BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF042F17

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAF19001.1|AF212157_1  S-adenosylhomocysteine hydrolase              320   2e-106   Allium cepa
gb|AFK08605.1|  S-adenosyl homocysteine hydrolase                       326   4e-106   Nicotiana benthamiana
gb|AAV31754.1|  S-adenosyl-L-homocysteine hydrolase                     325   4e-106   Nicotiana tabacum [American tobacco]
ref|NP_001289538.1|  adenosylhomocysteinase                             324   1e-105   Nicotiana sylvestris
gb|AFU51537.1|  S-adenosyl-homocysteine hydrolase protein               323   2e-105   Capsicum annuum
ref|XP_010253338.1|  PREDICTED: adenosylhomocysteinase                  323   2e-105   Nelumbo nucifera [Indian lotus]
ref|XP_010268032.1|  PREDICTED: adenosylhomocysteinase-like             323   4e-105   Nelumbo nucifera [Indian lotus]
gb|AAP92452.1|  S-adenosyl-L-homocystein hydrolase                      322   1e-104   Petunia x hybrida [garden petunia]
ref|XP_004247887.1|  PREDICTED: adenosylhomocysteinase                  322   1e-104   Solanum lycopersicum
ref|XP_009787091.1|  PREDICTED: adenosylhomocysteinase-like             321   2e-104   Nicotiana sylvestris
gb|EYU32710.1|  hypothetical protein MIMGU_mgv1a003606mg                323   3e-104   Erythranthe guttata [common monkey flower]
ref|XP_002266154.1|  PREDICTED: adenosylhomocysteinase                  320   4e-104   Vitis vinifera
ref|XP_006360925.1|  PREDICTED: adenosylhomocysteinase-like isofo...    320   5e-104   
sp|P35007.1|SAHH_CATRO  RecName: Full=Adenosylhomocysteinase; Sho...    320   5e-104   Catharanthus roseus [chatas]
gb|EYU31514.1|  hypothetical protein MIMGU_mgv1a005403mg                320   5e-104   Erythranthe guttata [common monkey flower]
ref|XP_009606591.1|  PREDICTED: adenosylhomocysteinase-like             320   8e-104   Nicotiana tomentosiformis
gb|ABB55380.1|  S-adenosyl-L-homocysteine hydrolase-like                319   1e-103   Solanum tuberosum [potatoes]
sp|P93253.1|SAHH_MESCR  RecName: Full=Adenosylhomocysteinase; Sho...    319   1e-103   Mesembryanthemum crystallinum
dbj|BAP47515.1|  S-adenosylhomocysteine hydrolase                       319   2e-103   Gentiana triflora
ref|NP_001078387.1|  adenosylhomocysteinase 1                           313   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011102056.1|  PREDICTED: adenosylhomocysteinase                  318   2e-103   Sesamum indicum [beniseed]
emb|CDP11183.1|  unnamed protein product                                318   2e-103   Coffea canephora [robusta coffee]
ref|XP_008380474.1|  PREDICTED: adenosylhomocysteinase                  318   2e-103   Malus domestica [apple tree]
ref|XP_009373550.1|  PREDICTED: adenosylhomocysteinase                  318   3e-103   Pyrus x bretschneideri [bai li]
gb|ABQ18314.1|  S-adenosyl-L-homocysteine hydrolase                     318   4e-103   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004252985.1|  PREDICTED: adenosylhomocysteinase-like             318   5e-103   Solanum lycopersicum
ref|XP_002278000.1|  PREDICTED: adenosylhomocysteinase-like             317   6e-103   Vitis vinifera
ref|XP_010908558.1|  PREDICTED: adenosylhomocysteinase                  317   7e-103   
ref|XP_006349914.1|  PREDICTED: adenosylhomocysteinase-like             317   7e-103   Solanum tuberosum [potatoes]
emb|CDY01177.1|  BnaA04g06420D                                          317   9e-103   
gb|EYU31513.1|  hypothetical protein MIMGU_mgv1a004058mg                319   1e-102   Erythranthe guttata [common monkey flower]
ref|XP_009139575.1|  PREDICTED: adenosylhomocysteinase 1                317   1e-102   Brassica rapa
gb|AAX16000.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            317   1e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15998.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            317   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193130.1|  adenosylhomocysteinase 1                              317   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283635.1|  hypothetical protein CARUB_v10004693mg             317   1e-102   Capsella rubella
ref|XP_010052042.1|  PREDICTED: adenosylhomocysteinase 1                317   1e-102   Eucalyptus grandis [rose gum]
gb|AAP92454.1|  S-adenosyl-L-homocystein hydrolase                      316   1e-102   Brassica oleracea var. alboglabra [Chinese broccoli]
ref|XP_002870350.1|  hypothetical protein ARALYDRAFT_915516             317   1e-102   Arabidopsis lyrata subsp. lyrata
gb|AAM62888.1|  adenosylhomocysteinase                                  317   1e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AAX15999.1|  S-adenosyl-L-homocysteine hydrolase 1 mutant            317   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002522805.1|  adenosylhomocysteinase, putative                   317   1e-102   Ricinus communis
gb|AAV31755.1|  S-adenosyl-L-homocysteine hydrolase                     316   1e-102   Nicotiana tabacum [American tobacco]
gb|KFK36278.1|  hypothetical protein AALP_AA4G101800                    317   1e-102   Arabis alpina [alpine rockcress]
ref|XP_009349913.1|  PREDICTED: adenosylhomocysteinase-like             316   2e-102   Pyrus x bretschneideri [bai li]
ref|XP_010527457.1|  PREDICTED: adenosylhomocysteinase 1                316   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_010532739.1|  PREDICTED: adenosylhomocysteinase 1                316   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_008457223.1|  PREDICTED: adenosylhomocysteinase 1                316   2e-102   Cucumis melo [Oriental melon]
ref|XP_008776857.1|  PREDICTED: adenosylhomocysteinase-like             316   2e-102   Phoenix dactylifera
sp|P50249.1|SAHH_PHASS  RecName: Full=Adenosylhomocysteinase; Sho...    316   2e-102   Phalaenopsis sp.
ref|XP_004138966.1|  PREDICTED: adenosylhomocysteinase-like             316   2e-102   
ref|XP_010097949.1|  hypothetical protein L484_026840                   316   3e-102   Morus notabilis
ref|XP_003524926.1|  PREDICTED: adenosylhomocysteinase-like             316   3e-102   
ref|XP_003531217.1|  PREDICTED: adenosylhomocysteinase-like             316   3e-102   Glycine max [soybeans]
ref|XP_009135865.1|  PREDICTED: adenosylhomocysteinase 2-like           316   3e-102   Brassica rapa
gb|AEI54335.1|  adenosylhomocysteinase                                  315   3e-102   Glycine max [soybeans]
emb|CDY47309.1|  BnaAnng08830D                                          315   3e-102   Brassica napus [oilseed rape]
gb|KCW59952.1|  hypothetical protein EUGRSUZ_H02678                     315   4e-102   Eucalyptus grandis [rose gum]
ref|XP_007034216.1|  S-adenosyl-L-homocysteine hydrolase                316   5e-102   
emb|CDX85127.1|  BnaC07g07790D                                          315   5e-102   
ref|XP_010023650.1|  PREDICTED: adenosylhomocysteinase                  315   5e-102   Eucalyptus grandis [rose gum]
emb|CDY50423.1|  BnaCnng19320D                                          315   6e-102   Brassica napus [oilseed rape]
gb|AIG62154.1|  S-adenosyl-L-homocysteine hydrolase                     315   6e-102   Populus tomentosa [Chinese white poplar]
sp|Q01781.2|SAHH_PETCR  RecName: Full=Adenosylhomocysteinase; Sho...    315   6e-102   Petroselinum crispum
gb|AIG62191.1|  S-adenosyl-L-homocysteine hydrolase                     315   7e-102   Populus tomentosa [Chinese white poplar]
gb|ABK25129.1|  unknown                                                 315   7e-102   Picea sitchensis
gb|AIG62181.1|  S-adenosyl-L-homocysteine hydrolase                     315   7e-102   Populus tomentosa [Chinese white poplar]
gb|AIG62178.1|  S-adenosyl-L-homocysteine hydrolase                     315   7e-102   Populus tomentosa [Chinese white poplar]
ref|XP_006297468.1|  hypothetical protein CARUB_v10013488mg             315   7e-102   
gb|KDO43195.1|  hypothetical protein CISIN_1g011464mg                   313   7e-102   Citrus sinensis [apfelsine]
gb|AIG62157.1|  S-adenosyl-L-homocysteine hydrolase                     315   7e-102   Populus tomentosa [Chinese white poplar]
gb|ABK24229.1|  unknown                                                 315   8e-102   Picea sitchensis
ref|XP_006414844.1|  hypothetical protein EUTSA_v10024750mg             318   8e-102   
gb|KJB37872.1|  hypothetical protein B456_006G223900                    313   8e-102   Gossypium raimondii
gb|AIG62165.1|  S-adenosyl-L-homocysteine hydrolase                     315   8e-102   Populus tomentosa [Chinese white poplar]
gb|AIG62166.1|  S-adenosyl-L-homocysteine hydrolase                     315   8e-102   Populus tomentosa [Chinese white poplar]
gb|AIG62184.1|  S-adenosyl-L-homocysteine hydrolase                     315   9e-102   Populus tomentosa [Chinese white poplar]
gb|AIG62160.1|  S-adenosyl-L-homocysteine hydrolase                     315   9e-102   Populus tomentosa [Chinese white poplar]
gb|AIG62156.1|  S-adenosyl-L-homocysteine hydrolase                     315   9e-102   Populus tomentosa [Chinese white poplar]
gb|AIG62164.1|  S-adenosyl-L-homocysteine hydrolase                     315   9e-102   Populus tomentosa [Chinese white poplar]
ref|XP_003629610.1|  Adenosylhomocysteinase                             314   1e-101   Medicago truncatula
ref|XP_011012490.1|  PREDICTED: adenosylhomocysteinase-like             314   1e-101   Populus euphratica
emb|CDY58805.1|  BnaC08g46780D                                          314   1e-101   Brassica napus [oilseed rape]
ref|XP_007153624.1|  hypothetical protein PHAVU_003G051200g             314   1e-101   Phaseolus vulgaris [French bean]
gb|KJB72028.1|  hypothetical protein B456_011G154000                    314   1e-101   Gossypium raimondii
gb|KHG17040.1|  Adenosylhomocysteinase                                  314   1e-101   Gossypium arboreum [tree cotton]
gb|KJB72024.1|  hypothetical protein B456_011G154000                    314   1e-101   Gossypium raimondii
ref|XP_009107496.1|  PREDICTED: adenosylhomocysteinase 1-like           314   1e-101   Brassica rapa
ref|XP_010551666.1|  PREDICTED: adenosylhomocysteinase 1-like           314   1e-101   Tarenaya hassleriana [spider flower]
ref|XP_011102207.1|  PREDICTED: adenosylhomocysteinase-like             314   2e-101   Sesamum indicum [beniseed]
ref|XP_010905139.1|  PREDICTED: adenosylhomocysteinase-like             314   2e-101   Elaeis guineensis
ref|XP_011083449.1|  PREDICTED: adenosylhomocysteinase-like             314   2e-101   Sesamum indicum [beniseed]
gb|KDP39327.1|  hypothetical protein JCGZ_01084                         314   2e-101   Jatropha curcas
ref|XP_008361486.1|  PREDICTED: adenosylhomocysteinase                  314   2e-101   Malus domestica [apple tree]
gb|AAL16259.1|AF428329_1  AT3g23810/MYM9_15                             313   2e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KCW59951.1|  hypothetical protein EUGRSUZ_H02678                     315   2e-101   Eucalyptus grandis [rose gum]
ref|XP_010673385.1|  PREDICTED: adenosylhomocysteinase                  313   2e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011003627.1|  PREDICTED: adenosylhomocysteinase                  313   2e-101   Populus euphratica
gb|AER92590.1|  putative S-adenosyl-L-homocysteinase                    316   2e-101   Linum usitatissimum
gb|AIG62149.1|  S-adenosyl-L-homocysteine hydrolase                     313   2e-101   Populus tomentosa [Chinese white poplar]
gb|KDO43194.1|  hypothetical protein CISIN_1g011464mg                   313   2e-101   Citrus sinensis [apfelsine]
dbj|BAH19670.1|  AT4G13940                                              308   2e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AIG62171.1|  S-adenosyl-L-homocysteine hydrolase                     313   2e-101   Populus tomentosa [Chinese white poplar]
gb|AIG62155.1|  S-adenosyl-L-homocysteine hydrolase                     313   2e-101   Populus tomentosa [Chinese white poplar]
ref|XP_006492541.1|  PREDICTED: adenosylhomocysteinase-like             313   2e-101   Citrus sinensis [apfelsine]
gb|AAP92453.1|  S-adenosyl-L-homocystein hydrolase                      313   2e-101   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28004.1|  hypothetical protein AALP_AA8G459100                    313   3e-101   Arabis alpina [alpine rockcress]
gb|AIG62188.1|  S-adenosyl-L-homocysteine hydrolase                     313   3e-101   Populus tomentosa [Chinese white poplar]
gb|AIG62158.1|  S-adenosyl-L-homocysteine hydrolase                     313   3e-101   Populus tomentosa [Chinese white poplar]
gb|AIG62173.1|  S-adenosyl-L-homocysteine hydrolase                     313   3e-101   Populus tomentosa [Chinese white poplar]
emb|CDX77483.1|  BnaA07g06210D                                          312   3e-101   
gb|AIG62187.1|  S-adenosyl-L-homocysteine hydrolase                     313   3e-101   Populus tomentosa [Chinese white poplar]
