BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF042C12

Length=648
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDY71259.1|  BnaAnng36730D                                          224   1e-68   Brassica napus [oilseed rape]
emb|CDY55729.1|  BnaC08g46150D                                          227   5e-68   Brassica napus [oilseed rape]
gb|AGV54793.1|  hypothetical protein                                    136   1e-67   Phaseolus vulgaris [French bean]
emb|CDY66372.1|  BnaAnng22160D                                          220   8e-66   Brassica napus [oilseed rape]
emb|CDY43697.1|  BnaC08g47040D                                          211   2e-64   Brassica napus [oilseed rape]
emb|CDY70240.1|  BnaCnng67370D                                          202   2e-61   Brassica napus [oilseed rape]
ref|XP_003627732.1|  ATP synthase subunit beta                          203   3e-56   
ref|XP_003638451.1|  hypothetical protein MTR_132s0010                98.6    2e-46   
ref|XP_003614382.1|  hypothetical protein MTR_5g050970                97.8    3e-46   
ref|XP_003614394.1|  hypothetical protein MTR_5g051130                97.8    4e-46   
ref|XP_003614395.1|  hypothetical protein MTR_5g051140                97.8    5e-46   
ref|XP_003614386.1|  hypothetical protein MTR_5g051030                97.1    1e-45   
ref|XP_003614383.1|  hypothetical protein MTR_5g051000                98.2    2e-45   
ref|XP_003614384.1|  hypothetical protein MTR_5g051010                97.1    2e-45   
gb|KFK40658.1|  hypothetical protein AALP_AA2G025000                    151   3e-40   Arabis alpina [alpine rockcress]
gb|KDO39226.1|  hypothetical protein CISIN_1g0366582mg                  143   1e-39   Citrus sinensis [apfelsine]
gb|EMD30335.1|  hypothetical protein CERSUDRAFT_61265                   137   3e-37   Gelatoporia subvermispora B
emb|CDY19789.1|  BnaA09g04420D                                          138   3e-35   Brassica napus [oilseed rape]
gb|ABO20854.1|  hypothetical protein                                    130   6e-35   Lilium longiflorum [Easter lily]
gb|EJY66653.1|  hypothetical protein OXYTRI_13058                       142   9e-35   Oxytricha trifallax
gb|EJY65597.1|  hypothetical protein OXYTRI_14248                       142   1e-34   Oxytricha trifallax
emb|CDW75723.1|  UNKNOWN                                                137   7e-33   Stylonychia lemnae
gb|EDY04083.1|  hypothetical protein G11MC16DRAFT_3625                92.4    7e-33   Geobacillus thermodenitrificans
gb|EGZ76045.1|  hypothetical protein NEUTE2DRAFT_35586                  124   8e-33   Neurospora tetrasperma FGSC 2509
ref|XP_003614393.1|  hypothetical protein MTR_5g051120                  129   1e-31   
ref|XP_002488951.1|  hypothetical protein SORBIDRAFT_1292s002010        120   2e-31   
ref|XP_002488946.1|  hypothetical protein SORBIDRAFT_1376s002010        119   7e-31   
gb|KEH17028.1|  hypothetical protein MTR_0052s0140                    99.8    8e-31   Medicago truncatula
ref|XP_003614397.1|  hypothetical protein MTR_5g051160                99.8    9e-31   
ref|XP_002488956.1|  hypothetical protein SORBIDRAFT_1211s002020        119   9e-31   
gb|ACR37398.1|  unknown                                                 117   2e-30   Zea mays [maize]
emb|CDS20307.1|  hypothetical protein EgrG_000335800                  88.6    4e-30   Echinococcus granulosus
gb|ELU05450.1|  hypothetical protein CAPTEDRAFT_103064                68.6    3e-29   Capitella teleta
ref|XP_003614387.1|  RRNA intron-encoded homing endonuclease          83.6    4e-27   
gb|KEH16994.1|  senescence-associated protein                         97.8    1e-26   Medicago truncatula
gb|KEH17022.1|  senescence-associated protein, putative               97.8    1e-26   Medicago truncatula
gb|KEH16991.1|  senescence-associated protein                         97.4    2e-26   Medicago truncatula
ref|XP_003614396.1|  hypothetical protein MTR_5g051150                  118   2e-26   
gb|KEH17027.1|  senescence-associated protein                         97.4    2e-26   Medicago truncatula
gb|KEH17020.1|  senescence-associated protein                         97.4    2e-26   Medicago truncatula
emb|CDY66173.1|  BnaAnng21760D                                          115   2e-26   Brassica napus [oilseed rape]
ref|XP_003614398.1|  hypothetical protein MTR_5g051170                  117   4e-26   
ref|XP_002488950.1|  hypothetical protein SORBIDRAFT_1303s002040        105   8e-26   
gb|KFK23449.1|  hypothetical protein AALP_AAs69095U000100               102   1e-24   Arabis alpina [alpine rockcress]
ref|XP_002488870.1|  hypothetical protein SORBIDRAFT_3036s002010        101   4e-24   
gb|KEH16988.1|  senescence-associated protein, putative               86.3    3e-23   Medicago truncatula
ref|XP_710281.1|  hypothetical protein CaO19.6835                     98.6    2e-22   
gb|KDP20462.1|  hypothetical protein JCGZ_06007                       98.6    2e-22   Jatropha curcas
ref|XP_005773285.1|  hypothetical protein EMIHUDRAFT_75086            94.0    3e-22   Emiliania huxleyi CCMP1516
ref|XP_007132739.1|  hypothetical protein PHAVU_011G120900g           95.9    1e-21   Phaseolus vulgaris [French bean]
ref|XP_002450733.1|  hypothetical protein SORBIDRAFT_05g016477        94.0    3e-21   
ref|XP_005792707.1|  hypothetical protein EMIHUDRAFT_77663            94.0    8e-21   Emiliania huxleyi CCMP1516
ref|XP_007413085.1|  hypothetical protein MELLADRAFT_90063            64.3    6e-20   Melampsora larici-populina 98AG31
ref|XP_007417441.1|  hypothetical protein MELLADRAFT_94740            64.3    7e-20   Melampsora larici-populina 98AG31
ref|XP_007411659.1|  hypothetical protein MELLADRAFT_88128            64.3    7e-20   Melampsora larici-populina 98AG31
gb|KEH17021.1|  senescence-associated protein                         97.8    2e-19   Medicago truncatula
gb|KIJ09669.1|  hypothetical protein PAXINDRAFT_177522                90.1    3e-19   Paxillus involutus ATCC 200175
ref|XP_007419459.1|  hypothetical protein MELLADRAFT_86114            63.9    4e-19   Melampsora larici-populina 98AG31
gb|EGN91295.1|  hypothetical protein SERLA73DRAFT_80747               90.1    8e-19   Serpula lacrymans var. lacrymans S7.3
gb|KDQ32287.1|  hypothetical protein PLEOSDRAFT_1074527               86.3    4e-18   Pleurotus ostreatus PC15
gb|KDQ32212.1|  hypothetical protein PLEOSDRAFT_49049                 86.3    4e-18   Pleurotus ostreatus PC15
gb|ELU05225.1|  hypothetical protein CAPTEDRAFT_108619                84.7    6e-18   Capitella teleta
gb|KIM34613.1|  hypothetical protein M413DRAFT_160682                 84.0    1e-17   Hebeloma cylindrosporum h7
gb|KEH17029.1|  senescence-associated protein                         91.3    2e-17   Medicago truncatula
ref|XP_001785975.1|  predicted protein                                84.0    2e-17   
emb|CDX99709.1|  BnaC02g36110D                                        87.0    2e-17   
ref|XP_004208964.1|  PREDICTED: uncharacterized protein LOC100197104  67.4    3e-17   
ref|XP_006279312.1|  hypothetical protein CARUB_v10012753mg           83.6    4e-17   
gb|KFZ88834.1|  hypothetical protein Thpro_03127                      84.0    5e-17   
ref|XP_007405670.1|  hypothetical protein MELLADRAFT_92511            51.6    2e-16   Melampsora larici-populina 98AG31
gb|EMD31866.1|  hypothetical protein CERSUDRAFT_162690                82.4    2e-16   Gelatoporia subvermispora B
ref|XP_009016464.1|  hypothetical protein HELRODRAFT_92454            67.8    3e-16   Helobdella robusta
ref|XP_007419023.1|  hypothetical protein MELLADRAFT_84531            51.6    3e-16   Melampsora larici-populina 98AG31
ref|XP_007415539.1|  hypothetical protein MELLADRAFT_92706            51.2    3e-16   Melampsora larici-populina 98AG31
ref|XP_007417426.1|  hypothetical protein MELLADRAFT_94723            51.2    5e-16   Melampsora larici-populina 98AG31
