/122 (72%), Gaps = 0/122 (0%)
 Frame = +2

Query  227  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  406
            TVDLRSDTV++PT+ MRA MA+A V DDV G DPT   LEA  A I GKEAGLFVPSGTM
Sbjct  7    TVDLRSDTVSQPTDKMRARMATAVVGDDVYGEDPTVNELEARTAAIFGKEAGLFVPSGTM  66

Query  407  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  586
            GNL++++ HC  RG+E ++GD SHI +YE GG S + GV   T+KN  DGT  L ++   
Sbjct  67   GNLLAIMVHCHRRGTEALVGDLSHIFLYEQGGASHLAGVQLATLKNEQDGTFSLQELRRR  126

Query  587  IR  592
            IR
Sbjct  127  IR  128



>emb|CBX71679.1| hypothetical protein YEW_FV24480 [Yersinia enterocolitica W22703]
Length=124

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR+AM +AEV DDV G DPT   LEA+ AK+ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  R  592
            +
Sbjct  122  K  122



>ref|XP_002001285.1| GI10703 [Drosophila mojavensis]
 gb|EDW16746.1| GI10703 [Drosophila mojavensis]
Length=383

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 96/138 (70%), Gaps = 3/138 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            VDLRSDTV++PT  MRA MASA V DDV G DPT   LEA+ A I GKEAGLFVPSGTMG
Sbjct  10   VDLRSDTVSQPTPEMRARMASAVVGDDVYGEDPTLAELEAKTAAIFGKEAGLFVPSGTMG  69

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL++V+ HC  RGSE I+GD SHI +YE GG + + GV    ++N  DGT  L+++   I
Sbjct  70   NLLAVMVHCSRRGSEAIVGDLSHIFLYEQGGSAHLAGVQLAQLRNLPDGTFSLEELRHKI  129

Query  590  RDPRFEICF-PTTRLICL  640
            R  ++E C  P T L+ +
Sbjct  130  R--QYEDCHEPVTSLVVV  145



>ref|WP_004873721.1| threonine aldolase [Yersinia mollaretii]
 gb|EEQ12086.1| L-allo-threonine aldolase [Yersinia mollaretii ATCC 43969]
Length=339

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEAE A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDTAMRNAMANAEVGDDVYGDDPTVNALEAEAARLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|WP_032898062.1| threonine aldolase [Yersinia bercovieri]
Length=339

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 97/137 (71%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR AM +AEV DDV G DPT   LEAE A++ GKEA LF+PSGT  
Sbjct  3    IDLRSDTVTQPDAAMRNAMVNAEVGDDVYGDDPTVNALEAEAARVSGKEAALFLPSGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|WP_042663615.1| threonine aldolase [Yersinia enterocolitica]
 gb|AJJ26706.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR+AM +AEV DDV G DPT   LEA+ AK+ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYETGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|WP_019079898.1| threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA+ A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRQAMANAEVGDDVYGDDPTVNALEAQAARLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|WP_019083465.1| threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA+ A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRQAMANAEVGDDVYGDDPTVNALEAQAARLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|WP_023160779.1| L-allo-threonine aldolase [Yersinia enterocolitica]
 emb|CCV46805.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:5,27) 
str. YE149/02]
Length=339