gb|AIG62150.1|  S-adenosyl-L-homocysteine hydrolase                     313   3e-101   Populus tomentosa [Chinese white poplar]
gb|AIG62169.1|  S-adenosyl-L-homocysteine hydrolase                     313   3e-101   Populus tomentosa [Chinese white poplar]
gb|AIG62148.1|  S-adenosyl-L-homocysteine hydrolase                     313   3e-101   Populus tomentosa [Chinese white poplar]
gb|AIG62179.1|  S-adenosyl-L-homocysteine hydrolase                     313   3e-101   Populus tomentosa [Chinese white poplar]
ref|XP_008222807.1|  PREDICTED: adenosylhomocysteinase isoform X1       313   3e-101   Prunus mume [ume]
gb|AIG62180.1|  S-adenosyl-L-homocysteine hydrolase                     313   3e-101   Populus tomentosa [Chinese white poplar]
gb|AGV54286.1|  adenosylhomocysteinase                                  313   3e-101   Phaseolus vulgaris [French bean]
ref|NP_001234012.1|  adenosylhomocysteinase                             313   3e-101   
ref|XP_010247578.1|  PREDICTED: adenosylhomocysteinase                  313   3e-101   Nelumbo nucifera [Indian lotus]
gb|AHA84211.1|  S-adenosyl-L-homocysteine hydrolase                     313   3e-101   Phaseolus vulgaris [French bean]
ref|XP_007222610.1|  hypothetical protein PRUPE_ppa004934mg             313   4e-101   Prunus persica
gb|AGX26683.1|  S-adenosyl-l-homocysteine hydrolase A                   313   4e-101   Populus tomentosa [Chinese white poplar]
gb|AIG62185.1|  S-adenosyl-L-homocysteine hydrolase                     313   4e-101   Populus tomentosa [Chinese white poplar]
gb|AIG62159.1|  S-adenosyl-L-homocysteine hydrolase                     313   4e-101   Populus tomentosa [Chinese white poplar]
ref|XP_006848518.1|  hypothetical protein AMTR_s00013p00261120          313   4e-101   Amborella trichopoda
gb|AIG62151.1|  S-adenosyl-L-homocysteine hydrolase                     313   4e-101   Populus tomentosa [Chinese white poplar]
gb|AIG62152.1|  S-adenosyl-L-homocysteine hydrolase                     313   4e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26651.1|  S-adenosyl-l-homocysteine hydrolase A                   313   4e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26646.1|  S-adenosyl-l-homocysteine hydrolase A                   313   4e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26663.1|  S-adenosyl-l-homocysteine hydrolase A                   313   4e-101   Populus tomentosa [Chinese white poplar]
ref|XP_008803686.1|  PREDICTED: adenosylhomocysteinase                  313   4e-101   Phoenix dactylifera
gb|AGX26674.1|  S-adenosyl-l-homocysteine hydrolase A                   313   4e-101   Populus tomentosa [Chinese white poplar]
gb|AGW81844.1|  S-(5'-adenosyl)-l-homocysteine hydrolase A              313   4e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26652.1|  S-adenosyl-l-homocysteine hydrolase A                   313   4e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26672.1|  S-adenosyl-l-homocysteine hydrolase A                   313   5e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26647.1|  S-adenosyl-l-homocysteine hydrolase A                   313   5e-101   Populus tomentosa [Chinese white poplar]
gb|AFZ78657.1|  S-adenosyl-L-homocysteine hydrolase                     313   5e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26669.1|  S-adenosyl-l-homocysteine hydrolase A                   313   5e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26650.1|  S-adenosyl-l-homocysteine hydrolase A                   313   5e-101   Populus tomentosa [Chinese white poplar]
gb|ABI95857.1|  S-adenosyl-homocysteine hydrolase                       313   5e-101   Nicotiana suaveolens
gb|AGX26684.1|  S-adenosyl-l-homocysteine hydrolase A                   313   5e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26678.1|  S-adenosyl-l-homocysteine hydrolase A                   313   5e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26666.1|  S-adenosyl-l-homocysteine hydrolase A                   313   5e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26664.1|  S-adenosyl-l-homocysteine hydrolase A                   312   5e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26655.1|  S-adenosyl-l-homocysteine hydrolase A                   312   5e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26682.1|  S-adenosyl-l-homocysteine hydrolase A                   312   5e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26661.1|  S-adenosyl-l-homocysteine hydrolase A                   312   5e-101   Populus tomentosa [Chinese white poplar]
dbj|BAE71233.1|  putative adenosylhomocysteinase                        312   5e-101   Trifolium pratense [peavine clover]
gb|AGX26685.1|  S-adenosyl-l-homocysteine hydrolase A                   312   5e-101   Populus tomentosa [Chinese white poplar]
ref|XP_006421018.1|  hypothetical protein CICLE_v10004852mg             312   6e-101   Citrus clementina [clementine]
gb|AIG62182.1|  S-adenosyl-L-homocysteine hydrolase                     312   6e-101   Populus tomentosa [Chinese white poplar]
gb|ADR30776.1|  S-adenosyl-L-homocysteine hydrolase                     312   6e-101   Cucumis sativus [cucumbers]
ref|XP_002300147.1|  adenosylhomocysteinase family protein              312   6e-101   Populus trichocarpa [western balsam poplar]
gb|AAK92718.1|  putative S-adenosyl-L-homocysteinas protein             312   6e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AIG62176.1|  S-adenosyl-L-homocysteine hydrolase                     312   7e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26679.1|  S-adenosyl-l-homocysteine hydrolase A                   312   8e-101   Populus tomentosa [Chinese white poplar]
gb|AGX26676.1|  S-adenosyl-l-homocysteine hydrolase A                   312   8e-101   Populus tomentosa [Chinese white poplar]
ref|NP_189023.1|  adenosylhomocysteinase 2                              312   8e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102577.1|  PREDICTED: adenosylhomocysteinase 2                312   9e-101   Brassica rapa
ref|XP_008794647.1|  PREDICTED: adenosylhomocysteinase-like             312   9e-101   Phoenix dactylifera
gb|AGX26649.1|  S-adenosyl-l-homocysteine hydrolase A                   311   1e-100   Populus tomentosa [Chinese white poplar]
gb|AAO72664.1|  wheat adenosylhomocysteinase-like protein               311   1e-100   Oryza sativa Japonica Group [Japonica rice]
gb|AIG62190.1|  S-adenosyl-L-homocysteine hydrolase                     311   1e-100   Populus tomentosa [Chinese white poplar]
ref|XP_002987608.1|  hypothetical protein SELMODRAFT_158886             311   1e-100   Selaginella moellendorffii
gb|KJB37873.1|  hypothetical protein B456_006G223900                    311   1e-100   Gossypium raimondii
ref|XP_004502244.1|  PREDICTED: adenosylhomocysteinase-like             311   1e-100   Cicer arietinum [garbanzo]
gb|AFW60834.1|  adenosyl homocysteine hydrolase1                        303   2e-100   
gb|KHG10896.1|  Adenosylhomocysteinase 1 -like protein                  311   2e-100   Gossypium arboreum [tree cotton]
gb|AGX26654.1|  S-adenosyl-l-homocysteine hydrolase A                   311   2e-100   Populus tomentosa [Chinese white poplar]
emb|CAJ01707.1|  putative S-adenosylhomocystein hydrolase 2             311   2e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN40278.1|  unknown                                                 311   2e-100   Picea sitchensis
gb|ABR16547.1|  unknown                                                 311   2e-100   Picea sitchensis
emb|CCC55421.1|  S-adenosyl-L-homocysteine hydrolase                    311   2e-100   Pinus pinaster [cluster pine]
gb|ABR17322.1|  unknown                                                 311   2e-100   Picea sitchensis
gb|ABR16573.1|  unknown                                                 311   2e-100   Picea sitchensis
ref|XP_008222808.1|  PREDICTED: adenosylhomocysteinase isoform X2       313   2e-100   
gb|AIG62174.1|  S-adenosyl-L-homocysteine hydrolase                     311   2e-100   Populus tomentosa [Chinese white poplar]
ref|XP_006418835.1|  hypothetical protein EUTSA_v10002505mg             311   2e-100   Eutrema salsugineum [saltwater cress]
gb|AGX26687.1|  S-adenosyl-l-homocysteine hydrolase A                   311   2e-100   Populus tomentosa [Chinese white poplar]
gb|AIG62163.1|  S-adenosyl-L-homocysteine hydrolase                     311   2e-100   Populus tomentosa [Chinese white poplar]
gb|AGX26656.1|  S-adenosyl-l-homocysteine hydrolase A                   311   3e-100   Populus tomentosa [Chinese white poplar]
emb|CDP15078.1|  unnamed protein product                                311   3e-100   Coffea canephora [robusta coffee]
ref|XP_006373090.1|  adenosylhomocysteinase family protein              311   3e-100   Populus trichocarpa [western balsam poplar]
ref|XP_002883461.1|  S-adenosyl-L-homocysteine (sah) hydrolase 2        310   3e-100   
gb|AIG62168.1|  S-adenosyl-L-homocysteine hydrolase                     310   3e-100   Populus tomentosa [Chinese white poplar]
gb|AIG62186.1|  S-adenosyl-L-homocysteine hydrolase                     310   3e-100   Populus tomentosa [Chinese white poplar]
gb|AGX26686.1|  S-adenosyl-l-homocysteine hydrolase A                   310   4e-100   Populus tomentosa [Chinese white poplar]
gb|AGX26657.1|  S-adenosyl-l-homocysteine hydrolase A                   310   5e-100   Populus tomentosa [Chinese white poplar]
gb|AAM19782.1|  AT3g23810/MYM9_15                                       310   5e-100   Arabidopsis thaliana [mouse-ear cress]
gb|AHL20280.1|  S-adenosylhomocysteine hydrolase                        310   6e-100   Kalanchoe daigremontiana
gb|AGX26677.1|  S-adenosyl-l-homocysteine hydrolase A                   310   6e-100   Populus tomentosa [Chinese white poplar]
gb|AGX26671.1|  S-adenosyl-l-homocysteine hydrolase A                   310   6e-100   Populus tomentosa [Chinese white poplar]
gb|ABR16138.1|  unknown                                                 310   7e-100   Picea sitchensis
ref|XP_004296983.1|  PREDICTED: adenosylhomocysteinase                  310   7e-100   Fragaria vesca subsp. vesca
gb|AGX26673.1|  S-adenosyl-l-homocysteine hydrolase A                   310   7e-100   Populus tomentosa [Chinese white poplar]
gb|AGX26653.1|  S-adenosyl-l-homocysteine hydrolase A                   309   8e-100   Populus tomentosa [Chinese white poplar]
emb|CDY53211.1|  BnaC03g74050D                                          309   8e-100   Brassica napus [oilseed rape]
ref|XP_004973012.1|  PREDICTED: adenosylhomocysteinase-like             309   9e-100   Setaria italica
gb|KJB28098.1|  hypothetical protein B456_005G027700                    309   1e-99    Gossypium raimondii
ref|XP_004953493.1|  PREDICTED: adenosylhomocysteinase-like             309   1e-99    Setaria italica
gb|AGX26665.1|  S-adenosyl-l-homocysteine hydrolase A                   309   1e-99    Populus tomentosa [Chinese white poplar]
gb|AGT16642.1|  Adenosylhomocysteinase                                  309   1e-99    Saccharum hybrid cultivar R570
sp|Q9SP37.1|SAHH_LUPLU  RecName: Full=Adenosylhomocysteinase; Sho...    309   1e-99    Lupinus luteus
gb|AGX26667.1|  S-adenosyl-l-homocysteine hydrolase A                   309   1e-99    Populus tomentosa [Chinese white poplar]
sp|P50246.1|SAHH_MEDSA  RecName: Full=Adenosylhomocysteinase; Sho...    309   1e-99    Medicago sativa [alfalfa]
gb|AIG62170.1|  S-adenosyl-L-homocysteine hydrolase                     309   1e-99    Populus tomentosa [Chinese white poplar]
pdb|3OND|A  Chain A, Crystal Structure Of Lupinus Luteus S-adenos...    309   2e-99    Lupinus luteus
gb|AGX26662.1|  S-adenosyl-l-homocysteine hydrolase A                   308   2e-99    Populus tomentosa [Chinese white poplar]
ref|XP_010512939.1|  PREDICTED: adenosylhomocysteinase 2-like           308   2e-99    Camelina sativa [gold-of-pleasure]
gb|AGX26681.1|  S-adenosyl-l-homocysteine hydrolase A                   308   2e-99    Populus tomentosa [Chinese white poplar]
ref|XP_009403608.1|  PREDICTED: adenosylhomocysteinase-like             308   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010466740.1|  PREDICTED: adenosylhomocysteinase 2-like iso...    308   2e-99    Camelina sativa [gold-of-pleasure]
gb|AGX26689.1|  S-adenosyl-l-homocysteine hydrolase A                   308   3e-99    Populus tomentosa [Chinese white poplar]
gb|EMT01272.1|  Adenosylhomocysteinase                                  308   3e-99    
dbj|BAP47516.1|  S-adenosylhomocysteine hydrolase                       308   4e-99    Gentiana triflora
ref|XP_009413566.1|  PREDICTED: adenosylhomocysteinase-like             308   4e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010488460.1|  PREDICTED: adenosylhomocysteinase 2                308   4e-99    Camelina sativa [gold-of-pleasure]
ref|XP_003538528.1|  PREDICTED: adenosylhomocysteinase-like             307   5e-99    Glycine max [soybeans]