gb|ACG27665.1|  hypothetical protein                                  79.3    5e-16   Zea mays [maize]
ref|XP_007414632.1|  hypothetical protein MELLADRAFT_91701            50.8    5e-16   Melampsora larici-populina 98AG31
ref|XP_002489152.1|  hypothetical protein SORBIDRAFT_0016s002240      83.6    5e-16   
gb|KIK49843.1|  hypothetical protein GYMLUDRAFT_78612                 83.6    6e-16   Gymnopus luxurians FD-317 M1
ref|XP_007416288.1|  hypothetical protein MELLADRAFT_93283            50.8    7e-16   Melampsora larici-populina 98AG31
gb|AFK36149.1|  unknown                                               79.0    8e-16   Lotus japonicus
gb|ADI72904.1|  hypothetical protein                                  79.3    1e-15   Ophiocordyceps unilateralis
gb|KEH17348.1|  hypothetical protein MTR_0021s0160                    63.5    1e-15   Medicago truncatula
ref|XP_006405910.1|  hypothetical protein EUTSA_v10028284mg           79.3    1e-15   
ref|XP_007410495.1|  hypothetical protein MELLADRAFT_87416            50.8    2e-15   Melampsora larici-populina 98AG31
ref|XP_007682037.1|  hypothetical protein BAUCODRAFT_57269            78.2    2e-15   Baudoinia panamericana UAMH 10762
ref|XP_006455542.1|  hypothetical protein AGABI2DRAFT_121457          80.5    2e-15   Agaricus bisporus var. bisporus H97
ref|XP_006405917.1|  hypothetical protein EUTSA_v10028144mg           78.6    2e-15   
ref|XP_002488918.1|  hypothetical protein SORBIDRAFT_1836s002010      73.2    2e-15   
ref|XP_003851049.1|  hypothetical protein MYCGRDRAFT_45572            77.8    4e-15   Zymoseptoria tritici IPO323
dbj|GAA49464.1|  hypothetical protein CLF_103095                      77.4    4e-15   Clonorchis sinensis [oriental liver fluke]
gb|ETW38010.1|  hypothetical protein PFTANZ_01288                     77.4    6e-15   Plasmodium falciparum Tanzania (2000708)
gb|KIM92488.1|  hypothetical protein OIDMADRAFT_139572                77.4    7e-15   Oidiodendron maius Zn
ref|WP_037545229.1|  hypothetical protein                             76.6    8e-15   
gb|EME38016.1|  hypothetical protein DOTSEDRAFT_101619                75.9    1e-14   Dothistroma septosporum NZE10
ref|XP_007419020.1|  hypothetical protein MELLADRAFT_84525            45.4    2e-14   Melampsora larici-populina 98AG31
dbj|BAD46202.1|  hypothetical protein                                 63.2    3e-14   Oryza sativa Japonica Group [Japonica rice]
dbj|GAA96381.1|  hypothetical protein E5Q_03048                       75.5    4e-14   Mixia osmundae IAM 14324
gb|KEI39782.1|  hypothetical protein L969DRAFT_47306                  75.1    5e-14   Mixia osmundae IAM 14324
gb|EFX62989.1|  hypothetical protein DAPPUDRAFT_37179                 70.9    6e-14   Daphnia pulex
ref|XP_009846274.1|  hypothetical protein H257_18840                  76.6    9e-14   Aphanomyces astaci
ref|WP_029759542.1|  hypothetical protein                             73.6    1e-13   Fusobacterium nucleatum
ref|XP_011116925.1|  hypothetical protein H072_8238                   73.9    1e-13   
ref|XP_009030137.1|  hypothetical protein HELRODRAFT_70460            72.4    3e-13   Helobdella robusta
gb|EJU02318.1|  hypothetical protein DACRYDRAFT_51410                 72.0    3e-13   Dacryopinax primogenitus
gb|KFM56506.1|  hypothetical protein X975_24482                       73.6    3e-13   Stegodyphus mimosarum
ref|XP_007418897.1|  hypothetical protein MELLADRAFT_84215            58.2    4e-13   Melampsora larici-populina 98AG31
ref|XP_007405673.1|  hypothetical protein MELLADRAFT_92517            57.0    4e-13   Melampsora larici-populina 98AG31
ref|WP_032484877.1|  hypothetical protein                             72.0    4e-13   
gb|KDQ05627.1|  hypothetical protein BOTBODRAFT_122476                72.0    5e-13   Botryobasidium botryosum FD-172 SS1
gb|KGG52127.1|  hypothetical protein DI09_206p20                      73.6    6e-13   Mitosporidium daphniae
gb|AAX26869.1|  unknown                                               72.4    6e-13   Schistosoma japonicum
gb|KIM19404.1|  hypothetical protein M408DRAFT_231258                 71.2    7e-13   Serendipita vermifera MAFF 305830
ref|XP_001617522.1|  hypothetical protein NEMVEDRAFT_v1g157418        70.9    7e-13   Nematostella vectensis
ref|XP_007373419.1|  hypothetical protein SPAPADRAFT_134376           71.2    9e-13   Spathaspora passalidarum NRRL Y-27907
ref|XP_006676538.1|  hypothetical protein BATDEDRAFT_9655             71.6    1e-12   Batrachochytrium dendrobatidis JAM81
ref|WP_000385345.1|  hypothetical protein                             70.9    1e-12   
ref|XP_001383615.2|  hypothetical protein PICST_56758                 70.9    1e-12   Scheffersomyces stipitis CBS 6054
ref|WP_044794659.1|  hypothetical protein                             71.2    2e-12   
gb|KIL53776.1|  hypothetical protein M378DRAFT_293576                 70.1    2e-12   Amanita muscaria Koide BX008
ref|XP_003370414.1|  conserved hypothetical protein                   69.7    2e-12   Trichinella spiralis
ref|XP_001891749.1|  hypothetical protein Bm1_01160                   70.1    2e-12   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003368606.1|  conserved hypothetical protein                   69.7    2e-12   Trichinella spiralis
ref|XP_004154316.1|  PREDICTED: uncharacterized protein LOC101218508  71.2    2e-12   
ref|XP_003369888.1|  conserved hypothetical protein                   69.3    2e-12   Trichinella spiralis
ref|XP_003368880.1|  conserved hypothetical protein                   69.7    2e-12   Trichinella spiralis
ref|XP_003367735.1|  conserved hypothetical protein                   69.3    2e-12   Trichinella spiralis
gb|EMD30418.1|  hypothetical protein CERSUDRAFT_61186                 70.5    2e-12   Gelatoporia subvermispora B
ref|XP_001624571.1|  predicted protein                                70.1    3e-12   Nematostella vectensis
ref|XP_008045699.1|  hypothetical protein TRAVEDRAFT_137427           70.5    3e-12   Trametes versicolor FP-101664 SS1
gb|KIK72365.1|  hypothetical protein PAXRUDRAFT_47302                 69.3    3e-12   Paxillus rubicundulus Ve08.2h10
ref|XP_008037628.1|  hypothetical protein TRAVEDRAFT_121800           69.7    3e-12   Trametes versicolor FP-101664 SS1
gb|EQL27843.1|  hypothetical protein BDFG_09352                       70.1    3e-12   Blastomyces dermatitidis ATCC 26199
ref|XP_005644354.1|  hypothetical protein COCSUDRAFT_9899             68.9    4e-12   Coccomyxa subellipsoidea C-169
gb|KIN97676.1|  hypothetical protein M404DRAFT_159840                 68.9    4e-12   Pisolithus tinctorius Marx 270
gb|EMD30404.1|  hypothetical protein CERSUDRAFT_61201                 69.7    4e-12   Gelatoporia subvermispora B
gb|EGN91036.1|  hypothetical protein SERLA73DRAFT_81370               69.3    4e-12   Serpula lacrymans var. lacrymans S7.3
ref|XP_001635423.1|  predicted protein                                68.9    4e-12   Nematostella vectensis
gb|KDR65243.1|  hypothetical protein GALMADRAFT_82103                 69.7    4e-12   Galerina marginata CBS 339.88
gb|EMD30512.1|  hypothetical protein CERSUDRAFT_61093                 69.7    4e-12   Gelatoporia subvermispora B
ref|XP_002489033.1|  hypothetical protein SORBIDRAFT_0351s002020      68.9    4e-12   
ref|XP_002957133.1|  hypothetical protein VOLCADRAFT_38607            68.6    5e-12   Volvox carteri f. nagariensis
ref|XP_002477792.1|  predicted protein                                68.6    5e-12   
gb|KEI36423.1|  hypothetical protein L969DRAFT_55109                  68.9    7e-12   Mixia osmundae IAM 14324
emb|CAN73055.1|  hypothetical protein VITISV_007595                   72.8    9e-12   Vitis vinifera
ref|XP_001620119.1|  hypothetical protein NEMVEDRAFT_v1g149069        60.1    1e-11   Nematostella vectensis
ref|XP_009037534.1|  hypothetical protein AURANDRAFT_27183            67.8    1e-11   Aureococcus anophagefferens