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR+AM +AEV DDV G DPT   LEA+ AK+ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|WP_005171133.1| threonine aldolase [Yersinia enterocolitica]
 gb|EKA27233.1| L-threonine aldolase [Yersinia enterocolitica subsp. enterocolitica 
WA-314]
 gb|KGA70404.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
 gb|KGA76475.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
 gb|AJI81980.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA+ A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRQAMANAEVGDDVYGDDPTVNALEAQAARLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|WP_011816022.1| threonine aldolase [Yersinia enterocolitica]
 ref|YP_001005802.1| L-threonine aldolase [Yersinia enterocolitica subsp. enterocolitica 
8081]
 emb|CAL11585.1| L-allo-threonine aldolase [Yersinia enterocolitica subsp. enterocolitica 
8081]
 gb|AJJ25309.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA+ A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRQAMANAEVGDDVYGDDPTVSALEAQAARLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|WP_005162818.1| threonine aldolase [Yersinia enterocolitica]
 emb|CBY27800.1| low-specificity L-threonine aldolase [Yersinia enterocolitica 
subsp. palearctica Y11]
 gb|ADZ43113.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
105.5R(r)]
 gb|EHB20617.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
PhRBD_Ye1]
 emb|CCV37830.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:9) 
str. YE56/03]
 gb|EOR69656.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
YE-149]
 gb|EOR80767.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
YE-P1]
 gb|EOR81361.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
YE-150]
 gb|EOR83594.1| L-threonine aldolase [Yersinia enterocolitica subsp. palearctica 
YE-P4]
 emb|CCV29351.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:9) 
str. YE212/02]
 gb|KGA62622.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
 gb|KGA67760.1| low specificity L-threonine aldolase [Yersinia enterocolitica]
Length=339

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR+AM +AEV DDV G DPT   LEA+ AK+ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>emb|CCQ40051.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:5) 
str. YE53/03]
Length=339

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR AMA+AEV DDV G DPT   LEA+ A++ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRQAMANAEVGDDVYGDDPTVNALEAQAARLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|WP_025383281.1| threonine aldolase [Yersinia similis]
 gb|AHK20627.1| threonine aldolase [Yersinia similis]
Length=339

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMRAAMA+AEV DDV G DPT   LEA+ A + GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPCVAMRAAMANAEVGDDVYGDDPTVNALEAKAASLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLSLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAPTRLLSL  136



>ref|WP_023161056.1| L-allo-threonine aldolase [Yersinia enterocolitica]
 emb|CCV54034.1| L-allo-threonine aldolase [Yersinia enterocolitica (type O:3) 
str. YE12/03]
Length=339

 Score =   147 bits (372),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 98/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMR+AM +AEV DDV G DPT   LEA+ AK+ GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPDAAMRSAMTNAEVGDDVYGDDPTVNALEAQAAKLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD++ AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDKVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAQTRLLSL  136



>ref|WP_023377740.1| Low-specificity L-threonine aldolase [Smithella sp. ME-1]
 gb|ESP63005.1| Low-specificity L-threonine aldolase [Smithella sp. ME-1]
Length=344

 Score =   147 bits (372),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 96/137 (70%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+PT+ MR AMA A+V DDV G DPT   LE   A  MGKEAGLF+PSGTMG
Sbjct  2    IDLRSDTVTQPTDEMRHAMALADVGDDVYGEDPTINYLEELSADRMGKEAGLFIPSGTMG  61

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NLI+ LTHC  RG E I+GD +H   YE GG+S +GG+   T+ N  DGT+ +  ++ AI
Sbjct  62   NLIAFLTHCQ-RGEEAIMGDQAHTFYYEVGGVSALGGIMVHTVPNQADGTIRISDLKNAI  120

Query  590  RDPRFEICFPTTRLICL  640
            R    ++ FPTTRLI L
Sbjct  121  RIE--DVHFPTTRLIAL  135



>ref|NP_651161.1| CG10184 [Drosophila melanogaster]
 gb|AAF56152.1| CG10184 [Drosophila melanogaster]
 gb|AAK93261.1| LD34157p [Drosophila melanogaster]
 gb|ACL85591.1| CG10184-PA, partial [synthetic construct]
 gb|ACL90455.1| CG10184-PA [synthetic construct]
Length=383

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 93/138 (67%), Gaps = 4/138 (3%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            VDLRSDTV++PT+ MRA MA+A V DDV G DPT   LEA  A I GKEAGLFVPSGTMG
Sbjct  7    VDLRSDTVSQPTDKMRARMATAVVGDDVYGEDPTVNELEARTAAIFGKEAGLFVPSGTMG  66