ref|XP_009415939.1|  PREDICTED: adenosylhomocysteinase                  307   5e-99    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACJ11250.1|  S-adenosyl-L-homocystein hydrolase                      307   8e-99    Gossypium hirsutum [American cotton]
ref|NP_001265954.1|  adenosylhomocysteinase-like                        307   8e-99    Cicer arietinum [garbanzo]
gb|AIG62177.1|  S-adenosyl-L-homocysteine hydrolase                     306   9e-99    Populus tomentosa [Chinese white poplar]
gb|EPS72602.1|  adenosylhomocysteinase                                  309   1e-98    Genlisea aurea
ref|NP_001148534.1|  adenosylhomocysteinase                             306   1e-98    
ref|XP_010913095.1|  PREDICTED: adenosylhomocysteinase-like             306   1e-98    Elaeis guineensis
gb|AIG62161.1|  S-adenosyl-L-homocysteine hydrolase                     306   1e-98    Populus tomentosa [Chinese white poplar]
gb|KFK39678.1|  hypothetical protein AALP_AA3G275000                    306   2e-98    Arabis alpina [alpine rockcress]
sp|P32112.1|SAHH_WHEAT  RecName: Full=Adenosylhomocysteinase; Sho...    306   2e-98    Triticum aestivum [Canadian hard winter wheat]
emb|CDY50106.1|  BnaC01g43540D                                          306   2e-98    Brassica napus [oilseed rape]
ref|XP_003601687.1|  Adenosylhomocysteinase                             305   3e-98    Medicago truncatula
ref|XP_001755906.1|  predicted protein                                  305   3e-98    
ref|XP_003577583.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    305   3e-98    
gb|ACN34730.1|  unknown                                                 305   4e-98    Zea mays [maize]
ref|XP_009106322.1|  PREDICTED: adenosylhomocysteinase 2                305   4e-98    Brassica rapa
ref|XP_001755926.1|  predicted protein                                  305   4e-98    
ref|XP_006662925.1|  PREDICTED: adenosylhomocysteinase-like             305   4e-98    Oryza brachyantha
ref|XP_008438321.1|  PREDICTED: adenosylhomocysteinase-like             302   4e-97    Cucumis melo [Oriental melon]
ref|XP_001755929.1|  predicted protein                                  301   1e-96    
ref|XP_007163813.1|  hypothetical protein PHAVU_001G266500g             300   4e-96    Phaseolus vulgaris [French bean]
gb|AAL33588.1|  S-adenosyl-L-homocysteine hydrolase                     291   7e-96    Zea mays [maize]
ref|XP_004133979.1|  PREDICTED: adenosylhomocysteinase-like             296   7e-95    Cucumis sativus [cucumbers]
ref|XP_004166113.1|  PREDICTED: LOW QUALITY PROTEIN: adenosylhomo...    296   9e-95    
gb|KJB19538.1|  hypothetical protein B456_003G108500                    296   1e-94    Gossypium raimondii
ref|XP_007037836.1|  S-adenosyl-L-homocysteine hydrolase                295   4e-94    
gb|KHG19993.1|  Adenosylhomocysteinase 1 -like protein                  295   4e-94    Gossypium arboreum [tree cotton]
gb|AFY99087.1|  S-adenosyl-l-homocysteine hydrolase                     284   8e-94    Campanula persicifolia [peach-bells]
ref|NP_001067845.2|  Os11g0455500                                       294   2e-93    
gb|AFY99082.1|  S-adenosyl-l-homocysteine hydrolase                     283   3e-93    Clermontia kakeana
emb|CAB09795.1|  S-adenosyl-L-homocysteine hydrolase                    290   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001756025.1|  predicted protein                                  278   3e-91    
gb|ABA01148.1|  S-adenosyl-L-homocystein hydrolase                      276   8e-90    Chlamydomonas incerta
ref|XP_005843353.1|  S-adenosyl-L-homocysteine hydrolase                282   3e-89    Chlorella variabilis
gb|KCW60457.1|  hypothetical protein EUGRSUZ_H03177                     281   7e-89    Eucalyptus grandis [rose gum]
ref|XP_001693339.1|  S-Adenosyl homocysteine hydrolase                  281   8e-89    Chlamydomonas reinhardtii
ref|XP_002950429.1|  hypothetical protein VOLCADRAFT_74602              278   1e-87    Volvox carteri f. nagariensis
gb|ADQ00183.1|  S-adenosyl homocysteine hydrolase                       278   1e-87    Chlamydomonas sp. ICE-L
ref|XP_005643510.1|  S-Adenosyl homocysteine hydrolase                  277   4e-87    Coccomyxa subellipsoidea C-169
gb|ABR16332.1|  unknown                                                 275   2e-86    Picea sitchensis
gb|KCW60456.1|  hypothetical protein EUGRSUZ_H03176                     274   2e-86    Eucalyptus grandis [rose gum]
gb|KDD76058.1|  S-adenosyl-L-homocysteine hydrolase                     275   3e-86    Helicosporidium sp. ATCC 50920
ref|XP_011397211.1|  Adenosylhomocysteinase                             276   4e-86    Auxenochlorella protothecoides
gb|ADJ96635.1|  S-adenosyl homocysteine hydrolase                       271   7e-85    Dunaliella salina
emb|CBN20774.1|  S-Adenosyl homocysteine hydrolase                      267   2e-83    Polytomella sp. Pringsheim 198.80
gb|AFY99086.1|  S-adenosyl-l-homocysteine hydrolase                     257   3e-83    Lobelia erinus
dbj|BAA03710.1|  cytokinin binding protein CBP57                        265   4e-83    Nicotiana sylvestris
gb|KIZ05177.1|  adenosylhomocysteinase                                  277   5e-83    Monoraphidium neglectum
emb|CEF99088.1|  S-adenosyl-L-homocysteine hydrolase, conserved site    264   3e-82    Ostreococcus tauri
gb|KCW60454.1|  hypothetical protein EUGRSUZ_H03173                     262   2e-81    Eucalyptus grandis [rose gum]
ref|XP_001419579.1|  predicted protein                                  261   3e-81    Ostreococcus lucimarinus CCE9901
gb|KJB72029.1|  hypothetical protein B456_011G154000                    260   4e-81    Gossypium raimondii
gb|KCW60455.1|  hypothetical protein EUGRSUZ_H03174                     260   7e-81    Eucalyptus grandis [rose gum]
ref|XP_010024049.1|  PREDICTED: adenosylhomocysteinase 1-like iso...    257   1e-79    Eucalyptus grandis [rose gum]
gb|ABR16616.1|  unknown                                                 256   2e-79    Picea sitchensis
gb|ABG22475.1|  Adenosylhomocysteinase, putative, expressed             253   4e-79    Oryza sativa Japonica Group [Japonica rice]
gb|ABA93500.1|  Adenosylhomocysteinase, putative, expressed             254   1e-78    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005708566.1|  adenosylhomocysteinase                             255   2e-78    Galdieria sulphuraria
emb|CAJ01706.1|  S-adenosyl-L-homocysteine hydrolase                    251   2e-77    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002505983.1|  adenosylhomocysteinase                             251   3e-77    
ref|XP_003057172.1|  adenosylhomocysteinase                             250   1e-76    
ref|XP_005716982.1|  S-adenosyl-L-homocysteine hydrolase                247   1e-75    
ref|XP_008881882.1|  adenosylhomocysteinase, putative                   244   2e-74    
ref|XP_002366178.1|  adenosylhomocysteinase, putative                   244   2e-74    
ref|XP_002177758.1|  adenosylhomocysteinase                             241   1e-73    
ref|XP_008611237.1|  adenosylhomocysteinase                             241   1e-73    
gb|KFG55060.1|  putative adenosylhomocysteinase                         244   2e-73    
gb|EPT27008.1|  adenosylhomocysteinase, putative                        244   2e-73    
gb|EPR62066.1|  putative adenosylhomocysteinase                         244   2e-73    
gb|KFH13893.1|  putative adenosylhomocysteinase                         244   2e-73    
gb|KFG42936.1|  putative adenosylhomocysteinase                         244   2e-73    
gb|ESS32583.1|  putative adenosylhomocysteinase                         244   2e-73    
ref|XP_003884366.1|  hypothetical protein NCLIV_047660                  240   3e-73    
ref|XP_002776364.1|  adenosylhomocysteinase, putative                   232   9e-73    
ref|XP_005790915.1|  S-adenosyl-L-homocysteine hydrolase                236   2e-71    
ref|XP_005830876.1|  hypothetical protein GUITHDRAFT_110013             236   2e-71    
ref|XP_008872075.1|  adenosylhomocysteinase 2                           236   2e-71    
ref|XP_007510486.1|  S-adenosyl-L-homocysteine hydrolase                237   5e-71    
ref|XP_009531393.1|  hypothetical protein PHYSODRAFT_347096             234   8e-71    
ref|XP_008893590.1|  adenosylhomocysteinase                             234   8e-71    
ref|XP_002788757.1|  conserved hypothetical protein                     233   2e-70    
ref|XP_009833581.1|  adenosylhomocysteinase 2                           233   5e-70    
ref|XP_009033133.1|  hypothetical protein AURANDRAFT_69644              232   7e-70    
ref|XP_009493630.1|  adenosylhomocysteinase 1                           231   1e-69    
gb|EWM21100.1|  s-adenosyl homocysteine hydrolase                       233   2e-69    
ref|XP_002765933.1|  conserved hypothetical protein                     229   7e-69    
ref|WP_037787267.1|  hypothetical protein                               221   1e-68    
gb|EJK60373.1|  hypothetical protein THAOC_19286                        219   2e-68    
emb|CCA20123.1|  unnamed protein product                                228   3e-68    
ref|XP_002902721.1|  adenosylhomocysteinase                             227   6e-68    
ref|XP_005786995.1|  S-adenosyl-L-homocysteine hydrolase                226   9e-68    
ref|WP_030724358.1|  adenosylhomocysteinase                             219   1e-67    
ref|WP_023410675.1|  S-adenosyl-L-homocysteine hydrolase                225   2e-67    
emb|CDI83949.1|  adenosylhomocysteinase, putative                       218   5e-67    
ref|WP_020576907.1|  S-adenosyl-L-homocysteine hydrolase                224   8e-67    
ref|XP_002290951.1|  hypothetical protein THAPSDRAFT_28496              224   8e-67    
ref|WP_005221374.1|  S-adenosyl-L-homocysteine hydrolase                223   1e-66    
ref|WP_030289952.1|  MULTISPECIES: hypothetical protein                 224   1e-66    
ref|WP_030260730.1|  MULTISPECIES: hypothetical protein                 223   2e-66    
ref|WP_042432571.1|  adenosylhomocysteinase                             222   3e-66    
ref|WP_031077053.1|  hypothetical protein                               223   3e-66    
emb|CCI50303.1|  unnamed protein product                                223   3e-66    
ref|WP_033354750.1|  hypothetical protein                               221   7e-66    
ref|WP_028061676.1|  hypothetical protein                               221   8e-66    
ref|WP_030310801.1|  hypothetical protein                               221   8e-66    
ref|WP_030398087.1|  MULTISPECIES: hypothetical protein                 221   1e-65    
ref|WP_030245490.1|  hypothetical protein                               221   1e-65    
gb|ACJ13434.1|  adenosylhomocysteinase                                  214   1e-65    
ref|WP_043914237.1|  S-adenosyl-L-homocysteine hydrolase                220   2e-65    
ref|WP_035863223.1|  S-adenosyl-L-homocysteine hydrolase                220   2e-65    
ref|XP_001423621.1|  hypothetical protein                               219   4e-65    
ref|WP_035848617.1|  hypothetical protein                               219   6e-65    
ref|WP_029018156.1|  hypothetical protein                               219   7e-65    
ref|WP_011292928.1|  S-adenosyl-L-homocysteine hydrolase                219   7e-65    
ref|WP_007192127.1|  S-adenosyl-L-homocysteine hydrolase                219   7e-65    
ref|WP_033218411.1|  S-adenosyl-L-homocysteine hydrolase                219   9e-65    
ref|WP_009148000.1|  S-adenosyl-L-homocysteine hydrolase                218   1e-64    
ref|WP_028062632.1|  hypothetical protein                               218   1e-64    
ref|WP_020251800.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    218   2e-64    
ref|WP_020252885.1|  hypothetical protein                               218   2e-64    
ref|WP_033255593.1|  S-adenosyl-L-homocysteine hydrolase                218   2e-64    
ref|WP_015281066.1|  adenosylhomocysteinase                             217   2e-64    
ref|WP_030461911.1|  S-adenosyl-L-homocysteine hydrolase                218   2e-64    
ref|WP_028072996.1|  hypothetical protein                               213   3e-64    
gb|ADE22275.1|  putative adenosylhomocysteinase                         217   3e-64    
ref|WP_037775629.1|  adenosylhomocysteinase                             217   3e-64    
ref|WP_014804737.1|  S-adenosyl-L-homocysteine hydrolase                217   3e-64    
ref|WP_037796630.1|  adenosylhomocysteinase                             217   3e-64    
ref|WP_030920540.1|  S-adenosyl-L-homocysteine hydrolase                217   3e-64    
gb|EDY66712.2|  adenosylhomocysteinase                                  217   3e-64    
ref|WP_017613514.1|  S-adenosyl-L-homocysteine hydrolase                217   3e-64    
ref|XP_005535237.1|  S-adenosyl-L-homocysteine hydrolase                218   4e-64    