ref|XP_007297914.1|  hypothetical protein MBM_10038                   71.6    1e-11   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_009550270.1|  hypothetical protein HETIRDRAFT_326154           68.2    1e-11   Heterobasidion irregulare TC 32-1
gb|EJK58440.1|  hypothetical protein THAOC_21442                      67.8    1e-11   Thalassiosira oceanica
ref|XP_006960893.1|  hypothetical protein WALSEDRAFT_4042             54.7    2e-11   Wallemia mellicola CBS 633.66
gb|ETO69135.1|  hypothetical protein F444_14193                       67.0    2e-11   Phytophthora parasitica P1976
gb|EFX61403.1|  hypothetical protein DAPPUDRAFT_38512                 67.0    2e-11   Daphnia pulex
gb|KIK74325.1|  hypothetical protein PAXRUDRAFT_176060                67.4    2e-11   Paxillus rubicundulus Ve08.2h10
gb|KEH16993.1|  senescence-associated protein                         72.4    2e-11   Medicago truncatula
gb|KEH17024.1|  senescence-associated protein                         72.4    3e-11   Medicago truncatula
gb|EFX60771.1|  hypothetical protein DAPPUDRAFT_70661                 67.4    4e-11   Daphnia pulex
ref|XP_005711500.1|  unnamed protein product                          65.9    4e-11   Chondrus crispus [carageen]
gb|KDQ49116.1|  hypothetical protein JAAARDRAFT_143833                67.0    4e-11   Jaapia argillacea MUCL 33604
gb|EFX62075.1|  hypothetical protein DAPPUDRAFT_68247                 67.4    5e-11   Daphnia pulex
ref|XP_007402182.1|  hypothetical protein PHACADRAFT_167261           54.7    5e-11   Phanerochaete carnosa HHB-10118-sp
emb|CCI11719.1|  unnamed protein product                              65.9    5e-11   Albugo candida
ref|XP_009846712.1|  hypothetical protein H257_19262                  67.0    5e-11   Aphanomyces astaci
gb|KIM19403.1|  hypothetical protein M408DRAFT_83569                  55.1    6e-11   Serendipita vermifera MAFF 305830
emb|CCM06164.1|  predicted protein                                    65.9    6e-11   Fibroporia radiculosa
gb|KDQ49126.1|  hypothetical protein JAAARDRAFT_143876                66.2    6e-11   Jaapia argillacea MUCL 33604
gb|EFX60889.1|  hypothetical protein DAPPUDRAFT_275081                67.8    7e-11   Daphnia pulex
ref|XP_003368605.1|  conserved hypothetical protein                   66.2    9e-11   Trichinella spiralis
ref|XP_002160886.1|  PREDICTED: uncharacterized protein LOC100204220  64.7    1e-10   
ref|XP_009533744.1|  hypothetical protein PHYSODRAFT_520257           64.7    1e-10   Phytophthora sojae
ref|XP_002780099.1|  conserved hypothetical protein                   64.3    1e-10   Perkinsus marinus ATCC 50983
emb|CDW61223.1|  hypothetical protein TTRE_0000966601                 65.1    1e-10   Trichuris trichiura
ref|XP_002118265.1|  hypothetical protein TRIADDRAFT_33825            64.3    2e-10   Trichoplax adhaerens
ref|XP_001896196.1|  hypothetical protein Bm1_23695                   63.9    2e-10   Brugia malayi [agent of lymphatic filariasis]
gb|KFD59603.1|  LOW QUALITY PROTEIN: hypothetical protein M514_28217  64.3    2e-10   Trichuris suis
gb|EFX62166.1|  hypothetical protein DAPPUDRAFT_68172                 65.1    2e-10   Daphnia pulex
gb|EME38015.1|  hypothetical protein DOTSEDRAFT_181978                64.7    2e-10   Dothistroma septosporum NZE10
ref|XP_004205829.1|  PREDICTED: uncharacterized protein LOC101237073  63.9    3e-10   
gb|EMD91246.1|  hypothetical protein COCHEDRAFT_1103737               63.9    4e-10   Bipolaris maydis C5
ref|XP_007929417.1|  hypothetical protein MYCFIDRAFT_141089           63.9    4e-10   Pseudocercospora fijiensis CIRAD86
ref|XP_007413992.1|  hypothetical protein MELLADRAFT_90626            44.3    5e-10   Melampsora larici-populina 98AG31
ref|XP_007411820.1|  hypothetical protein MELLADRAFT_88317            64.3    6e-10   Melampsora larici-populina 98AG31
ref|XP_001617556.1|  hypothetical protein NEMVEDRAFT_v1g78756         62.4    7e-10   Nematostella vectensis
ref|XP_001624697.1|  predicted protein                                62.8    7e-10   Nematostella vectensis
ref|XP_001618625.1|  hypothetical protein NEMVEDRAFT_v1g69194         62.8    8e-10   Nematostella vectensis
gb|ELT98715.1|  hypothetical protein CAPTEDRAFT_61794                 52.8    9e-10   Capitella teleta
gb|KIJ09673.1|  hypothetical protein PAXINDRAFT_177523                63.5    9e-10   Paxillus involutus ATCC 200175
ref|XP_008027951.1|  hypothetical protein SETTUDRAFT_161947           63.5    9e-10   Exserohilum turcica Et28A
ref|XP_003839870.1|  predicted protein                                63.5    1e-09   Leptosphaeria maculans JN3
ref|XP_009533743.1|  hypothetical protein PHYSODRAFT_521105           62.0    1e-09   Phytophthora sojae
ref|XP_006455550.1|  hypothetical protein AGABI2DRAFT_75975           62.8    1e-09   Agaricus bisporus var. bisporus H97
ref|XP_003851048.1|  hypothetical protein MYCGRDRAFT_74254            62.4    1e-09   Zymoseptoria tritici IPO323
gb|ADI72883.1|  hypothetical protein                                  61.6    2e-09   Ophiocordyceps unilateralis
gb|ELT91110.1|  hypothetical protein CAPTEDRAFT_97599                 62.0    2e-09   Capitella teleta
gb|EHA21129.1|  hypothetical protein ASPNIDRAFT_144328                48.5    2e-09   Aspergillus niger ATCC 1015
ref|XP_006279316.1|  hypothetical protein CARUB_v10012757mg           62.8    2e-09   
emb|CEP08712.1|  hypothetical protein                                 62.4    2e-09   Parasitella parasitica
gb|EMF07912.1|  hypothetical protein SEPMUDRAFT_55174                 62.0    2e-09   Sphaerulina musiva SO2202
emb|CDW61210.1|  hypothetical protein TTRE_0000965101                 51.2    3e-09   Trichuris trichiura
ref|XP_004209857.1|  PREDICTED: uncharacterized protein LOC101237391  60.8    4e-09   
gb|EHK21459.1|  hypothetical protein TRIVIDRAFT_152580                62.0    4e-09   Trichoderma virens Gv29-8
gb|EHK48867.1|  hypothetical protein TRIATDRAFT_262275                62.0    5e-09   Trichoderma atroviride IMI 206040
gb|KFM58614.1|  hypothetical protein X975_11578                       60.1    5e-09   Stegodyphus mimosarum
gb|ABI52743.1|  10 kDa putative secreted protein                      61.2    5e-09   Argas monolakensis
gb|EJU02319.1|  hypothetical protein DACRYDRAFT_51577                 60.8    6e-09   Dacryopinax primogenitus
emb|CCT65050.1|  uncharacterized protein FFUJ_14433                   61.6    7e-09   Fusarium fujikuroi IMI 58289
ref|XP_003297441.1|  hypothetical protein PTT_07856                   61.6    8e-09   
ref|XP_007324734.1|  hypothetical protein SERLADRAFT_353240           48.1    9e-09   Serpula lacrymans var. lacrymans S7.9
gb|KEH16543.1|  senescence-associated protein, putative               64.3    1e-08   Medicago truncatula
ref|XP_003614377.1|  hypothetical protein MTR_5g050920                64.3    1e-08   
gb|KEH16540.1|  senescence-associated protein, putative               64.3    1e-08   Medicago truncatula
ref|XP_003614352.1|  hypothetical protein MTR_5g050460                64.3    1e-08   
emb|CCE34895.1|  uncharacterized protein CPUR_08834                   60.8    1e-08   Claviceps purpurea 20.1
ref|XP_003614355.1|  hypothetical protein MTR_5g050490                63.9    1e-08   
emb|CCD58743.1|  unnamed protein product                              60.1    1e-08   Schistosoma mansoni
ref|XP_001887546.1|  predicted protein                                59.7    2e-08   Laccaria bicolor S238N-H82
ref|XP_729764.1|  hypothetical protein                                43.1    2e-08   
ref|XP_007324730.1|  hypothetical protein SERLADRAFT_353212           59.3    2e-08   Serpula lacrymans var. lacrymans S7.9
ref|XP_009550271.1|  hypothetical protein HETIRDRAFT_421044           59.3    2e-08   Heterobasidion irregulare TC 32-1
ref|XP_007311851.1|  hypothetical protein STEHIDRAFT_23631            59.3    2e-08   Stereum hirsutum FP-91666 SS1