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL++++ HC  RG+E ++GD SHI +YE GG S + GV   T+KN  DGT  L  +    
Sbjct  67   NLLAIMVHCHRRGTEALVGDLSHIFLYEQGGASHLAGVQLATLKNEQDGTFSLQDLR---  123

Query  590  RDPRFEICF-PTTRLICL  640
            R  R E C  P T L+ +
Sbjct  124  RRIRHEDCHEPITSLVVV  141



>ref|WP_038404710.1| threonine aldolase, partial [Pseudomonas aeruginosa]
Length=162

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 93/137 (68%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+PT  MR AMA+AE+ DDV G DPT  RLEAE+A  +G  A LFVP+GTM 
Sbjct  4    IDLRSDTVTQPTAGMREAMAAAELGDDVYGEDPTVNRLEAELAARLGFAAALFVPTGTMS  63

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+ ++ HC  RG E I+G  +H + YE GG + +G + P+ I    DG++DLD++ AAI
Sbjct  64   NLLGLMAHCE-RGDEYIVGQQAHTYKYEGGGAAVLGSIQPQPIDGEADGSLDLDKVAAAI  122

Query  590  RDPRFEICFPTTRLICL  640
            +   F   F  TRL+ L
Sbjct  123  KADDFH--FARTRLLAL  137



>ref|XP_002053845.1| GJ23119 [Drosophila virilis]
 gb|EDW67365.1| GJ23119 [Drosophila virilis]
Length=379

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M    VDLRSDTV+ PT  MR  MA+A V DDV G DPT   L+ + A I GKEAGLFVP
Sbjct  1    MSVNIVDLRSDTVSLPTPEMRERMAAAVVGDDVYGEDPTVAELQEKTAAIFGKEAGLFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL++V+ HC  RGSE I+GD SHI +YE GG + + GV   TI+N  DGT  L++
Sbjct  61   SGTMGNLLAVMVHCNRRGSEAIVGDLSHIFLYEQGGAAHLAGVQLATIRNQQDGTFSLEE  120

Query  575  IEAAIRDPRFEICF-PTTRLICL  640
            +   IR  ++E C  P T L+ +
Sbjct  121  LRHKIR--QYEDCHEPVTSLVVV  141



>ref|XP_002104572.1| GD18368 [Drosophila simulans]
 gb|EDX14075.1| GD18368 [Drosophila simulans]
Length=383

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 93/139 (67%), Gaps = 4/139 (3%)
 Frame = +2

Query  227  TVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTM  406
             VDLRSDTV++PT+ MRA MA+A V DDV G DPT   LEA  A I GKEAGLFVPSGTM
Sbjct  6    VVDLRSDTVSQPTDKMRARMAAAVVGDDVYGEDPTVNELEARTAAIFGKEAGLFVPSGTM  65

Query  407  GNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAA  586
            GNL++++ HC  RG+E ++GD SHI +YE GG S + GV   T+KN  DGT  L  +   
Sbjct  66   GNLLAIMVHCHRRGTEALVGDLSHIFLYEQGGASHLAGVQLATLKNEQDGTFSLQDLR--  123

Query  587  IRDPRFEICF-PTTRLICL  640
             R  R E C  P T L+ +
Sbjct  124  -RRIRHEDCHEPITSLVVV  141



>ref|WP_033853305.1| threonine aldolase [Yersinia sp. WP-931205]
Length=339

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 97/137 (71%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMRAAMA+AEV DDV G DPT   LEA+ A + GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPCTAMRAAMANAEVGDDVYGDDPTVNALEAKAASLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD + AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDNVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAPTRLLSL  136



>ref|WP_012119285.1| threonine aldolase [Roseiflexus castenholzii]
 gb|ABU56855.1| Threonine aldolase [Roseiflexus castenholzii DSM 13941]
Length=359

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 98/145 (68%), Gaps = 8/145 (6%)
 Frame = +2