ref|WP_014136057.1|  S-adenosyl-L-homocysteine hydrolase                217   4e-64    
ref|WP_034088535.1|  hypothetical protein                               217   5e-64    
ref|WP_030634444.1|  adenosylhomocysteinase                             209   5e-64    
ref|WP_030264019.1|  hypothetical protein                               216   6e-64    
ref|WP_035801129.1|  hypothetical protein                               216   6e-64    
ref|WP_030759761.1|  adenosylhomocysteinase                             210   7e-64    
ref|WP_017604622.1|  S-adenosyl-L-homocysteine hydrolase                216   7e-64    
ref|WP_017583238.1|  S-adenosyl-L-homocysteine hydrolase                216   7e-64    
ref|WP_014779838.1|  S-adenosyl-L-homocysteine hydrolase                216   8e-64    
ref|WP_030634534.1|  adenosylhomocysteinase                             208   8e-64    
ref|XP_002784976.1|  adenosylhomocysteinase, putative                   206   9e-64    
ref|WP_017595102.1|  S-adenosyl-L-homocysteine hydrolase                216   1e-63    
ref|WP_037575816.1|  hypothetical protein                               216   1e-63    
ref|WP_014911909.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    215   1e-63    
ref|WP_031943710.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-63    
ref|WP_030221563.1|  adenosylhomocysteinase                             215   2e-63    
ref|WP_042410976.1|  hypothetical protein                               215   2e-63    
ref|WP_014142777.1|  S-adenosyl-L-homocysteine hydrolase                215   2e-63    
ref|WP_030119663.1|  adenosylhomocysteinase                             208   2e-63    
ref|WP_033824956.1|  hypothetical protein                               215   3e-63    
ref|WP_042802104.1|  adenosylhomocysteinase                             214   3e-63    
ref|WP_027357796.1|  adenosylhomocysteinase                             214   3e-63    
ref|WP_037837039.1|  adenosylhomocysteinase                             208   3e-63    
ref|WP_020389898.1|  S-adenosyl-L-homocysteine hydrolase                214   3e-63    
ref|WP_031147523.1|  adenosylhomocysteinase                             208   4e-63    
gb|EFL18396.1|  adenosylhomocysteinase                                  214   4e-63    
ref|WP_007041769.1|  S-adenosyl-L-homocysteine hydrolase                214   4e-63    
ref|WP_017608316.1|  S-adenosyl-L-homocysteine hydrolase                214   4e-63    
emb|CDW86895.1|  s-adenosyl-l-homocysteine hydrolase                    214   4e-63    
ref|WP_028648434.1|  S-adenosyl-L-homocysteine hydrolase                214   5e-63    
ref|WP_017542451.1|  S-adenosyl-L-homocysteine hydrolase                214   5e-63    
ref|WP_043962062.1|  adenosylhomocysteinase                             214   5e-63    
ref|WP_017585142.1|  S-adenosyl-L-homocysteine hydrolase                214   6e-63    
ref|WP_030979035.1|  adenosylhomocysteinase                             207   8e-63    
ref|WP_017570953.1|  S-adenosyl-L-homocysteine hydrolase                213   9e-63    
ref|WP_042456565.1|  hypothetical protein                               213   9e-63    
ref|WP_007074914.1|  S-adenosyl-L-homocysteine hydrolase                214   9e-63    
ref|WP_012935821.1|  S-adenosyl-L-homocysteine hydrolase                213   1e-62    
ref|WP_017625947.1|  S-adenosyl-L-homocysteine hydrolase                213   1e-62    
ref|WP_037605447.1|  hypothetical protein                               213   1e-62    
ref|WP_030998790.1|  adenosylhomocysteinase                             213   1e-62    
ref|WP_033342518.1|  hypothetical protein                               213   1e-62    
ref|WP_009717416.1|  S-adenosyl-L-homocysteine hydrolase                213   1e-62    
ref|WP_037840693.1|  adenosylhomocysteinase                             206   2e-62    
ref|WP_004953444.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
gb|EKD42945.1|  hypothetical protein ACD_72C00527G0002                  212   2e-62    
ref|WP_007822968.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
ref|WP_009068214.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    213   2e-62    
ref|WP_017575237.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
ref|WP_008746056.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
ref|WP_020506665.1|  S-adenosyl-L-homocysteine hydrolase                212   2e-62    
ref|WP_043752821.1|  adenosylhomocysteinase                             212   2e-62    
ref|WP_031147752.1|  adenosylhomocysteinase                             206   2e-62    
ref|WP_019711661.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
emb|CBJ28078.1|  S-Adenosyl homocysteine hydrolase                      212   2e-62    
ref|WP_012919256.1|  S-adenosyl-L-homocysteine hydrolase                212   2e-62    
ref|WP_030716579.1|  adenosylhomocysteinase                             206   2e-62    
ref|WP_042387828.1|  hypothetical protein                               212   2e-62    
ref|WP_018386384.1|  S-adenosyl-L-homocysteine hydrolase                213   2e-62    
ref|WP_031509769.1|  adenosylhomocysteinase                             212   3e-62    
ref|WP_016910634.1|  S-adenosyl-L-homocysteine hydrolase                212   3e-62    
ref|WP_017596835.1|  S-adenosyl-L-homocysteine hydrolase                212   3e-62    
ref|WP_019546896.1|  S-adenosyl-L-homocysteine hydrolase                212   3e-62    
ref|WP_031063941.1|  adenosylhomocysteinase                             204   4e-62    
ref|WP_030122306.1|  adenosylhomocysteinase                             205   4e-62    
ref|WP_017564266.1|  S-adenosyl-L-homocysteine hydrolase                211   5e-62    
ref|WP_006134655.1|  S-adenosyl-L-homocysteine hydrolase                204   5e-62    
ref|WP_027734715.1|  adenosylhomocysteinase                             211   5e-62    
ref|WP_017945881.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    211   5e-62    
ref|WP_030276178.1|  hypothetical protein                               211   6e-62    
ref|WP_037910293.1|  adenosylhomocysteinase                             211   6e-62    
ref|WP_030735559.1|  adenosylhomocysteinase                             211   7e-62    
ref|WP_006348984.1|  S-adenosyl-L-homocysteine hydrolase                211   9e-62    
ref|WP_030350966.1|  adenosylhomocysteinase                             211   9e-62    
ref|WP_024494417.1|  adenosylhomocysteinase                             206   1e-61    
ref|WP_031015775.1|  adenosylhomocysteinase                             207   1e-61    
ref|WP_013731725.1|  S-adenosyl-L-homocysteine hydrolase                211   1e-61    
ref|WP_030265792.1|  adenosylhomocysteinase                             203   1e-61    
ref|WP_028810729.1|  adenosylhomocysteinase                             211   1e-61    
ref|WP_030889521.1|  MULTISPECIES: adenosylhomocysteinase               211   1e-61    
ref|WP_030723207.1|  adenosylhomocysteinase                             211   1e-61    
ref|WP_014440987.1|  S-adenosyl-L-homocysteine hydrolase                210   1e-61    
ref|WP_010527565.1|  S-adenosyl-L-homocysteine hydrolase                210   1e-61    
ref|WP_030231660.1|  adenosylhomocysteinase                             204   1e-61    
ref|WP_030802969.1|  MULTISPECIES: adenosylhomocysteinase               210   1e-61    
ref|WP_044347377.1|  adenosylhomocysteinase                             210   2e-61    
ref|WP_018846770.1|  S-adenosyl-L-homocysteine hydrolase                210   2e-61    
ref|WP_019435388.1|  S-adenosyl-L-homocysteine hydrolase                210   2e-61    
ref|WP_029384937.1|  MULTISPECIES: adenosylhomocysteinase               210   2e-61    
gb|EJY87176.1|  Adenosylhomocysteinase                                  210   2e-61    
ref|WP_030543976.1|  adenosylhomocysteinase                             210   2e-61    
ref|WP_020963739.1|  hypothetical protein                               201   2e-61    
ref|WP_040623224.1|  adenosylhomocysteinase                             203   3e-61    
ref|WP_030390893.1|  adenosylhomocysteinase                             207   3e-61    
ref|WP_012969559.1|  S-adenosyl-L-homocysteine hydrolase                209   3e-61    
ref|WP_013154760.1|  S-adenosyl-L-homocysteine hydrolase                209   3e-61    
ref|WP_019608106.1|  S-adenosyl-L-homocysteine hydrolase                209   3e-61    
ref|WP_027585853.1|  adenosylhomocysteinase                             209   3e-61    
ref|WP_043501387.1|  adenosylhomocysteinase                             209   3e-61    
ref|WP_030497957.1|  adenosylhomocysteinase                             207   3e-61    
ref|WP_017538521.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    209   3e-61    
ref|WP_027472887.1|  adenosylhomocysteinase                             209   3e-61    
ref|WP_023417428.1|  S-adenosyl-L-homocysteine hydrolase                209   4e-61    
ref|WP_030082756.1|  adenosylhomocysteinase                             202   4e-61    
ref|WP_030266050.1|  adenosylhomocysteinase                             202   4e-61    
ref|WP_026206556.1|  adenosylhomocysteinase                             209   4e-61    
ref|WP_030700076.1|  adenosylhomocysteinase                             209   4e-61    
ref|WP_014155919.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    209   4e-61    
ref|WP_032787207.1|  adenosylhomocysteinase                             209   4e-61    
ref|WP_030891029.1|  adenosylhomocysteinase                             209   4e-61    
ref|WP_028072995.1|  hypothetical protein                               205   5e-61    
ref|WP_014061185.1|  S-adenosyl-L-homocysteine hydrolase                209   5e-61    
ref|WP_039960509.1|  adenosylhomocysteinase                             204   5e-61    
ref|WP_031067797.1|  adenosylhomocysteinase                             202   5e-61    
ref|WP_038284612.1|  hypothetical protein                               209   5e-61    
ref|WP_040272134.1|  hypothetical protein                               209   5e-61    
gb|AJD20014.1|  S-adenosyl-L-homocysteine hy-drolase                    209   5e-61    
ref|WP_038287745.1|  hypothetical protein                               209   5e-61    
ref|WP_028429456.1|  adenosylhomocysteinase                             209   5e-61    
ref|WP_023421854.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    209   5e-61    
ref|WP_044107885.1|  adenosylhomocysteinase                             208   5e-61    
ref|WP_030625507.1|  adenosylhomocysteinase                             202   6e-61    
ref|WP_030694652.1|  adenosylhomocysteinase                             206   6e-61    
emb|CDJ69092.1|  adenosylhomocysteinase, putative                       209   6e-61    
gb|KIZ22480.1|  adenosylhomocysteinase                                  209   6e-61    
ref|WP_030595575.1|  adenosylhomocysteinase                             209   6e-61    
ref|WP_007460887.1|  S-adenosyl-L-homocysteine hydrolase                209   6e-61    
gb|ACJ22539.1|  S-adenosylhomocysteinase                                201   6e-61    
ref|WP_012936074.1|  S-adenosyl-L-homocysteine hydrolase                209   6e-61    
ref|WP_031126383.1|  adenosylhomocysteinase                             209   7e-61    
ref|WP_030326708.1|  adenosylhomocysteinase                             208   7e-61    
ref|WP_020870822.1|  S-adenosyl-L-homocysteine hydrolase                209   7e-61    
ref|WP_015796151.1|  S-adenosyl-L-homocysteine hydrolase                209   7e-61    
ref|WP_030250255.1|  MULTISPECIES: adenosylhomocysteinase               209   7e-61    
ref|WP_003968738.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    209   7e-61    
ref|WP_018961954.1|  S-adenosyl-L-homocysteine hydrolase                208   7e-61    
ref|WP_032784234.1|  adenosylhomocysteinase                             208   7e-61    
ref|WP_032769603.1|  adenosylhomocysteinase                             208   7e-61    
ref|WP_037954273.1|  adenosylhomocysteinase                             208   8e-61    
ref|WP_030742429.1|  adenosylhomocysteinase                             208   8e-61    
ref|WP_033326694.1|  adenosylhomocysteinase                             208   8e-61    
ref|WP_041129509.1|  adenosylhomocysteinase                             208   8e-61    
ref|WP_010059945.1|  S-adenosyl-L-homocysteine hydrolase                208   8e-61    
ref|WP_031065684.1|  adenosylhomocysteinase                             202   8e-61    
ref|WP_006125011.1|  MULTISPECIES: S-adenosyl-L-homocysteine hydr...    208   8e-61    
ref|WP_015608928.1|  MULTISPECIES: SAHH Adenosylhomocysteinase          208   9e-61    
emb|CAL34094.1|  putative adenosylhomocysteinase                        208   9e-61    
ref|WP_031184361.1|  adenosylhomocysteinase                             208   9e-61    