ref|XP_001891761.1|  LD48059p                                         58.2    3e-08   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003370312.1|  conserved hypothetical protein                   60.1    3e-08   Trichinella spiralis
ref|XP_001383614.1|  hypothetical protein PICST_57317                 58.2    5e-08   Scheffersomyces stipitis CBS 6054
ref|XP_008037273.1|  hypothetical protein TRAVEDRAFT_36643            58.2    7e-08   Trametes versicolor FP-101664 SS1
ref|XP_002427897.1|  hypothetical protein Phum_PHUM351800             58.5    7e-08   Pediculus humanus corporis [human body lice]
gb|EKC17825.1|  hypothetical protein CGI_10000151                     57.8    7e-08   Crassostrea gigas
gb|KDR65247.1|  hypothetical protein GALMADRAFT_82099                 58.9    8e-08   Galerina marginata CBS 339.88
gb|EQB46020.1|  hypothetical protein CGLO_15009                       58.2    1e-07   Colletotrichum gloeosporioides Cg-14
gb|AII97892.1|  BLTX527                                               57.0    2e-07   Nephila pilipes
gb|EGZ74197.1|  hypothetical protein NEUTE2DRAFT_35651                56.6    2e-07   Neurospora tetrasperma FGSC 2509
ref|XP_007373420.1|  hypothetical protein SPAPADRAFT_134444           56.6    2e-07   Spathaspora passalidarum NRRL Y-27907
gb|KFX41037.1|  hypothetical protein GQ26_0740040                     55.5    2e-07   Talaromyces marneffei PM1
ref|XP_003366709.1|  conserved hypothetical protein                   55.1    3e-07   Trichinella spiralis
ref|XP_009050220.1|  hypothetical protein LOTGIDRAFT_149064           55.5    3e-07   Lottia gigantea
ref|XP_004212671.1|  PREDICTED: uncharacterized protein LOC101237460  55.5    3e-07   
gb|EFN71375.1|  hypothetical protein EAG_03557                        41.6    3e-07   Camponotus floridanus
gb|EGZ76056.1|  hypothetical protein NEUTE2DRAFT_35677                56.2    4e-07   Neurospora tetrasperma FGSC 2509
gb|KIK74324.1|  hypothetical protein PAXRUDRAFT_176058                55.5    4e-07   Paxillus rubicundulus Ve08.2h10
gb|ADI72888.1|  hypothetical protein                                  55.1    5e-07   Ophiocordyceps unilateralis
gb|EMF07894.1|  hypothetical protein SEPMUDRAFT_55199                 55.1    6e-07   Sphaerulina musiva SO2202
gb|KDR65244.1|  hypothetical protein GALMADRAFT_82084                 55.5    6e-07   Galerina marginata CBS 339.88
ref|XP_005017309.1|  PREDICTED: olfactory receptor 14C36-like         58.5    6e-07   
ref|XP_001891961.1|  LD48059p                                         54.3    7e-07   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001756672.1|  predicted protein                                55.8    8e-07   
ref|XP_007413089.1|  hypothetical protein MELLADRAFT_90069            44.7    8e-07   Melampsora larici-populina 98AG31
gb|EHA21130.1|  hypothetical protein ASPNIDRAFT_195725                54.3    8e-07   Aspergillus niger ATCC 1015
gb|EMD30538.1|  hypothetical protein CERSUDRAFT_61068                 55.8    9e-07   Gelatoporia subvermispora B
ref|XP_001230221.1|  hypothetical protein CHGG_11100                  55.5    1e-06   Chaetomium globosum CBS 148.51
gb|EHA21137.1|  hypothetical protein ASPNIDRAFT_138531                53.5    1e-06   Aspergillus niger ATCC 1015
ref|XP_003368961.1|  conserved hypothetical protein                   53.5    1e-06   Trichinella spiralis
ref|XP_003666596.1|  hypothetical protein MYCTH_2071561               55.5    1e-06   
ref|XP_001230225.1|  hypothetical protein CHGG_11103                  55.1    1e-06   Chaetomium globosum CBS 148.51
ref|XP_003654188.1|  hypothetical protein THITE_2145127               55.1    1e-06   Thielavia terrestris NRRL 8126
ref|WP_029759544.1|  hypothetical protein                             53.5    2e-06   Fusobacterium nucleatum
gb|EUB55374.1|  rRNA promoter binding protein                         57.4    2e-06   Echinococcus granulosus
ref|XP_007324736.1|  hypothetical protein SERLADRAFT_353288           53.5    3e-06   Serpula lacrymans var. lacrymans S7.9
gb|EHK48570.1|  hypothetical protein TRIATDRAFT_55202                 53.1    3e-06   Trichoderma atroviride IMI 206040
gb|EZA46947.1|  hypothetical protein X777_00562                       52.8    4e-06   Ooceraea biroi
emb|CAB81951.1|  integral membrane transporter protein                56.2    4e-06   Homo sapiens [man]
gb|EFN65035.1|  hypothetical protein EAG_01178                        40.0    4e-06   Camponotus floridanus
ref|XP_005895158.1|  PREDICTED: keratin-associated protein 10-4-like  56.2    4e-06   
gb|EMD30504.1|  hypothetical protein CERSUDRAFT_163812                52.4    5e-06   Gelatoporia subvermispora B
ref|XP_004606287.1|  PREDICTED: putative tripartite motif-contain...  56.2    5e-06   
ref|XP_002994726.1|  hypothetical protein SELMODRAFT_139061           39.7    7e-06   
ref|XP_003366551.1|  conserved hypothetical protein                   50.8    1e-05   Trichinella spiralis
ref|XP_007006612.1|  hypothetical protein TREMEDRAFT_69606            51.6    1e-05   Tremella mesenterica DSM 1558
ref|XP_002590018.1|  hypothetical protein BRAFLDRAFT_81640            53.9    1e-05   Branchiostoma floridae
gb|EHK21458.1|  hypothetical protein TRIVIDRAFT_139669                50.8    2e-05   Trichoderma virens Gv29-8
gb|EKC34377.1|  hypothetical protein CGI_10017680                     51.2    2e-05   Crassostrea gigas
gb|EHK42655.1|  hypothetical protein TRIATDRAFT_224476                51.2    2e-05   Trichoderma atroviride IMI 206040
ref|WP_021794368.1|  hypothetical protein                             52.0    2e-05   
ref|XP_003367734.1|  conserved hypothetical protein                   50.8    2e-05   Trichinella spiralis
ref|XP_009262663.1|  hypothetical protein FPSE_11271                  50.1    2e-05   Fusarium pseudograminearum CS3096
gb|KIM52775.1|  hypothetical protein SCLCIDRAFT_1159873               50.8    2e-05   Scleroderma citrinum Foug A
ref|XP_724982.1|  hypothetical protein                                51.6    3e-05   
gb|EGN91490.1|  hypothetical protein SERLA73DRAFT_67320               52.0    3e-05   Serpula lacrymans var. lacrymans S7.3
ref|XP_003666597.1|  hypothetical protein MYCTH_2071504               50.1    4e-05   Thermothelomyces thermophila ATCC 42464
ref|XP_003654189.1|  hypothetical protein THITE_2049959               50.1    4e-05   Thielavia terrestris NRRL 8126
ref|XP_001894199.1|  hypothetical protein Bm1_13675                   40.8    4e-05   Brugia malayi [agent of lymphatic filariasis]
gb|EGZ74234.1|  hypothetical protein NEUTE2DRAFT_76202                49.7    5e-05   
ref|XP_009517221.1|  hypothetical protein PHYSODRAFT_469960           50.1    5e-05   
emb|CDW61227.1|  hypothetical protein TTRE_0000967001                 49.7    9e-05   
emb|CDW61045.1|  hypothetical protein TTRE_0000946401                 49.7    9e-05   
gb|KGH16813.1|  hypothetical protein P608_06365                       48.5    1e-04   
emb|CDW60996.1|  hypothetical protein TTRE_0000940601                 52.0    1e-04   
emb|CDW61032.1|  hypothetical protein TTRE_0000944701                 49.7    1e-04   
gb|KFO33844.1|  hypothetical protein H920_04838                       49.3    1e-04   
emb|CDW61028.1|  hypothetical protein TTRE_0000944201                 49.7    1e-04   
ref|XP_009539724.1|  hypothetical protein PHYSODRAFT_291312           43.9    1e-04   
gb|ACN10266.1|  Cytochrome c oxidase subunit 5B, mitochondrial pr...  50.1    1e-04   
gb|EWC78008.1|  hypothetical protein C923_01320                       48.1    1e-04   
ref|WP_043914893.1|  hypothetical protein                             48.9    2e-04   
emb|CDS34355.1|  hypothetical protein HmN_000587800                   50.8    2e-04   
ref|XP_008187637.1|  PREDICTED: uncharacterized protein LOC103310617  48.9    4e-04   
ref|XP_004389677.1|  PREDICTED: aryl hydrocarbon receptor nuclear...  50.4    4e-04   
ref|XP_003366574.1|  hypothetical protein Tsp_15093                   46.2    6e-04   