Query  215  MVTRTVDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVP  394
            M ++ +DLRSDTVT PT AMR AMA AEV DDV G DPT  RLE   A+ +GK A +FVP
Sbjct  1    MPSKPIDLRSDTVTLPTPAMRTAMARAEVGDDVYGEDPTINRLEEFAAQRVGKAAAMFVP  60

Query  395  SGTMGNLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQ  574
            SGTMGNL ++L HC  RG E+I+GD SHI+ YE GG S +GGV    + N  DGT+ LD 
Sbjct  61   SGTMGNLCALLAHCQ-RGDEVIVGDASHIYNYEAGGASVVGGVAFHVLPNQPDGTIALDH  119

Query  575  IEAAIR---DPRFEICFPTTRLICL  640
            + AA+R   DP    C   TRLICL
Sbjct  120  LRAAVRWLDDPH---C-AETRLICL  140



>ref|XP_002032362.1| GM23553 [Drosophila sechellia]
 gb|EDW43348.1| GM23553 [Drosophila sechellia]
Length=383

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 93/138 (67%), Gaps = 4/138 (3%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            VDLRSDTV++PT+ MRA MA+A V DDV G DPT   LEA  A I GKEAGLFVPSGTMG
Sbjct  7    VDLRSDTVSQPTDKMRARMAAAVVGDDVYGEDPTVNELEARTAAIFGKEAGLFVPSGTMG  66

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL++++ HC  RG+E ++GD SHI +YE GG S + GV   T+KN  DGT  L  +    
Sbjct  67   NLLAIMVHCHRRGTEALVGDLSHIFLYEQGGASHLAGVQLATLKNEQDGTFSLQDLR---  123

Query  590  RDPRFEICF-PTTRLICL  640
            R  R E C  P T L+ +
Sbjct  124  RRIRHEDCHEPITSLVVV  141



>ref|WP_015671727.1| threonine aldolase [Serratia marcescens]
 gb|AGB81881.1| threonine aldolase [Serratia marcescens FGI94]
Length=339

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 99/137 (72%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+PT AMR AMASAEV DDV G DPT   L+ E A++ GKEA LF+PSGT  
Sbjct  3    IDLRSDTVTQPTAAMRQAMASAEVGDDVYGDDPTVNALQNEAARLAGKEAALFLPSGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++L+HC  RG E ++G  +H + YE GG + +GG+ P+ I+ +DDGT+ LD++ AAI
Sbjct  63   NLVALLSHCQ-RGDEYLVGQQAHNYKYEAGGAAVLGGIQPQPIEADDDGTLPLDKVAAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  +RL+ L
Sbjct  122  KPD--DIHFARSRLLSL  136



>ref|WP_042819367.1| threonine aldolase [Yersinia sp. WP-930601]
Length=339

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 97/137 (71%), Gaps = 3/137 (2%)
 Frame = +2

Query  230  VDLRSDTVTKPTEAMRAAMASAEVDDDVLGFDPTAQRLEAEIAKIMGKEAGLFVPSGTMG  409
            +DLRSDTVT+P  AMRAAMA+AEV DDV G DPT   LEA+ A + GKEA LF+P+GT  
Sbjct  3    IDLRSDTVTQPCTAMRAAMANAEVGDDVYGDDPTVNALEAKAASLSGKEAALFLPTGTQA  62

Query  410  NLISVLTHCPIRGSEIILGDYSHIHIYENGGISTIGGVHPRTIKNNDDGTMDLDQIEAAI  589
            NL+++LTHC  RG E I+G  +H ++YE GG + +G + P+ I  NDDGT+ LD + AAI
Sbjct  63   NLVALLTHCQ-RGEEYIVGQKAHNYLYEAGGAAVLGSIQPQPIDANDDGTLPLDNVLAAI  121

Query  590  RDPRFEICFPTTRLICL  640
            +    +I F  TRL+ L
Sbjct  122  KPD--DIHFAPTRLLSL  136



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750