>gb|AAF19001.1|AF212157_1 S-adenosylhomocysteine hydrolase [Allium cepa]
Length=312

 Score =   320 bits (821),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/174 (97%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEV+MPGLMACR EFGPSQPFKGARITGSL MT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVDMPGLMACRTEFGPSQPFKGARITGSLLMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY KNGT+PDPSSTDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTLPDPSSTDNAEFQIVL  178



>gb|AFK08605.1| S-adenosyl homocysteine hydrolase [Nicotiana benthamiana]
Length=485

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGT+PDP+STDNAEFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTIPDPNSTDNAEFQLVL  178



>gb|AAV31754.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGT+PDP+STDNAEFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTIPDPNSTDNAEFQLVL  178



>ref|NP_001289538.1| adenosylhomocysteinase [Nicotiana sylvestris]
 ref|XP_009622119.1| PREDICTED: adenosylhomocysteinase [Nicotiana tomentosiformis]
 ref|XP_009800926.1| PREDICTED: adenosylhomocysteinase [Nicotiana sylvestris]
 sp|P68172.1|SAHH_NICSY RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana sylvestris]
 sp|P68173.1|SAHH_TOBAC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=Cytokinin-binding protein CBP57; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase [Nicotiana tabacum]
 dbj|BAA03709.1| S-adenosyl-L-homocystein hydrolase [Nicotiana sylvestris]
 dbj|BAA08142.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 dbj|BAA23164.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
 gb|AAV31756.1| S-adenosyl-L-homocysteine hydrolase [Nicotiana tabacum]
Length=485

 Score =   324 bits (831),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 173/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDNAEFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVL  178



>gb|AFU51537.1| S-adenosyl-homocysteine hydrolase protein [Capsicum annuum]
Length=485

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGTVPDPSSTDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPSSTDNVEFQLVL  178



>ref|XP_010253338.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G +PDPSSTDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKLPDPSSTDNAEFQIVL  178



>ref|XP_010268032.1| PREDICTED: adenosylhomocysteinase-like [Nelumbo nucifera]
Length=485

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 166/174 (95%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G +PDPSSTDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKLPDPSSTDNAEFQIVL  178



>gb|AAP92452.1| S-adenosyl-L-homocystein hydrolase [Petunia x hybrida]
Length=485

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+GTVPDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKDGTVPDPTSTDNVEFQLVL  178



>ref|XP_004247887.1| PREDICTED: adenosylhomocysteinase [Solanum lycopersicum]
Length=485

 Score =   322 bits (825),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDPSSTDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPSSTDNVEFQLVL  178



>ref|XP_009787091.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana sylvestris]
Length=485

 Score =   321 bits (823),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQLVL  178



>gb|EYU32710.1| hypothetical protein MIMGU_mgv1a003606mg [Erythranthe guttata]
Length=574

 Score =   323 bits (829),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 167/174 (96%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  94   VEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  153

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  154  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  213

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ KNGTVPDP+STDNAEFQIVL
Sbjct  214  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKNGTVPDPNSTDNAEFQIVL  267



>ref|XP_002266154.1| PREDICTED: adenosylhomocysteinase [Vitis vinifera]
 emb|CAN64242.1| hypothetical protein VITISV_022595 [Vitis vinifera]
Length=485

 Score =   320 bits (821),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP QPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPQQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNAEFQIVL  178



>ref|XP_006360925.1| PREDICTED: adenosylhomocysteinase-like isoform X1 [Solanum tuberosum]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVL  178



>sp|P35007.1|SAHH_CATRO RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
 emb|CAA81527.1| S-adenosyl-L-homocysteine hydrolase [Catharanthus roseus]
Length=485

 Score =   320 bits (821),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQ+HAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQEHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY KNG +PDPSSTDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKNGALPDPSSTDNAEFQIVL  178



>gb|EYU31514.1| hypothetical protein MIMGU_mgv1a005403mg [Erythranthe guttata]
Length=485

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 166/175 (95%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             VEKT+SGREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDPSSTDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPSSTDNAEFQIVL  178



>ref|XP_009606591.1| PREDICTED: adenosylhomocysteinase-like [Nicotiana tomentosiformis]
Length=485

 Score =   320 bits (819),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNVEFQLVL  178



>gb|ABB55380.1| S-adenosyl-L-homocysteine hydrolase-like [Solanum tuberosum]
Length=484

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 171/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGT+PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTIPDPTSTDNVEFQLVL  178



>sp|P93253.1|SAHH_MESCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Mesembryanthemum 
crystallinum]
 gb|AAB38499.1| S-adenosyl-L-homocystein hydrolase [Mesembryanthemum crystallinum]
Length=485

 Score =   319 bits (818),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY KNGT+PDP+STDN EFQ+VL
Sbjct  125  LDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGTIPDPTSTDNPEFQLVL  178



>dbj|BAP47515.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   319 bits (817),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTNSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDPSSTDNAEFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFKKSGKLPDPSSTDNAEFQLVL  178



>ref|NP_001078387.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 gb|AEE83348.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=325

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>ref|XP_011102056.1| PREDICTED: adenosylhomocysteinase [Sesamum indicum]
Length=485

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDPSSTDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVL  178



>emb|CDP11183.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 172/174 (99%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGP+QPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPTQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGKLPDPASTDNAEFQIVL  178



>ref|XP_008380474.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+GT+PDPSSTDN EFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGTLPDPSSTDNQEFQLVL  178



>ref|XP_009373550.1| PREDICTED: adenosylhomocysteinase [Pyrus x bretschneideri]
Length=485

 Score =   318 bits (816),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 173/175 (99%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+GT+PDPSSTDN EFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGTLPDPSSTDNQEFQLVL  178



>gb|ABQ18314.1| S-adenosyl-L-homocysteine hydrolase [Chrysanthemum x morifolium]
Length=485

 Score =   318 bits (815),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            TVEKT+SGREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTTSGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK+G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKSGKLPDPTSTDNAEFQIVL  178



>ref|XP_004252985.1| PREDICTED: adenosylhomocysteinase-like [Solanum lycopersicum]
Length=485

 Score =   318 bits (814),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G  PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKFPDPNSTDNVEFQLVL  178



>ref|XP_002278000.1| PREDICTED: adenosylhomocysteinase-like [Vitis vinifera]
Length=485

 Score =   317 bits (813),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP QPFKGARITGSLHM
Sbjct  4    VVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPQQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEY ++G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYERSGKLPDPASTDNAEFQIVL  178



>ref|XP_010908558.1| PREDICTED: adenosylhomocysteinase [Elaeis guineensis]
Length=485

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKVPDPASTDNAEFQIVL  178



>ref|XP_006349914.1| PREDICTED: adenosylhomocysteinase-like [Solanum tuberosum]
Length=485

 Score =   317 bits (813),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK G  PDP STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKTGKFPDPHSTDNVEFQLVL  178



>emb|CDY01177.1| BnaA04g06420D [Brassica napus]
Length=485

 Score =   317 bits (812),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>gb|EYU31513.1| hypothetical protein MIMGU_mgv1a004058mg [Erythranthe guttata]
Length=547

 Score =   319 bits (817),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDM+QADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  67   VEKTTSGREYKVKDMTQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  126

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  127  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  186

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K G +PDPSSTDNAEFQIVL
Sbjct  187  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKLPDPSSTDNAEFQIVL  240



>ref|XP_009139575.1| PREDICTED: adenosylhomocysteinase 1 [Brassica rapa]
Length=485

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/175 (94%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>gb|AAX16000.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>gb|AAX15998.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   317 bits (812),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>ref|NP_193130.1| adenosylhomocysteinase 1 [Arabidopsis thaliana]
 sp|O23255.1|SAHH1_ARATH RecName: Full=Adenosylhomocysteinase 1; Short=AdoHcyase 1; AltName: 
Full=Protein EMBRYO DEFECTIVE 1395; AltName: Full=Protein 
HOMOLOGY-DEPENDENT GENE SILENCING 1; AltName: Full=S-adenosyl-L-homocysteine 
hydrolase 1; Short=SAH hydrolase 1 [Arabidopsis 
thaliana]
 gb|AAG40389.1|AF325037_1 AT4g13940 [Arabidopsis thaliana]
 emb|CAB10173.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAC14714.1| S-adenosyl-L-homocysteine hydrolase [Arabidopsis thaliana]
 emb|CAB78436.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK68806.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAK83621.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAL90945.1| AT4g13940/dl3010w [Arabidopsis thaliana]
 gb|AAM10030.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AAO00764.1| adenosylhomocysteinase [Arabidopsis thaliana]
 gb|AEE83345.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>ref|XP_006283635.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
 ref|XP_010435212.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450125.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 ref|XP_010450146.1| PREDICTED: adenosylhomocysteinase 1 [Camelina sativa]
 gb|EOA16533.1| hypothetical protein CARUB_v10004693mg [Capsella rubella]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>ref|XP_010052042.1| PREDICTED: adenosylhomocysteinase 1 [Eucalyptus grandis]
 gb|KCW75898.1| hypothetical protein EUGRSUZ_D00281 [Eucalyptus grandis]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAE+GP+QPFKGARITGSLHMT
Sbjct  5    VEKTAGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEYGPAQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAATARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKVPDPASTDNAEFQIVL  178



>gb|AAP92454.1| S-adenosyl-L-homocystein hydrolase [Brassica oleracea var. alboglabra]
Length=466

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>ref|XP_002870350.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46609.1| hypothetical protein ARALYDRAFT_915516 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>gb|AAM62888.1| adenosylhomocysteinase [Arabidopsis thaliana]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>gb|AAX15999.1| S-adenosyl-L-homocysteine hydrolase 1 mutant [Arabidopsis thaliana]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>ref|XP_002522805.1| adenosylhomocysteinase, putative [Ricinus communis]
 gb|EEF39656.1| adenosylhomocysteinase, putative [Ricinus communis]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPTSTDNAEFQIVL  178



>gb|AAV31755.1| S-adenosyl-L-homocysteine hydrolase, partial [Nicotiana tabacum]
Length=479

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/172 (94%), Positives = 169/172 (98%), Gaps = 0/172 (0%)
 Frame = +2

Query  101  KTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQ  280
            KT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQ
Sbjct  1    KTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQ  60

Query  281  TAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALD  460
            TAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALD
Sbjct  61   TAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALD  120

Query  461  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDPSSTDN EFQ+VL
Sbjct  121  WGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKLPDPSSTDNVEFQLVL  172



>gb|KFK36278.1| hypothetical protein AALP_AA4G101800 [Arabis alpina]
Length=485

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPNSTDNPEFQIVL  178



>ref|XP_009349913.1| PREDICTED: adenosylhomocysteinase-like [Pyrus x bretschneideri]
Length=485

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 172/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+GT+PDPSSTDN EFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGTLPDPSSTDNQEFQLVL  178



>ref|XP_010527457.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPSSTDNPEFQIVL  178



>ref|XP_010532739.1| PREDICTED: adenosylhomocysteinase 1 [Tarenaya hassleriana]
Length=485

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/174 (95%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQVPDPSSTDNPEFQIVL  178



>ref|XP_008457223.1| PREDICTED: adenosylhomocysteinase 1 [Cucumis melo]
Length=485

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVL  178



>ref|XP_008776857.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDN EFQIVL
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPTSTDNVEFQIVL  178



>sp|P50249.1|SAHH_PHASS RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Phalaenopsis sp.]
 emb|CAA56278.1| S-adenosylhomocysteine hydrolase [Phalaenopsis sp. 'pSPORT1']
Length=485

 Score =   316 bits (810),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            L+WG GGGPDLIVDDGGDATLLIHEGVKAEEEY KNG +PDP+STDNAEFQIVL
Sbjct  125  LEWGAGGGPDLIVDDGGDATLLIHEGVKAEEEYEKNGKIPDPASTDNAEFQIVL  178



>ref|XP_004138966.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 ref|XP_004162424.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN61486.1| hypothetical protein Csa_2G140370 [Cucumis sativus]
Length=485

 Score =   316 bits (809),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVL  178



>ref|XP_010097949.1| hypothetical protein L484_026840 [Morus notabilis]
 gb|EXB73679.1| hypothetical protein L484_026840 [Morus notabilis]
Length=485

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL  178



>ref|XP_003524926.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVL  178



>ref|XP_003531217.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVL  178



>ref|XP_009135865.1| PREDICTED: adenosylhomocysteinase 2-like [Brassica rapa]
Length=485

 Score =   316 bits (809),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDPSSTDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPSSTDNPEFQIVL  178



>gb|AEI54335.1| adenosylhomocysteinase [Glycine max]
Length=485

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGELPDPNSTDNAEFQIVL  178



>emb|CDY47309.1| BnaAnng08830D [Brassica napus]
Length=486

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>gb|KCW59952.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=467

 Score =   315 bits (806),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVL  178



>ref|XP_007034216.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY05142.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=510

 Score =   316 bits (809),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVL  178



>emb|CDX85127.1| BnaC07g07790D [Brassica napus]
Length=475

 Score =   315 bits (806),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVL  178



>ref|XP_010023650.1| PREDICTED: adenosylhomocysteinase [Eucalyptus grandis]
 gb|KCW59953.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=485

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVL  178



>emb|CDY50423.1| BnaCnng19320D [Brassica napus]
Length=485

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 164/175 (94%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    VVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPG GPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  124  ALDWGPGAGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>gb|AIG62154.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>sp|Q01781.2|SAHH_PETCR RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Petroselinum crispum]
 gb|AAA33856.1| S-adenosylhomocysteine hydrolase [Petroselinum crispum]
Length=485

 Score =   315 bits (807),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKDMS ADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSLADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQT VLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTER
Sbjct  64   TIQTGVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYKKSGAIPDPASTDNAEFQIVL  178



>gb|AIG62191.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|ABK25129.1| unknown [Picea sitchensis]
Length=485

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +2

Query  98   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  278  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            DWGPGGGPDLIVDDGGD TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL
Sbjct  126  DWGPGGGPDLIVDDGGDTTLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVL  178



>gb|AIG62181.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62178.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>ref|XP_006297468.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
 gb|EOA30366.1| hypothetical protein CARUB_v10013488mg, partial [Capsella rubella]
Length=507

 Score =   315 bits (808),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  27   VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  86

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  87   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  146

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL
Sbjct  147  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVL  200



>gb|KDO43195.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=445

 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL  178



>gb|AIG62157.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|ABK24229.1| unknown [Picea sitchensis]
 gb|ACN40819.1| unknown [Picea sitchensis]
Length=485

 Score =   315 bits (806),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +2

Query  98   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRVEFGPAQPFKGARITGSLHMTI  65