>emb|CDY71259.1| BnaAnng36730D [Brassica napus]
Length=293

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/205 (61%), Positives = 128/205 (62%), Gaps = 68/205 (33%)
 Frame = +1

Query  7    QESDMCASQRASKPVRRKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGA  186
            +ESDMCASQR SKPVRRKEADW DP                 CEH CRDPKDGELCLS A
Sbjct  157  KESDMCASQRVSKPVRRKEADWLDP---------------SRCEHACRDPKDGELCLSWA  201

Query  187  KPEETLVEARSDTDVQIVRLTWV*GRKTNRTV**LVPSEVSLRIAGAGARVLSGKAND*R  366
            KPEETLVEARS+TDVQIVRLTW                                      
Sbjct  202  KPEETLVEARSNTDVQIVRLTW--------------------------------------  223

Query  367  HRGRNALDLFSNFK*VGRRGCFVEPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANL  546
                           VGR GCFVEP HGI SSKWAIFGKQNWRCGMNRKPGYGAQLRANL
Sbjct  224  ---------------VGRGGCFVEPSHGIESSKWAIFGKQNWRCGMNRKPGYGAQLRANL  268

Query  547  DPTKGVGRLRQQDGGHGSRNPLRSV  621
            +PTKGVGRLRQQDGGHGSRNPLRSV
Sbjct  269  EPTKGVGRLRQQDGGHGSRNPLRSV  293



>emb|CDY55729.1| BnaC08g46150D [Brassica napus]
Length=467

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 128/205 (62%), Gaps = 68/205 (33%)
 Frame = +1

Query  7    QESDMCASQRASKPVRRKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGA  186
            +ESDMCASQ  SKPVRRKEADW DP                 CEH CRDPKDGELCLSGA
Sbjct  236  KESDMCASQLVSKPVRRKEADWLDP---------------SRCEHACRDPKDGELCLSGA  280

Query  187  KPEETLVEARSDTDVQIVRLTWV*GRKTNRTV**LVPSEVSLRIAGAGARVLSGKAND*R  366
            KPEETLVEARSDTDVQIVRLTW                                      
Sbjct  281  KPEETLVEARSDTDVQIVRLTW--------------------------------------  302

Query  367  HRGRNALDLFSNFK*VGRRGCFVEPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANL  546
                           VGR GCFVEP HGI SSKWAIFGKQNWRCGMNRKPGYGAQLRANL
Sbjct  303  ---------------VGRGGCFVEPSHGIESSKWAIFGKQNWRCGMNRKPGYGAQLRANL  347

Query  547  DPTKGVGRLRQQDGGHGSRNPLRSV  621
            +PTKGVGRLRQQDGGHGSRNPLRSV
Sbjct  348  EPTKGVGRLRQQDGGHGSRNPLRSV  372



>gb|AGV54793.1| hypothetical protein [Phaseolus vulgaris]
Length=294

 Score =   136 bits (343),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 66/70 (94%), Gaps = 0/70 (0%)
 Frame = +1

Query  412  VGRRGCFVEPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANLDPTKGVGRLRQQDGG  591
            VGRRGC VEP HGI SSKWAIFGKQNWRCGMNRK GYGAQLRANLDPTKGVGRLRQQDGG
Sbjct  191  VGRRGCSVEPCHGIESSKWAIFGKQNWRCGMNRKLGYGAQLRANLDPTKGVGRLRQQDGG  250

Query  592  HGSRNPLRSV  621
            HGSRNPLRSV
Sbjct  251  HGSRNPLRSV  260


 Score =   116 bits (290),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 85/111 (77%), Gaps = 2/111 (2%)
 Frame = +2

Query  80   PSRGCTADRP*SSEKGSSASIPVGTRKMVNYA*AGRSQRKLWWRPAAILTCKSFV*LGYR  259
            P  GCTADRP SS KGSS SIPVGTRKMVNYA AGRSQRKLWWRPAAILTCKSF  LG  
Sbjct  80   PLVGCTADRPRSSVKGSSESIPVGTRKMVNYAGAGRSQRKLWWRPAAILTCKSFSDLGI-  138

Query  260  GERLIEpssswfppkfpsG*LELAREFYRVK-PMIRGIGGVTPSTYSQTLN  409
            G + IEPSSSWFPPKFPSG     R     K P IRGIGG TPSTYSQT N
Sbjct  139  GRKTIEPSSSWFPPKFPSGDSWSPRASSIGKTPTIRGIGGATPSTYSQTSN  189


 Score = 52.8 bits (125),  Expect(3) = 1e-67, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  7   QESDMCASQRASKPVRRKEADWRDPLTG  90
           +ESDMCASQR SKPVRRKEADW DPL G
Sbjct  56  KESDMCASQRVSKPVRRKEADWWDPLVG  83



>emb|CDY66372.1| BnaAnng22160D, partial [Brassica napus]
Length=409

 Score =   220 bits (560),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 126/205 (61%), Gaps = 68/205 (33%)
 Frame = +1

Query  7    QESDMCASQRASKPVRRKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGA  186
            +ESDMCASQR SKPVRRKEADW DP                 CEH CRDPKDGE   SGA
Sbjct  232  KESDMCASQRVSKPVRRKEADWLDP---------------SRCEHACRDPKDGERGRSGA  276

Query  187  KPEETLVEARSDTDVQIVRLTWV*GRKTNRTV**LVPSEVSLRIAGAGARVLSGKAND*R  366
            KPEETLVEARSDTDVQIVRLTW                                      
Sbjct  277  KPEETLVEARSDTDVQIVRLTW--------------------------------------  298

Query  367  HRGRNALDLFSNFK*VGRRGCFVEPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANL  546
                           VGR GCFVEP HGI SSKWAIFGKQNWRCGMNRKPGYGAQLRANL
Sbjct  299  ---------------VGRGGCFVEPSHGIESSKWAIFGKQNWRCGMNRKPGYGAQLRANL  343

Query  547  DPTKGVGRLRQQDGGHGSRNPLRSV  621
            +PTKGVGRLRQQDGGHGSRNPLRSV
Sbjct  344  EPTKGVGRLRQQDGGHGSRNPLRSV  368



>emb|CDY43697.1| BnaC08g47040D [Brassica napus]
Length=229

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 123/201 (61%), Gaps = 66/201 (33%)
 Frame = +1

Query  19   MCASQRASKPVRRKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGAKPEE  198
            MCA+QR SKP+RRKEADW DP               FECEH CRDP+DGELCLSGAK EE
Sbjct  1    MCANQRVSKPIRRKEADWLDP-------------SRFECEHACRDPEDGELCLSGAKQEE  47

Query  199  TLVEARSDTDVQIVRLTWV*GRKTNRTV**LVPSEVSLRIAGAGARVLSGKAND*RHRGR  378
            TLVEA SDTDV+IV LTW                                          
Sbjct  48   TLVEAHSDTDVKIVHLTW------------------------------------------  65

Query  379  NALDLFSNFK*VGRRGCFVEPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANLDPTK  558
                       VGR GCFVEP HGI SSKWAIFGKQNWRCGMN+KPGYGAQLRANL+PTK
Sbjct  66   -----------VGRGGCFVEPSHGIESSKWAIFGKQNWRCGMNQKPGYGAQLRANLEPTK  114

Query  559  GVGRLRQQDGGHGSRNPLRSV  621
            GVGRLRQQDGGHGS+N LRSV
Sbjct  115  GVGRLRQQDGGHGSQNTLRSV  135



>emb|CDY70240.1| BnaCnng67370D [Brassica napus]
Length=226

 Score =   202 bits (515),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 118/203 (58%), Gaps = 76/203 (37%)
 Frame = +1

Query  10   ESDMCASQRASKPVRRKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGAK  189
            ESDMCASQR SKPVRR                       FECEH CRDPKDGELCLS AK
Sbjct  86   ESDMCASQRVSKPVRR-----------------------FECEHACRDPKDGELCLSRAK  122

Query  190  PEETLVEARSDTDVQIVRLTWV*GRKTNRTV**LVPSEVSLRIAGAGARVLSGKAND*RH  369
            PEETLVEARSDTDVQIVRLTW                                       
Sbjct  123  PEETLVEARSDTDVQIVRLTW---------------------------------------  143

Query  370  RGRNALDLFSNFK*VGRRGCFVEPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANLD  549
                          VGR GCFVEP HGI SSKWAIF KQNWRCGMN KPGYG+QLRA L+
Sbjct  144  --------------VGRGGCFVEPSHGIESSKWAIFSKQNWRCGMNWKPGYGSQLRAKLE  189

Query  550  PTKGVGRLRQQDGGHGSRNPLRS  618
            PTKGVGRLRQQDGGHGSRNPLR+
Sbjct  190  PTKGVGRLRQQDGGHGSRNPLRT  212



>ref|XP_003627732.1| ATP synthase subunit beta [Medicago truncatula]
Length=1098

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 114/181 (63%), Gaps = 53/181 (29%)
 Frame = +1

Query  79    PLTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV*  258
             P  G HR PT IF EGFE EH CRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTW  
Sbjct  971   PRPGPHRWPTPIFCEGFELEHACRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTW--  1028

Query  259   GRKTNRTV**LVPSEVSLRIAGAGARVLSGKAND*RHRGRNALDLFSNFK*VGRRGCFVE  438
                                                                VGR GC  E
Sbjct  1029  ---------------------------------------------------VGRHGCSGE  1037

Query  439   PRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANLDPTKGVGRLRQQDGGHGSRNPLRS  618
             P  GI SSKWAIFGKQNWRCGMNRKPGYGA+LRANL+PTKGVGRLRQQDGGHGSRNPLRS
Sbjct  1038  PCLGIGSSKWAIFGKQNWRCGMNRKPGYGAELRANLEPTKGVGRLRQQDGGHGSRNPLRS  1097

Query  619   V  621
             V
Sbjct  1098  V  1098



>ref|XP_003638451.1| hypothetical protein MTR_132s0010, partial [Medicago truncatula]
Length=1458

 Score = 98.6 bits (244),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  584  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  642


 Score = 88.6 bits (218),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  515  GFRFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRP  372
             FRFIPHRQFCLPKMAHLEL IPW GST+QP RPTYLKFENRSR+  P
Sbjct  540  AFRFIPHRQFCLPKMAHLELSIPWHGSTEQPHRPTYLKFENRSRSFAP  587


 Score = 47.0 bits (110),  Expect(3) = 2e-46, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  642  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  670



>ref|XP_003614382.1| hypothetical protein MTR_5g050970 [Medicago truncatula]
Length=1065

 Score = 97.8 bits (242),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  570  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  628


 Score = 88.6 bits (218),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  512  FRFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRP  372
            FRFIPHRQFCLPKMAHLEL IPW GST+QP RPTYLKFENRSR+  P
Sbjct  527  FRFIPHRQFCLPKMAHLELSIPWHGSTEQPHRPTYLKFENRSRSFAP  573


 Score = 46.6 bits (109),  Expect(3) = 3e-46, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  628  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  656



>ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago truncatula]
Length=1337

 Score = 97.8 bits (242),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  488  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  546


 Score = 88.6 bits (218),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  515  GFRFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRP  372
             FRFIPHRQFCLPKMAHLEL IPW GST+QP RPTYLKFENRSR+  P
Sbjct  444  AFRFIPHRQFCLPKMAHLELSIPWHGSTEQPHRPTYLKFENRSRSFAP  491


 Score = 46.6 bits (109),  Expect(3) = 4e-46, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  546  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  574



>ref|XP_003614395.1| hypothetical protein MTR_5g051140 [Medicago truncatula]
Length=1186

 Score = 97.8 bits (242),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  474  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  532


 Score = 88.6 bits (218),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  512  FRFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRP  372
            FRFIPHRQFCLPKMAHLEL IPW GST+QP RPTYLKFENRSR+  P
Sbjct  431  FRFIPHRQFCLPKMAHLELSIPWHGSTEQPHRPTYLKFENRSRSFAP  477


 Score = 46.6 bits (109),  Expect(3) = 5e-46, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  532  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  560



>ref|XP_003614386.1| hypothetical protein MTR_5g051030 [Medicago truncatula]
Length=795

 Score = 97.1 bits (240),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  441  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  499


 Score = 88.2 bits (217),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  512  FRFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRP  372
            FRFIPHRQFCLPKMAHLEL IPW GST+QP RPTYLKFENRSR+  P
Sbjct  398  FRFIPHRQFCLPKMAHLELSIPWHGSTEQPHRPTYLKFENRSRSFAP  444


 Score = 46.2 bits (108),  Expect(3) = 1e-45, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  499  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  527



>ref|XP_003614383.1| hypothetical protein MTR_5g051000 [Medicago truncatula]
Length=1735

 Score = 98.2 bits (243),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268   SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
             SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  1079  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  1137


 Score = 88.2 bits (217),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -2

Query  515   GFRFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRP  372
              FRFIPHRQFCLPKMAHLEL IPW GST+QP RPTYLKFENRSR+  P
Sbjct  1035  AFRFIPHRQFCLPKMAHLELSIPWHGSTEQPHRPTYLKFENRSRSFAP  1082


 Score = 44.7 bits (104),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 24/31 (77%), Gaps = 2/31 (6%)
 Frame = -1

Query  99    AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
             A H R  IPPISFLAP GFT PLTR HVRLL
Sbjct  1137  ATHKR--IPPISFLAPNGFTHPLTRIHVRLL  1165



>ref|XP_003614384.1| hypothetical protein MTR_5g051010 [Medicago truncatula]
Length=1153

 Score = 97.1 bits (240),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  799  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  857


 Score = 88.2 bits (217),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -2

Query  512  FRFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRP  372
            FRFIPHRQFCLPKMAHLEL IPW GST+QP RPTYLKFENRSR+  P
Sbjct  756  FRFIPHRQFCLPKMAHLELSIPWHGSTEQPHRPTYLKFENRSRSFAP  802


 Score = 46.2 bits (108),  Expect(3) = 2e-45, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  857  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  885



>gb|KFK40658.1| hypothetical protein AALP_AA2G025000 [Arabis alpina]
Length=342

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/83 (92%), Positives = 78/83 (94%), Gaps = 1/83 (1%)
 Frame = +1

Query  7    QESDMCASQRASKPVRRKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGA  186
            +ESDMCASQR SKPVRRKEADWRDP + VHRRPTLIF EGFECEH CRDPKDGELCLSGA
Sbjct  261  KESDMCASQRVSKPVRRKEADWRDP-SRVHRRPTLIFREGFECEHACRDPKDGELCLSGA  319

Query  187  KPEETLVEARSDTDVQIVRLTWV  255
            KPEETLVEARSDTDVQIVRLTWV
Sbjct  320  KPEETLVEARSDTDVQIVRLTWV  342


 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/51 (86%), Positives = 46/51 (90%), Gaps = 1/51 (2%)
 Frame = +1

Query  7    QESDMCASQRASKPVRRKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPK  159
            +ESDMCASQR SKPVRRKEADWRDP + VHRRPTLIF EGFECEH CRDPK
Sbjct  177  KESDMCASQRVSKPVRRKEADWRDP-SRVHRRPTLIFREGFECEHACRDPK  226


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 1/37 (3%)
 Frame = +1

Query  7    QESDMCASQRASKPVRRKEADWRDPLTGVHRRPTLIF  117
            +ESDMCASQR SKPVRRKEADWRDP + VHRRPTLIF
Sbjct  82   KESDMCASQRVSKPVRRKEADWRDP-SRVHRRPTLIF  117



>gb|KDO39226.1| hypothetical protein CISIN_1g0366582mg, partial [Citrus sinensis]
Length=210

 Score =   143 bits (360),  Expect(3) = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 80/107 (75%), Gaps = 21/107 (20%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFKV*E*VEGVTPPMP  364
            VSAQL TVTRLPVHPA+PVLLTKNGPLGA+DSVA LNEAAAPSYLFK             
Sbjct  68   VSAQLATVTRLPVHPATPVLLTKNGPLGALDSVAWLNEAAAPSYLFK-------------  114

Query  363  LIIGFTR*NSRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVS  223
                    NS + SSYPEGNFGGNQLLDGSISLSPLYPSQTNDLH  
Sbjct  115  --------NSFSGSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHAC  153


 Score = 41.2 bits (95),  Expect(3) = 1e-39, Method: Compositional matrix adjust.
 Identities = 16/20 (80%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = -3

Query  67   QLPCALRVYSPVDSHTCQTP  8
            + PCALRVY P+DSHTCQTP
Sbjct  163  KFPCALRVYWPIDSHTCQTP  182


 Score = 27.3 bits (59),  Expect(3) = 1e-39, Method: Compositional matrix adjust.
 Identities = 11/14 (79%), Positives = 11/14 (79%), Gaps = 0/14 (0%)
 Frame = -2

Query  146  QVCSHSNPSQKIKV  105
              CSHSNPSQKIK 
Sbjct  151  HACSHSNPSQKIKF  164



>gb|EMD30335.1| hypothetical protein CERSUDRAFT_61265, partial [Ceriporiopsis 
subvermispora B]
Length=122

 Score =   137 bits (346),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 82/87 (94%), Gaps = 1/87 (1%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDR+A TRTLLRRSRSVGGAP
Sbjct  1    SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRHAHTRTLLRRSRSVGGAP  60

Query  88   P*GDPANQLPCALRVYSPVDSHTCQTP  8
               DPANQLPCALRVYSP DSHTCQTP
Sbjct  61   A-RDPANQLPCALRVYSPADSHTCQTP  86



>emb|CDY19789.1| BnaA09g04420D [Brassica napus]
Length=349

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/70 (94%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +1