Query  278  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            DWGPGGGPDLIVDDGGD TLLIHEGVKAEEE+AK G VPDP+ST N EFQIVL
Sbjct  126  DWGPGGGPDLIVDDGGDTTLLIHEGVKAEEEFAKTGKVPDPASTTNVEFQIVL  178



>ref|XP_006414844.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
 gb|ESQ56297.1| hypothetical protein EUTSA_v10024750mg [Eutrema salsugineum]
Length=588

 Score =   318 bits (814),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  108  VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  167

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  168  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  227

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  228  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPNSTDNPEFQIVL  281



>gb|KJB37872.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=446

 Score =   313 bits (802),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVL  178



>gb|AIG62165.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62166.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62184.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62160.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62162.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62167.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62172.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62183.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62156.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62164.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62189.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   315 bits (806),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>ref|XP_003629610.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89237.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AET04086.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            TVEKT +GREYKV+D+SQADFGRLE+ELAE+EMPGLM+CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTQAGREYKVRDLSQADFGRLEIELAEIEMPGLMSCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDNAEFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGEVPDPSSTDNAEFQLVL  178



>ref|XP_011012490.1| PREDICTED: adenosylhomocysteinase-like [Populus euphratica]
Length=485

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>emb|CDY58805.1| BnaC08g46780D [Brassica napus]
Length=475

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>ref|XP_007153624.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
 gb|ESW25618.1| hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris]
Length=485

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPTSTDNAEFQIVL  178



>gb|KJB72028.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=487

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVL
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVL  178



>gb|KHG17040.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=485

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVL
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVL  178



>gb|KJB72024.1| hypothetical protein B456_011G154000 [Gossypium raimondii]
Length=485

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVL
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPSSTDNAEFQIVL  178



>ref|XP_009107496.1| PREDICTED: adenosylhomocysteinase 1-like [Brassica rapa]
Length=478

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>ref|XP_010551666.1| PREDICTED: adenosylhomocysteinase 1-like [Tarenaya hassleriana]
Length=485

 Score =   314 bits (804),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPS TDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGQVPDPSCTDNPEFQIVL  178



>ref|XP_011102207.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKMPDPTSTDNAEFQIVL  178



>ref|XP_010905139.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+EFGPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPFKGARISGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDN+EFQIVL
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPTSTDNSEFQIVL  178



>ref|XP_011083449.1| PREDICTED: adenosylhomocysteinase-like [Sesamum indicum]
Length=485

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGASQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEYAK+G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYAKSGKMPDPTSTDNAEFQIVL  178



>gb|KDP39327.1| hypothetical protein JCGZ_01084 [Jatropha curcas]
Length=485

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             VEKT+ GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAE+GPSQPFKGA+ITGSLHM
Sbjct  4    VVEKTTGGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEYGPSQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDPSSTDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGQLPDPSSTDNAEFQIVL  178



>ref|XP_008361486.1| PREDICTED: adenosylhomocysteinase [Malus domestica]
Length=485

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPLKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+GT+PDPSSTDN EFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGTLPDPSSTDNQEFQLVL  178



>gb|AAL16259.1|AF428329_1 AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C AEFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVAEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVL  178



>gb|KCW59951.1| hypothetical protein EUGRSUZ_H02678 [Eucalyptus grandis]
Length=517

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT+ GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTGGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDNAEFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGKLPDPASTDNAEFQLVL  178



>ref|XP_010673385.1| PREDICTED: adenosylhomocysteinase [Beta vulgaris subsp. vulgaris]
 dbj|BAE07182.1| S-adenosyl-L-homocysteine hydrolase [Beta vulgaris]
Length=487

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGA+ITGSLHM
Sbjct  6    SVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFKGAKITGSLHM  65

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  66   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  125

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VL
Sbjct  126  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKIPDPTSTDNVEFQLVL  180



>ref|XP_011003627.1| PREDICTED: adenosylhomocysteinase [Populus euphratica]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AER92590.1| putative S-adenosyl-L-homocysteinase [Linum usitatissimum]
Length=561

 Score =   316 bits (809),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            V+KT++GREYKVKDMSQADFGRLELELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  81   VDKTTTGREYKVKDMSQADFGRLELELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  140

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  141  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  200

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVL
Sbjct  201  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKIPDPASTDNAEFQIVL  254



>gb|AIG62149.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|KDO43194.1| hypothetical protein CISIN_1g011464mg [Citrus sinensis]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL  178



>dbj|BAH19670.1| AT4G13940 [Arabidopsis thaliana]
Length=325

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRL LELAEVEMPGLMACR  FGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLGLELAEVEMPGLMACRTGFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEVFEKTGQVPDPTSTDNPEFQIVL  178



>gb|AIG62171.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62155.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>ref|XP_006492541.1| PREDICTED: adenosylhomocysteinase-like [Citrus sinensis]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVEKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL  178



>gb|AAP92453.1| S-adenosyl-L-homocystein hydrolase [Arabidopsis thaliana]
Length=485

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTS GREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGP+QPFKGARITGSLHMT
Sbjct  5    VEKTSGGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPAQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGQVPDPTSTDNPEFQIVL  178



>gb|KFK28004.1| hypothetical protein AALP_AA8G459100 [Arabis alpina]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/174 (94%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWG GGGPDLIVDDGGDATLLIHEGVKAEE + K G VPDP+STDN EFQIVL
Sbjct  125  LDWGTGGGPDLIVDDGGDATLLIHEGVKAEEVFEKTGQVPDPNSTDNPEFQIVL  178



>gb|AIG62188.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62158.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62173.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>emb|CDX77483.1| BnaA07g06210D [Brassica napus]
Length=460

 Score =   312 bits (800),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVL  178



>gb|AIG62187.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62150.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62153.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62169.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62148.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62175.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AIG62192.1| S-adenosyl-L-homocysteine hydrolase [Populus alba x Populus glandulosa]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62179.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>ref|XP_008222807.1| PREDICTED: adenosylhomocysteinase isoform X1 [Prunus mume]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVL  178



>gb|AIG62180.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AGV54286.1| adenosylhomocysteinase [Phaseolus vulgaris]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPTSTDNAEFQIVL  178



>ref|NP_001234012.1| adenosylhomocysteinase [Solanum lycopersicum]
 sp|Q9SWF5.1|SAHH_SOLLC RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Solanum lycopersicum]
 gb|AAD50775.1|AF161705_1 S-adenosyl-l-homocysteine hydrolase [Solanum lycopersicum]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA RAEFGPSQP KGA+IT SLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRAEFGPSQPVKGAKITCSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTA LIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAFLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AKNGTVPDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKNGTVPDPTSTDNVEFQLVL  178



>ref|XP_010247578.1| PREDICTED: adenosylhomocysteinase [Nelumbo nucifera]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            V+KTSSGREYKVKDMSQADFGRLE++LAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTSSGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEE+ K G  PDPSST+NAEFQIVL
Sbjct  125  LDWGPSGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKFPDPSSTNNAEFQIVL  178



>gb|AHA84211.1| S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris]
Length=485

 Score =   313 bits (802),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKTTTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELFEKTGELPDPASTDNAEFQIVL  178



>ref|XP_007222610.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
 gb|EMJ23809.1| hypothetical protein PRUPE_ppa004934mg [Prunus persica]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVL  178



>gb|AGX26683.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AIG62185.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYDKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62159.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>ref|XP_006848518.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
 gb|ERN10099.1| hypothetical protein AMTR_s00013p00261120 [Amborella trichopoda]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+ST N EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTTNPEFQIVL  178



>gb|AIG62151.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKV+DMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVEDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62152.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEVELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AGX26651.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26646.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26648.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26658.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26659.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26668.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26670.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26675.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26680.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26688.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26663.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>ref|XP_008803686.1| PREDICTED: adenosylhomocysteinase [Phoenix dactylifera]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACR+E+GPSQPFKGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRSEYGPSQPFKGARISGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERC  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            L+WGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL
Sbjct  125  LEWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVL  178



>gb|AGX26674.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGW81844.1| S-(5'-adenosyl)-l-homocysteine hydrolase A [Populus tomentosa]
 gb|AGX26660.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26652.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26672.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26647.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AFZ78657.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
 gb|AGX26645.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26669.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26650.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|ABI95857.1| S-adenosyl-homocysteine hydrolase [Nicotiana suaveolens]
Length=485

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 170/174 (98%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFG LE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGGLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVF  +GETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFRVEGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLI+EGVKAEEE+AKNGT+PDP+STDNAEFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIYEGVKAEEEFAKNGTIPDPNSTDNAEFQLVL  178



>gb|AGX26684.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26678.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26666.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   313 bits (801),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26664.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26655.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26682.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26661.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>dbj|BAE71233.1| putative adenosylhomocysteinase [Trifolium pratense]
 dbj|BAE71257.1| putative adenosylhomocysteinase [Trifolium pratense]
Length=485

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            TVEKT++GREYKVKD+SQADFGRLE+ELAE+EMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    TVEKTTAGREYKVKDLSQADFGRLEIELAEIEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDPSSTDN EFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEELYEKTGEVPDPSSTDNVEFQLVL  178



>gb|AGX26685.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   312 bits (800),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>ref|XP_006421018.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
 gb|ESR34258.1| hypothetical protein CICLE_v10004852mg [Citrus clementina]
Length=485

 Score =   312 bits (800),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +V+K++SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGA+ITGSLHM
Sbjct  4    SVQKSASGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTEK  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGKLPDPASTDNAEFQIVL  178



>gb|AIG62182.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   312 bits (800),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDL VDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLTVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|ADR30776.1| S-adenosyl-L-homocysteine hydrolase [Cucumis sativus]
Length=485

 Score =   312 bits (800),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT++GRE KVKDMSQADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTAAGRENKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGALPDPASTDNAEFQIVL  178



>ref|XP_002300147.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|EEE84952.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   312 bits (800),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G  PDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGASPDPASTDNAEFQIVL  178



>gb|AAK92718.1| putative S-adenosyl-L-homocysteinas protein [Arabidopsis thaliana]
Length=485

 Score =   312 bits (800),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVL  178



>gb|AIG62176.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   312 bits (800),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGP+QPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPAQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AGX26679.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   312 bits (799),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLL+HEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLVHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26676.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   312 bits (799),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            +QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   VQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>ref|NP_189023.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
 sp|Q9LK36.1|SAHH2_ARATH RecName: Full=Adenosylhomocysteinase 2; Short=AdoHcyase 2; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase 1; AltName: 
Full=SAH hydrolase 2 [Arabidopsis thaliana]
 dbj|BAB01858.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAL24370.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAM13384.1| S-adenosyl L-homocystein hydrolase [Arabidopsis thaliana]
 gb|AAN12996.1| putative S-adenosyl-L-homocysteinase [Arabidopsis thaliana]
 gb|AEE76817.1| adenosylhomocysteinase 2 [Arabidopsis thaliana]
Length=485

 Score =   312 bits (799),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AKNGT PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVL  178



>ref|XP_009102577.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   312 bits (799),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPF GARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPFTGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPTSTDNPEFQIVL  178



>ref|XP_008794647.1| PREDICTED: adenosylhomocysteinase-like [Phoenix dactylifera]
Length=485

 Score =   312 bits (799),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            V KTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+EFGPSQP KGARI+GSLHMT
Sbjct  5    VGKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEFGPSQPLKGARISGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSVAVFAWKGETLQEYWWCTERC  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVL  178



>gb|AGX26649.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGV+AEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVRAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AAO72664.1| wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica 
Group]
 gb|EAY80818.1| hypothetical protein OsI_35998 [Oryza sativa Indica Group]
 gb|EEE52055.1| hypothetical protein OsJ_33804 [Oryza sativa Japonica Group]
 gb|AIR95993.1| adenosylhomocysteinase [Oryza sativa Japonica Group]
Length=485

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVL
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVL  178



>gb|AIG62190.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDA LLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDAALLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>ref|XP_002987608.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
 ref|XP_002987645.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11220.1| hypothetical protein SELMODRAFT_269302 [Selaginella moellendorffii]
 gb|EFJ11444.1| hypothetical protein SELMODRAFT_158886 [Selaginella moellendorffii]
Length=485

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGARITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGE LQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGENLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWG GGGPDLIVDDGGDATLLIHEGVKAE+E+ KNGT+PDPSST N EFQIVL
Sbjct  124  ALDWGVGGGPDLIVDDGGDATLLIHEGVKAEKEFEKNGTLPDPSSTTNQEFQIVL  178



>gb|KJB37873.1| hypothetical protein B456_006G223900 [Gossypium raimondii]
Length=485

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVL  178



>ref|XP_004502244.1| PREDICTED: adenosylhomocysteinase-like [Cicer arietinum]
Length=485

 Score =   311 bits (798),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y KNG +PDPSSTDNAEFQI+L
Sbjct  125  LDWGPTGGPDLIVDDGGDVTLLIHEGVKAEELYEKNGQLPDPSSTDNAEFQIIL  178



>gb|AFW60834.1| adenosyl homocysteine hydrolase1 [Zea mays]
Length=259

 Score =   303 bits (777),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG  GGPDLIVDDGGDATLLIHEGVKAEE+Y K G +PDP STDNAEF+IVL
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEDYEKTGKIPDPESTDNAEFKIVL  178



>gb|KHG10896.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACR EFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRTEFGPAQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEEVYEKTGQLPDPASTDNAEFQIVL  178



>gb|AGX26654.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQA+FGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQANFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>emb|CAJ01707.1| putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. 
vulgare]
 dbj|BAJ88218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVL
Sbjct  124  CLDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVL  178



>gb|ACN40278.1| unknown [Picea sitchensis]
Length=485

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/173 (93%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +2