Query  412  VGRRGCFVEPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANLDPTKGVGRLRQQDGG  591
            VGR GCFVEP HGI SSKWAIFGKQNWRCGMNRKPGYGAQLRANL+PTKGVGRLRQQDGG
Sbjct  185  VGRGGCFVEPSHGIESSKWAIFGKQNWRCGMNRKPGYGAQLRANLEPTKGVGRLRQQDGG  244

Query  592  HGSRNPLRSV  621
            HGSRNPLRSV
Sbjct  245  HGSRNPLRSV  254



>gb|ABO20854.1| hypothetical protein [Lilium longiflorum]
Length=87

 Score =   130 bits (327),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDR+A TRTL RRS SVGGAP
Sbjct  1    SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRHAPTRTLHRRSGSVGGAP  60

Query  88   P*GDPANQLPCALRVYSPVDSHTCQTP  8
              GDPA+QLPCA RV++PV  H CQTP
Sbjct  61   HKGDPAHQLPCAFRVFTPVGLHACQTP  87



>gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trifallax]
Length=1367

 Score =   142 bits (358),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 101/179 (56%), Gaps = 21/179 (12%)
 Frame = -1

Query  648  LVDSAGELLHTP*RIstsmttvlls*stntLCGI*VSAQLGTVTRLPVHPASPVLLTKNG  469
            LV SAGELLHTP R                     +S QLGT+TR   HP+SPVLLTKNG
Sbjct  649  LVHSAGELLHTPQRYL-------------------MSVQLGTLTRRQEHPSSPVLLTKNG  689

Query  468  PLGAVDSVARLNEAAAPSYL-FKV*E*VEGVTPPMPLIIGFTR*NSRASSSYPEGNFGGN  292
            PLG       LN+   P +L  +      G   P            R   SYPEGNFGGN
Sbjct  690  PLGTRIEPPCLNQER-PGFLPIQSLRIGRGHCIPEASNHSLYLIKLRICPSYPEGNFGGN  748

Query  291  QLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIFRVPTGMLALEPFSE  115
            QLLDGSISLSPLYPS T DLHV  A  LHQSF WL P QA FTIFRV T ML L+PF+ 
Sbjct  749  QLLDGSISLSPLYPSSTIDLHVRTATSLHQSFPWLHPTQAQFTIFRVLTFMLVLKPFTR  807



>gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trifallax]
Length=1367

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 101/179 (56%), Gaps = 21/179 (12%)
 Frame = -1

Query  648  LVDSAGELLHTP*RIstsmttvlls*stntLCGI*VSAQLGTVTRLPVHPASPVLLTKNG  469
            LV SAGELLHTP R                     +S QLGT+TR   HP+SPVLLTKNG
Sbjct  649  LVHSAGELLHTPQRYL-------------------MSVQLGTLTRRQEHPSSPVLLTKNG  689

Query  468  PLGAVDSVARLNEAAAPSYL-FKV*E*VEGVTPPMPLIIGFTR*NSRASSSYPEGNFGGN  292
            PLG       LN+   P +L  +      G   P            R   SYPEGNFGGN
Sbjct  690  PLGTRIEPPCLNQER-PGFLPIQSLRIGRGHCIPEASNHSLYLIKLRICPSYPEGNFGGN  748

Query  291  QLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIFRVPTGMLALEPFSE  115
            QLLDGSISLSPLYPS T DLHV  A  LHQSF WL P QA FTIFRV T ML L+PF+ 
Sbjct  749  QLLDGSISLSPLYPSSTIDLHVRTATSLHQSFPWLHPTQAQFTIFRVLTFMLVLKPFTR  807



>emb|CDW75723.1| UNKNOWN [Stylonychia lemnae]
Length=1881

 Score =   137 bits (345),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 86/154 (56%), Positives = 92/154 (60%), Gaps = 24/154 (16%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFKV*E*VEGVTPPMP  364
            +S QLGT+TR   HP+SPVLLTKNGPLG       L +               G  P   
Sbjct  582  MSVQLGTLTRRQEHPSSPVLLTKNGPLGTRIEPPCLTQERP------------GFLPIQS  629

Query  363  LIIG---FTR*NS---------RASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSI  220
            L IG   FT   S         R   SYPEGNFGGNQLLDGSISLSPLYPS TNDLHVS 
Sbjct  630  LRIGRGHFTPDASNHSLYLIKLRICPSYPEGNFGGNQLLDGSISLSPLYPSLTNDLHVST  689

Query  219  AAGLHQSFLWLRPAQA*FTIFRVPTGMLALEPFS  118
            A  LHQSF WL P QA FTIFRV T ML L+PF+
Sbjct  690  ATSLHQSFPWLHPTQAQFTIFRVLTCMLVLKPFT  723


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 48/99 (48%), Gaps = 10/99 (10%)
 Frame = -3

Query  616  SLADFDFHDHRPAVLIDQHPLW-----DLG*RAVGHRNPASGSSRIASSAYQKWPTWSC*  452
            S+A  DFH HRPAV ++QHPL       LG       +P+S      +          C 
Sbjct  558  SIAGSDFHGHRPAVWMNQHPLQFLMSVQLGTLTRRQEHPSSPVLLTKNGPLGTRIEPPC-  616

Query  451  FRGAAQRSSRAVLPI*SLRIGRGRYAPDASNHWLYPIEL  335
                  +     LPI SLRIGRG + PDASNH LY I+L
Sbjct  617  ----LTQERPGFLPIQSLRIGRGHFTPDASNHSLYLIKL  651



>gb|EDY04083.1| hypothetical protein G11MC16DRAFT_3625 [Geobacillus sp. G11MC16]
Length=182

 Score = 92.4 bits (228),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 47/48 (98%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCS  135
            VRLVFRPYTQVRRTICTSVSLRASTRV SGFAPLRHSSPSFGSRQVCS
Sbjct  2    VRLVFRPYTQVRRTICTSVSLRASTRVCSGFAPLRHSSPSFGSRQVCS  49


 Score = 75.5 bits (184),  Expect(2) = 7e-33, Method: Compositional matrix adjust.
 Identities = 35/45 (78%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  MLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            + +LEPFSEDQGRSA+HP  GI P+SFLAP GFT PLTRTHVRLL
Sbjct  47   VCSLEPFSEDQGRSALHPSRGIAPVSFLAPCGFTSPLTRTHVRLL  91



>gb|EGZ76045.1| hypothetical protein NEUTE2DRAFT_35586, partial [Neurospora tetrasperma 
FGSC 2509]
Length=85

 Score =   124 bits (312),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 75/81 (93%), Positives = 76/81 (94%), Gaps = 1/81 (1%)
 Frame = -3

Query  250  KSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAPP*GDPA  71
            KSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDR+A TRTLLRRSRSVG AP   DPA
Sbjct  1    KSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRHAHTRTLLRRSRSVGCAPV-RDPA  59

Query  70   NQLPCALRVYSPVDSHTCQTP  8
            NQLPCALRVYSPVDSHTCQTP
Sbjct  60   NQLPCALRVYSPVDSHTCQTP  80



>ref|XP_003614393.1| hypothetical protein MTR_5g051120 [Medicago truncatula]
Length=385

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/70 (89%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +1

Query  412  VGRRGCFVEPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANLDPTKGVGRLRQQDGG  591
            VGR GC VEP HGI SSKWAIFGKQNWRCGMNRK GYGAQLRANLDPTKGVGRLRQQDGG
Sbjct  191  VGRCGCSVEPCHGIESSKWAIFGKQNWRCGMNRKLGYGAQLRANLDPTKGVGRLRQQDGG  250

Query  592  HGSRNPLRSV  621
            HGSRNPL ++
Sbjct  251  HGSRNPLPTL  260



>ref|XP_002488951.1| hypothetical protein SORBIDRAFT_1292s002010 [Sorghum bicolor]
 gb|EES20203.1| hypothetical protein SORBIDRAFT_1292s002010 [Sorghum bicolor]
Length=63

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/62 (94%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +1

Query  436  EPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANLDPTKGVGRLRQQDGGHGSRNPLR  615
            EP HGI SSKWAIFGKQNWRCGMNRKPGYGA+LRANL+PTKGVGRLRQQDGGHGSRNPLR
Sbjct  2    EPCHGIGSSKWAIFGKQNWRCGMNRKPGYGAKLRANLEPTKGVGRLRQQDGGHGSRNPLR  61

Query  616  SV  621
            SV
Sbjct  62   SV  63



>ref|XP_002488946.1| hypothetical protein SORBIDRAFT_1376s002010 [Sorghum bicolor]
 gb|EES20265.1| hypothetical protein SORBIDRAFT_1376s002010 [Sorghum bicolor]
Length=79

 Score =   119 bits (299),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  19   MCASQRASKPVRRKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGAKPEE  198
            M AS+R  KP  RKEAD R+  TG    PTLIF EGFE EH CRDPKDGELCLSGAKPEE
Sbjct  1    MRASRRVLKPGMRKEADEREAFTGCTAVPTLIFCEGFELEHACRDPKDGELCLSGAKPEE  60