Query  98   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVL  178



>gb|ABR16547.1| unknown [Picea sitchensis]
 gb|ABR18363.1| unknown [Picea sitchensis]
Length=485

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/173 (93%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +2

Query  98   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVL  178



>emb|CCC55421.1| S-adenosyl-L-homocysteine hydrolase [Pinus pinaster]
Length=485

 Score =   311 bits (797),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 168/173 (97%), Gaps = 0/173 (0%)
 Frame = +2

Query  98   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
            EKT SGRE+KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
            QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP+ST N EFQ+VL
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPASTTNLEFQMVL  178



>gb|ABR17322.1| unknown [Picea sitchensis]
Length=485

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/173 (93%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +2

Query  98   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVL  178



>gb|ABR16573.1| unknown [Picea sitchensis]
Length=485

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/173 (93%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +2

Query  98   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            DWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL
Sbjct  126  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVL  178



>ref|XP_008222808.1| PREDICTED: adenosylhomocysteinase isoform X2 [Prunus mume]
Length=547

 Score =   313 bits (801),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 171/175 (98%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK+SSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKSSSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP+STDN EFQ+VL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKLPDPASTDNQEFQLVL  178



>gb|AIG62174.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVL ETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLTETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>ref|XP_006418835.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
 gb|ESQ37271.1| hypothetical protein EUTSA_v10002505mg [Eutrema salsugineum]
Length=485

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G  PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQFPDPTSTDNPEFQIVL  178



>gb|AGX26687.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAW+GETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWEGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AIG62163.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+IT SLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITDSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AGX26656.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTA LIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAALIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>emb|CDP15078.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 162/175 (93%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQP KGARITGSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPLKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGA VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGASVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDPSST+NAEFQIVL
Sbjct  124  ALDWGSEGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTENAEFQIVL  178



>ref|XP_006373090.1| adenosylhomocysteinase family protein [Populus trichocarpa]
 gb|ABK96105.1| unknown [Populus trichocarpa]
 gb|ERP50887.1| adenosylhomocysteinase family protein [Populus trichocarpa]
Length=485

 Score =   311 bits (796),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGR YKVKD+SQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGRAYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>ref|XP_002883461.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59720.1| S-adenosyl-L-homocysteine (sah) hydrolase 2 [Arabidopsis lyrata 
subsp. lyrata]
Length=485

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++CR EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTFPDPTSTDNPEFQIVL  178



>gb|AIG62168.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLH T
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHTT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AIG62186.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   310 bits (795),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGA VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAGVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|AGX26686.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDW PGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWSPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26657.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            +QTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   VQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPSGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AAM19782.1| AT3g23810/MYM9_15 [Arabidopsis thaliana]
Length=485

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAE  +AKNGT PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEAIFAKNGTFPDPTSTDNPEFQIVL  178



>gb|AHL20280.1| S-adenosylhomocysteine hydrolase [Kalanchoe daigremontiana]
Length=485

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR+EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRSEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFS+QDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLI DDGGDA++LIHEGVKAEEE+AKNGTVPDP ST N +FQIVL
Sbjct  125  LDWGPSGGPDLIFDDGGDASMLIHEGVKAEEEFAKNGTVPDPHSTTNPDFQIVL  178



>gb|AGX26677.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPG M+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGSMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26671.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQ HAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQGHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|ABR16138.1| unknown [Picea sitchensis]
Length=485

 Score =   310 bits (793),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +2

Query  98   EKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTI  277
            EKT SGREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGARITGSLHMTI
Sbjct  6    EKTVSGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGARITGSLHMTI  65

Query  278  QTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERAL  457
            QTAVLIETL ALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERAL
Sbjct  66   QTAVLIETLAALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERAL  125

Query  458  DWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            DWGPGGGPDLIV+DGGDATLLIHEGVKAEEE+AK G VPDP ST N EFQ+VL
Sbjct  126  DWGPGGGPDLIVNDGGDATLLIHEGVKAEEEFAKTGKVPDPESTTNLEFQMVL  178



>ref|XP_004296983.1| PREDICTED: adenosylhomocysteinase [Fragaria vesca subsp. vesca]
Length=485

 Score =   310 bits (793),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 161/175 (92%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEK SSGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R EFGPSQPFKGARITGSLHM
Sbjct  4    SVEKHSSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRVEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDP+STDNAEFQIVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIFEKTGQLPDPTSTDNAEFQIVL  178



>gb|AGX26673.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   310 bits (793),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDAT LIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATPLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGX26653.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   309 bits (792),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGR YKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGRGYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>emb|CDY53211.1| BnaC03g74050D [Brassica napus]
Length=476

 Score =   309 bits (792),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 162/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCCTEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G VPDPSSTDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQVPDPSSTDNPEFQIVL  178



>ref|XP_004973012.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   309 bits (792),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K G VPDP STDNAEF+IVL
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKVPDPESTDNAEFKIVL  178



>gb|KJB28098.1| hypothetical protein B456_005G027700 [Gossypium raimondii]
Length=485

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +V+KTS GREYKVKDMSQADFGRLE++LAEVEMPGLMACR EFGPSQPFKGARITGSLHM
Sbjct  4    SVDKTSGGREYKVKDMSQADFGRLEIDLAEVEMPGLMACRTEFGPSQPFKGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARDSA+VFAWKGETLQEYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAVIARDSASVFAWKGETLQEYWWCTEK  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            +LDWG GGGPDLIVDDGGD T+LIHEGVKAEE Y K G VPDP+S+DNAEFQIVL
Sbjct  124  SLDWGAGGGPDLIVDDGGDVTMLIHEGVKAEEAYEKTGKVPDPTSSDNAEFQIVL  178



>ref|XP_004953493.1| PREDICTED: adenosylhomocysteinase-like [Setaria italica]
Length=485

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR EFGPSQPF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRTEFGPSQPFAGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K+G +PDP STDNAEF+IVL
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKIPDPESTDNAEFKIVL  178



>gb|AGX26665.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWW TERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWSTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|AGT16642.1| Adenosylhomocysteinase [Saccharum hybrid cultivar R570]
Length=485

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP STDNAEF+IVL
Sbjct  124  CLDWGEGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKIPDPESTDNAEFKIVL  178



>sp|Q9SP37.1|SAHH_LUPLU RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Lupinus luteus]
 gb|AAD56048.1|AF185635_1 S-adenosyl-L-homocysteinase [Lupinus luteus]
Length=485

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL
Sbjct  125  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVL  178



>gb|AGX26667.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFG SQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGLSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>sp|P50246.1|SAHH_MEDSA RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Medicago sativa]
 gb|AAB41814.1| adenosylhomocysteinase [Medicago sativa]
Length=485

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDPSSTDNAE QIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVL  178



>gb|AIG62170.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCS NIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSRNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>pdb|3OND|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3OND|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenosine
 pdb|3ONE|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONE|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Adenine
 pdb|3ONF|A Chain A, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
 pdb|3ONF|B Chain B, Crystal Structure Of Lupinus Luteus S-adenosyl-l-homocysteine 
Hydrolase In Complex With Cordycepin
Length=488

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLMA R+EFGPSQPFKGA+ITGSLHMT
Sbjct  8    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMASRSEFGPSQPFKGAKITGSLHMT  67

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  68   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  127

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE Y K+G  PDP STDNAEF+IVL
Sbjct  128  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIYEKSGQFPDPDSTDNAEFKIVL  181



>gb|AGX26662.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMFCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVD GGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDGGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>ref|XP_010512939.1| PREDICTED: adenosylhomocysteinase 2-like [Camelina sativa]
Length=485

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT+PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTLPDPTSTDNPEFQIVL  178



>gb|AGX26681.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LD GPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDRGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>ref|XP_009403608.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
             VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLM+CRAEFGPSQPF GARITGSLHM
Sbjct  4    VVEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMSCRAEFGPSQPFAGARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWGP GGPDLIVDDGGDATLLIHEGVKAEEE+ K G +PDP+STDNAEFQIVL
Sbjct  124  CLDWGPTGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKLPDPASTDNAEFQIVL  178



>ref|XP_010466740.1| PREDICTED: adenosylhomocysteinase 2-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT+PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTLPDPTSTDNPEFQIVL  178



>gb|AGX26689.1| S-adenosyl-l-homocysteine hydrolase A [Populus tomentosa]
Length=485

 Score =   308 bits (789),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGS HMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSFHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEV WCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVPWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE Y K G +PDP+STDN EFQ+VL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGVLPDPASTDNVEFQLVL  178



>gb|EMT01272.1| Adenosylhomocysteinase [Aegilops tauschii]
Length=485

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLEL+LAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELDLAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVL
Sbjct  124  CLDWGAGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVL  178



>dbj|BAP47516.1| S-adenosylhomocysteine hydrolase [Gentiana triflora]
Length=485

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            V+KT++GREYKVKDMSQADFGRLE+ELAEVEMPGLM+ R EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTTTGREYKVKDMSQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAA +ARD AAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAATIARDCAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEEE+  +GT+PDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDTTLLIHEGVKAEEEFKTSGTMPDPNSTDNAEFQIVL  178



>ref|XP_009413566.1| PREDICTED: adenosylhomocysteinase-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIE+LTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER 
Sbjct  65   IQTAVLIESLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPASTDNAEFQIVL  178



>ref|XP_010488460.1| PREDICTED: adenosylhomocysteinase 2 [Camelina sativa]
Length=485

 Score =   308 bits (788),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCITEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K GT PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGTFPDPTSTDNPEFQIVL  178



>ref|XP_003538528.1| PREDICTED: adenosylhomocysteinase-like [Glycine max]
Length=485

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDM+QADFGRLE+ELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMTQADFGRLEIELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G  PDP+S+DNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDTTLLIHEGVKAEEIFEKTGQFPDPASSDNAEFQIVL  178



>ref|XP_009415939.1| PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis]
Length=485

 Score =   307 bits (787),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTS+GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP++PF GARI+GSLHMT
Sbjct  5    VEKTSTGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPAKPFAGARISGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL EYWWCTER 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLAEYWWCTERC  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGPNGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPASTDNAEFQIVL  178



>gb|ACJ11250.1| S-adenosyl-L-homocystein hydrolase [Gossypium hirsutum]
Length=485

 Score =   307 bits (786),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT++GREYKVKDMSQADFGRLE+ELAEVEMPGLMACRAEFGP+QPFKGA+ITGSLHM
Sbjct  4    SVEKTAAGREYKVKDMSQADFGRLEIELAEVEMPGLMACRAEFGPAQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+A DSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIAHDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ Y K G +PDPSSTDNAEFQIVL
Sbjct  124  ALDWGPTGGPDLIVDDGGDATLLIHEGVKAEQVYEKTGQLPDPSSTDNAEFQIVL  178



>ref|NP_001265954.1| adenosylhomocysteinase-like [Cicer arietinum]
 emb|CAI56440.1| S-adenosyl-L-homocysteine hydrolase [Cicer arietinum]
Length=485

 Score =   307 bits (786),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT++GREYKVKD+SQADFGRLE+ELAE+EMPGL++ R EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTNTGREYKVKDLSQADFGRLEIELAEIEMPGLISSRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGD TLLIHEGVKAEE + K G VPDPSSTDNAEFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDVTLLIHEGVKAEELFEKTGEVPDPSSTDNAEFQIVL  178



>gb|AIG62177.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   306 bits (785),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGA+ITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQD AAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|EPS72602.1| adenosylhomocysteinase, partial [Genlisea aurea]
Length=567

 Score =   309 bits (792),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT++GRE+KVKDMSQADFGRLE+ELAEVEMPGLM+ R+EFGPSQPFKGARITGSLHMT
Sbjct  87   VEKTTAGREFKVKDMSQADFGRLEIELAEVEMPGLMSSRSEFGPSQPFKGARITGSLHMT  146

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  147  IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  206

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAE EY K G +PDP+STDNAEFQ+VL
Sbjct  207  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEAEYEKTGKLPDPNSTDNAEFQLVL  260



>ref|NP_001148534.1| adenosylhomocysteinase [Zea mays]
 gb|ACG31873.1| adenosylhomocysteinase [Zea mays]
Length=485

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP STDNAEF+IVL
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKIPDPESTDNAEFKIVL  178



>ref|XP_010913095.1| PREDICTED: adenosylhomocysteinase-like [Elaeis guineensis]
Length=485

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACR+E+GPSQP KGARI+GSLHMT
Sbjct  5    VEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRSEYGPSQPLKGARISGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTE+ 
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTEQC  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWG  GGPDLIVDDGGDATLLIHEGVKAEEEY K G +PDP+STDNAEFQIVL
Sbjct  125  LDWGAAGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKMPDPASTDNAEFQIVL  178



>gb|AIG62161.1| S-adenosyl-L-homocysteine hydrolase [Populus tomentosa]
Length=485

 Score =   306 bits (785),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKT+SGREYKVKDMSQADFGRLE+ELAE EMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VEKTTSGREYKVKDMSQADFGRLEIELAEAEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQD AAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDRAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K G VPDP+STDNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGAVPDPASTDNAEFQIVL  178



>gb|KFK39678.1| hypothetical protein AALP_AA3G275000 [Arabis alpina]
Length=485

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE + K G  PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFEKTGVFPDPTSTDNPEFQIVL  178



>sp|P32112.1|SAHH_WHEAT RecName: Full=Adenosylhomocysteinase; Short=AdoHcyase; AltName: 
Full=S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
 gb|AAA34303.1| S-adenosyl-L-homocysteine hydrolase [Triticum aestivum]
Length=485

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+ QADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLFQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFS+QDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSSQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDN EF+IVL
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNPEFKIVL  178



>emb|CDY50106.1| BnaC01g43540D [Brassica napus]
 emb|CDY18090.1| BnaA01g23510D [Brassica napus]
Length=508

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/174 (92%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLIVDDGGDATLLIHEGVKAEE +AK G +PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEIFAKTGQLPDPTSTDNPEFQIVL  178



>ref|XP_003601687.1| Adenosylhomocysteinase [Medicago truncatula]
 gb|AAO89238.1| adenosylhomocysteinase [Medicago truncatula]
 gb|AES71938.1| S-adenosyl-L-homocysteine hydrolase [Medicago truncatula]
Length=485

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VE T+SGREYKVKDMSQADFGRLE+ELAEVEMPGLM+CR EFGPSQPFKGARITGSLHMT
Sbjct  5    VETTTSGREYKVKDMSQADFGRLEIELAEVEMPGLMSCRTEFGPSQPFKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWC+ERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCSERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWG GGGPDLIVDDGGD TLLIHEGVKAEE + K G +PDPSSTDNAE QIVL
Sbjct  125  LDWGTGGGPDLIVDDGGDVTLLIHEGVKAEEVFEKTGQLPDPSSTDNAEMQIVL  178



>ref|XP_001755906.1| predicted protein [Physcomitrella patens]
 gb|EDQ79191.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVL
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDAYAKDGTLPDPESTTNAEFKIVL  178



>ref|XP_003577583.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Brachypodium 
distachyon]
Length=485

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLELELAEVEMPGLMACR EFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLELELAEVEMPGLMACRTEFGPSQPFKGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSC IFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCXIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K+G +PDP STDN EF+IVL
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKIPDPESTDNPEFKIVL  178



>gb|ACN34730.1| unknown [Zea mays]
 gb|AFW60832.1| adenosyl homocysteine hydrolase1 isoform 1 [Zea mays]
 gb|AFW60833.1| adenosyl homocysteine hydrolase1 isoform 2 [Zea mays]
Length=485

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPS+PF GARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSKPFAGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG  GGPDLIVDDGGDATLLIHEGVKAEE+Y K G +PDP STDNAEF+IVL
Sbjct  124  CLDWGEAGGPDLIVDDGGDATLLIHEGVKAEEDYEKTGKIPDPESTDNAEFKIVL  178



>ref|XP_009106322.1| PREDICTED: adenosylhomocysteinase 2 [Brassica rapa]
Length=485

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMSQADFGRLE+ELAEVEMPGL++C  EFGPSQP KGARITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCVTEFGPSQPLKGARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGPGGGPDLI DDGGDATLLIHEGVKAEE +AK G +PDP+STDN EFQIVL
Sbjct  125  LDWGPGGGPDLIGDDGGDATLLIHEGVKAEEIFAKTGQLPDPTSTDNPEFQIVL  178



>ref|XP_001755926.1| predicted protein [Physcomitrella patens]
 gb|EDQ79211.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVL
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDVYAKDGTLPDPESTTNAEFKIVL  178



>ref|XP_006662925.1| PREDICTED: adenosylhomocysteinase-like [Oryza brachyantha]
Length=485

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 159/175 (91%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKTSSGREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHM
Sbjct  4    SVEKTSSGREYKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWW TER
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWGTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
             LDWG GGGPDLIVDDGGDATLLIHEGVKAEEE+ K G VP+P STDNAEF+IVL
Sbjct  124  CLDWGVGGGPDLIVDDGGDATLLIHEGVKAEEEFEKTGKVPNPDSTDNAEFKIVL  178



>ref|XP_008438321.1| PREDICTED: adenosylhomocysteinase-like [Cucumis melo]
Length=485

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GPSQPFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPSQPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGDATLLIHEGVKAEE Y K GT+PDPSST N+E QIV 
Sbjct  125  LDWGPEGGPDLIVDDGGDATLLIHEGVKAEEIYEKTGTLPDPSSTTNSELQIVF  178



>ref|XP_001755929.1| predicted protein [Physcomitrella patens]
 gb|EDQ79214.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   301 bits (772),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            +VEKT+SGREYKV+DMSQADFGRLEL+LAEVEMPGLM+CR EFG +QPFKGA+ITGSLHM
Sbjct  4    SVEKTASGREYKVRDMSQADFGRLELDLAEVEMPGLMSCRTEFGAAQPFKGAKITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLI+TLT LGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER
Sbjct  64   TIQTAVLIDTLTDLGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTER  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGP GGPDLIVDDGGDATLLIHEGVKAE+ YAK+GT+PDP ST NAEF+IVL
Sbjct  124  ALDWGPDGGPDLIVDDGGDATLLIHEGVKAEDVYAKDGTLPDPESTTNAEFKIVL  178



>ref|XP_007163813.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
 gb|ESW35807.1| hypothetical protein PHAVU_001G266500g [Phaseolus vulgaris]
Length=485

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            VEKTSSGREYKVKDMS ADFGR+E+ELAEVEMPGL++CR EFG SQPFKG RITGSLHMT
Sbjct  5    VEKTSSGREYKVKDMSLADFGRMEIELAEVEMPGLISCRTEFGSSQPFKGTRITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERA
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGD TLLIHEGVKAE+ + K G  PDPSS+DNAEFQIVL
Sbjct  125  LDWGPDGGPDLIVDDGGDTTLLIHEGVKAEQVFEKTGQSPDPSSSDNAEFQIVL  178



>gb|AAL33588.1| S-adenosyl-L-homocysteine hydrolase [Zea mays]
Length=232

 Score =   291 bits (744),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 150/158 (95%), Positives = 157/158 (99%), Gaps = 0/158 (0%)
 Frame = +2

Query  143  QADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAE  322
            QADFGRLE+ELAEVEMPGLMACR EFGPSQPFKGA+ITGSLHMTIQTAVLIETLTALGAE
Sbjct  1    QADFGRLEIELAEVEMPGLMACRTEFGPSQPFKGAKITGSLHMTIQTAVLIETLTALGAE  60

Query  323  VRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVDDG  502
            VRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDG
Sbjct  61   VRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDG  120

Query  503  GDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            GDATLLIHEGVKAEEE+AKNGT+PDP+STDNAEFQ+VL
Sbjct  121  GDATLLIHEGVKAEEEFAKNGTIPDPNSTDNAEFQLVL  158



>ref|XP_004133979.1| PREDICTED: adenosylhomocysteinase-like [Cucumis sativus]
 gb|KGN56709.1| hypothetical protein Csa_3G129660 [Cucumis sativus]
Length=485

 Score =   296 bits (759),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y K GT+PDPSST N+E QIV 
Sbjct  125  LDWGPEGGPDLIVDDGGDVTLLIHEGVKAEEIYEKTGTLPDPSSTTNSELQIVF  178



>ref|XP_004166113.1| PREDICTED: LOW QUALITY PROTEIN: adenosylhomocysteinase-like [Cucumis 
sativus]
Length=485

 Score =   296 bits (759),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 152/174 (87%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            V+KTS+GREYKVKDM+QADFGRLE++LAEVEMPGLMACR E+GP+ PFKGA+ITGSLHMT
Sbjct  5    VDKTSTGREYKVKDMAQADFGRLEIDLAEVEMPGLMACRTEYGPALPFKGAKITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTER+
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERS  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            LDWGP GGPDLIVDDGGD TLLIHEGVKAEE Y K GT+PDPSST N+E QIV 
Sbjct  125  LDWGPEGGPDLIVDDGGDVTLLIHEGVKAEEIYEKXGTLPDPSSTTNSELQIVF  178



>gb|KJB19538.1| hypothetical protein B456_003G108500 [Gossypium raimondii]
Length=485

 Score =   296 bits (758),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 168/175 (96%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            TV +T++GRE+KVKD++QADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4    TVSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTEK  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            ALDWGPGGGPDLIVDDGGDATLLIHEG KAEEEY ++G +P+P+ T+NAEF+IVL
Sbjct  124  ALDWGPGGGPDLIVDDGGDATLLIHEGAKAEEEYERSGKLPNPNETENAEFRIVL  178



>ref|XP_007037836.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
 gb|EOY22337.1| S-adenosyl-L-homocysteine hydrolase [Theobroma cacao]
Length=485

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = +2

Query  92   TVEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHM  271
            T+ +T +GREYKVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHM
Sbjct  4    TISRTPTGREYKVKDISQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKDARITGSLHM  63

Query  272  TIQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTER  451
            TIQTAVLIETLTALGA+VRWCSCNIFSTQDHAAAA+ARDSA+VFAWKGETL+EYWWCTE+
Sbjct  64   TIQTAVLIETLTALGAQVRWCSCNIFSTQDHAAAAIARDSASVFAWKGETLEEYWWCTEK  123

Query  452  ALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            AL+WGPGGGPDLIVDDGGDATLLIHEGVKAEE Y ++G +P+P+ T+NAEF+IVL
Sbjct  124  ALEWGPGGGPDLIVDDGGDATLLIHEGVKAEEVYERSGKLPNPNETENAEFRIVL  178



>gb|KHG19993.1| Adenosylhomocysteinase 1 -like protein [Gossypium arboreum]
Length=485

 Score =   295 bits (754),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/174 (85%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +2

Query  95   VEKTSSGREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMT  274
            V +T++GRE+KVKD++QADFGRLE+ELAEVEMPGLMACRAEFGP+QP K ARITGSLHMT
Sbjct  5    VSRTATGREFKVKDIAQADFGRLEIELAEVEMPGLMACRAEFGPTQPLKEARITGSLHMT  64

Query  275  IQTAVLIETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERA  454
            IQTAVLIETLTALGAEVRWCSCNIFSTQDHAA+A+ARDSAAVFAWKGETL+EYWWCTE+A
Sbjct  65   IQTAVLIETLTALGAEVRWCSCNIFSTQDHAASAIARDSAAVFAWKGETLEEYWWCTEKA  124

Query  455  LDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            L+WGPGGGPDLIVDDGGDATLLIHEGVKAE EY ++G +P+P+ T+NAEFQIVL
Sbjct  125  LEWGPGGGPDLIVDDGGDATLLIHEGVKAEGEYERSGKLPNPNETENAEFQIVL  178



>gb|AFY99087.1| S-adenosyl-l-homocysteine hydrolase, partial [Campanula persicifolia]
Length=202

 Score =   284 bits (727),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 153/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  137  MSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  316
            MS ADFGRLELELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMTIQT VLIETLTALG
Sbjct  1    MSLADFGRLELELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALG  60

Query  317  AEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVD  496
            AEVRWCSCNIFSTQDHAAAA+ARDS AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  61   AEVRWCSCNIFSTQDHAAAAIARDSCAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  120

Query  497  DGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            DGGDATLLIHEGVKAEEE+ K+G VPDP+STDNAEFQIVL
Sbjct  121  DGGDATLLIHEGVKAEEEFEKSGAVPDPASTDNAEFQIVL  160



>ref|NP_001067845.2| Os11g0455500 [Oryza sativa Japonica Group]
 dbj|BAF28208.2| Os11g0455500, partial [Oryza sativa Japonica Group]
Length=515

 Score =   294 bits (752),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/168 (90%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +2

Query  113  GREYKVKDMSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVL  292
            G  +KVKD+SQADFGRLE+ELAEVEMPGLMACRAEFGPSQPFKGARI+GSLHMTIQTAVL
Sbjct  41   GGSFKVKDLSQADFGRLEIELAEVEMPGLMACRAEFGPSQPFKGARISGSLHMTIQTAVL  100

Query  293  IETLTALGAEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPG  472
            IETLTALGAEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETL+EYWWCTER LDWG G
Sbjct  101  IETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLEEYWWCTERCLDWGVG  160

Query  473  GGPDLIVDDGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            GGPDLIVDDGGDATLLIHEGVKAEEE+ K+G VPDP STDNAEF+IVL
Sbjct  161  GGPDLIVDDGGDATLLIHEGVKAEEEFEKSGKVPDPESTDNAEFKIVL  208



>gb|AFY99082.1| S-adenosyl-l-homocysteine hydrolase, partial [Clermontia kakeana]
 gb|AFY99083.1| S-adenosyl-l-homocysteine hydrolase, partial [Clermontia arborescens 
subsp. waihiae]
 gb|AFY99084.1| S-adenosyl-l-homocysteine hydrolase, partial [Clermontia fauriei]
 gb|AFY99085.1| S-adenosyl-l-homocysteine hydrolase, partial [Cyanea asplenifolia]
Length=202

 Score =   283 bits (723),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 149/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = +2

Query  137  MSQADFGRLELELAEVEMPGLMACRAEFGPSQPFKGARITGSLHMTIQTAVLIETLTALG  316
            MS ADFGRLELELAEVEMPGLM+ R EFGPSQPFKGARITGSLHMTIQT VLIETLTALG
Sbjct  1    MSLADFGRLELELAEVEMPGLMSSRTEFGPSQPFKGARITGSLHMTIQTGVLIETLTALG  60

Query  317  AEVRWCSCNIFSTQDHaaaavardsaavfaWKGETLQEYWWCTERALDWGPGGGPDLIVD  496
            AEVRWCSCNIFSTQDHAAAA+ARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
Sbjct  61   AEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD  120

Query  497  DGGDATLLIHEGVKAEEEYAKNGTVPDPSSTDNAEFQIVL  616
            DGGDATLLIHEGVKAEEEY K+G +PDP+STDNAEFQIVL
Sbjct  121  DGGDATLLIHEGVKAEEEYEKSGALPDPTSTDNAEFQIVL  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090