Query  199  TLVEARSDTDVQIVRLTWV  255
            TLVEARSDTDVQIVRLTWV
Sbjct  61   TLVEARSDTDVQIVRLTWV  79



>gb|KEH17028.1| hypothetical protein MTR_0052s0140 [Medicago truncatula]
Length=372

 Score = 99.8 bits (247),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 63/104 (61%), Gaps = 25/104 (24%)
 Frame = -1

Query  339  NSRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTI  160
             +R+   YP G FGGNQLLDGSISLSPLYPSQTNDLHVSIAA LHQSFLWLR +      
Sbjct  26   ENRSRVLYPGGYFGGNQLLDGSISLSPLYPSQTNDLHVSIAADLHQSFLWLRRSVG----  81

Query  159  FRVPTGMLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLT  28
                                A H R  IPPISFLA  GFT PLT
Sbjct  82   -------------------GATHKR--IPPISFLAANGFTHPLT  104


 Score = 61.2 bits (147),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -2

Query  473  MAHLELLIPWRGSTKQPRRPTYLKFENRSRALRP  372
            MAHLEL IPW GST QP RPTYLKFENRSR L P
Sbjct  1    MAHLELSIPWHGSTDQPHRPTYLKFENRSRVLYP  34



>ref|XP_003614397.1| hypothetical protein MTR_5g051160 [Medicago truncatula]
Length=356

 Score = 99.8 bits (247),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 63/104 (61%), Gaps = 25/104 (24%)
 Frame = -1

Query  339  NSRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTI  160
             +R+   YP G FGGNQLLDGSISLSPLYPSQTNDLHVSIAA LHQSFLWLR +      
Sbjct  26   ENRSRVLYPGGYFGGNQLLDGSISLSPLYPSQTNDLHVSIAADLHQSFLWLRRSVG----  81

Query  159  FRVPTGMLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLT  28
                                A H R  IPPISFLA  GFT PLT
Sbjct  82   -------------------GATHKR--IPPISFLAANGFTHPLT  104


 Score = 61.2 bits (147),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -2

Query  473  MAHLELLIPWRGSTKQPRRPTYLKFENRSRALRP  372
            MAHLEL IPW GST QP RPTYLKFENRSR L P
Sbjct  1    MAHLELSIPWHGSTDQPHRPTYLKFENRSRVLYP  34



>ref|XP_002488956.1| hypothetical protein SORBIDRAFT_1211s002020 [Sorghum bicolor]
 ref|XP_002488958.1| hypothetical protein SORBIDRAFT_1184s002010 [Sorghum bicolor]
 ref|XP_002489054.1| hypothetical protein SORBIDRAFT_0208s002040 [Sorghum bicolor]
 ref|XP_002489066.1| hypothetical protein SORBIDRAFT_0177s002020 [Sorghum bicolor]
 ref|XP_002489115.1| hypothetical protein SORBIDRAFT_0057s002020 [Sorghum bicolor]
 ref|XP_002489154.1| hypothetical protein SORBIDRAFT_0016s002500 [Sorghum bicolor]
 ref|XP_002489155.1| hypothetical protein SORBIDRAFT_0016s002510 [Sorghum bicolor]
 ref|XP_002489156.1| hypothetical protein SORBIDRAFT_0016s002520 [Sorghum bicolor]
 gb|EES20147.1| hypothetical protein SORBIDRAFT_1184s002010 [Sorghum bicolor]
 gb|EES20195.1| hypothetical protein SORBIDRAFT_1211s002020 [Sorghum bicolor]
 gb|EES20334.1| hypothetical protein SORBIDRAFT_0016s002500 [Sorghum bicolor]
 gb|EES20335.1| hypothetical protein SORBIDRAFT_0016s002510 [Sorghum bicolor]
 gb|EES20336.1| hypothetical protein SORBIDRAFT_0016s002520 [Sorghum bicolor]
 gb|EES20346.1| hypothetical protein SORBIDRAFT_0177s002020 [Sorghum bicolor]
 gb|EES20406.1| hypothetical protein SORBIDRAFT_0208s002040 [Sorghum bicolor]
 gb|EES20511.1| hypothetical protein SORBIDRAFT_0057s002020 [Sorghum bicolor]
Length=65

 Score =   119 bits (297),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 63/64 (98%), Gaps = 0/64 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKIKVGR  99
            VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQ CS+SNPSQKI+VG+
Sbjct  2    VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQACSNSNPSQKIRVGQ  61

Query  98   RCTP  87
            RC+P
Sbjct  62   RCSP  65



>gb|ACR37398.1| unknown [Zea mays]
Length=65

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKIKVGR  99
            VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQ CS+SNPSQKI+VG+
Sbjct  2    VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQACSNSNPSQKIRVGQ  61

Query  98   RCTP  87
            RC P
Sbjct  62   RCGP  65



>emb|CDS20307.1| hypothetical protein EgrG_000335800 [Echinococcus granulosus]
Length=209

 Score = 88.6 bits (218),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 43/52 (83%), Positives = 45/52 (87%), Gaps = 0/52 (0%)
 Frame = -1

Query  327  SSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            S+SYPEGNFGGNQLLDGSISLSPLYP  T DLHV IA  LHQSFLWL+P QA
Sbjct  158  SASYPEGNFGGNQLLDGSISLSPLYPRLTIDLHVRIATVLHQSFLWLQPTQA  209


 Score = 70.5 bits (171),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 49/92 (53%), Gaps = 7/92 (8%)
 Frame = -3

Query  610  ADFDFHDHRPAVLIDQHPLWDLG*RAVGHRNPASGSSRIASSAYQKWPTWSC*FRGAAQR  431
            AD DFH HRPAV I+QH LW L   +V H N A GSS  ASSAYQKWPTW          
Sbjct  69   ADADFHGHRPAVYINQHLLWYLMSVSVRHLNRAFGSSHSASSAYQKWPTWH-------SH  121

Query  430  SSRAVLPI*SLRIGRGRYAPDASNHWLYPIEL  335
              R   P         R+ P  SNH LY I+L
Sbjct  122  IQRPTPPAAIHAYEATRFEPSTSNHSLYRIKL  153



>gb|ELU05450.1| hypothetical protein CAPTEDRAFT_103064, partial [Capitella teleta]
Length=123

 Score = 68.6 bits (166),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 31/31 (100%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = -1

Query  318  YPEGNFGGNQLLDGSISLSPLYPSQTNDLHV  226
            YPEGNFGGNQLLDGSISLSPLYPSQTNDLHV
Sbjct  48   YPEGNFGGNQLLDGSISLSPLYPSQTNDLHV  78


 Score = 64.3 bits (155),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -3

Query  538  RAVGHRNPASGSSRIASSAYQKWPTWSC*FRGAAQR  431
            RAVGHRNPASGSSRIASSAYQKWPTWS  F GAAQ+
Sbjct  1    RAVGHRNPASGSSRIASSAYQKWPTWSSRFPGAAQQ  36


 Score = 43.5 bits (101),  Expect(3) = 3e-29, Method: Compositional matrix adjust.
 Identities = 20/23 (87%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  137  SHSNPSQKIKVGRRCTPVRGSRQ  69
            +HSNPSQKIKVGRRCTP  GSRQ
Sbjct  89   AHSNPSQKIKVGRRCTPRGGSRQ  111



>ref|XP_003614387.1| RRNA intron-encoded homing endonuclease [Medicago truncatula]
Length=1440

 Score = 83.6 bits (205),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 46/52 (88%), Positives = 49/52 (94%), Gaps = 0/52 (0%)
 Frame = -3

Query  247  SDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            ++ERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  22   TNERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  73


 Score = 48.1 bits (113),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  73   ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  101


 Score = 37.4 bits (85),  Expect(3) = 4e-27, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  356  LALPDRTLAPAPAILRETSEGTS  288
            +ALPDRT   APAILRETSEGT+
Sbjct  1    MALPDRTRPRAPAILRETSEGTN  23



>gb|KEH16994.1| senescence-associated protein [Medicago truncatula]
Length=881

 Score = 97.8 bits (242),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  367  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  425


 Score = 49.3 bits (116),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  425  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  453


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFK  403
            VSAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA PSYLFK
Sbjct  320  VSAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPSYLFK  366



>gb|KEH17022.1| senescence-associated protein, putative [Medicago truncatula]
Length=1550

 Score = 97.8 bits (242),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268   SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
             SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  1179  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  1237


 Score = 49.3 bits (116),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99    AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
             A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  1237  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  1265


 Score = 86.7 bits (213),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -3

Query  250  KSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            KSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  366  KSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  418


 Score = 49.3 bits (116),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  418  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  446


 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  543   VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFK  403
             VSAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA PSYLFK
Sbjct  1132  VSAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPSYLFK  1178


 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  540  SAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFKV*E  394
            SAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA PSYLFK  E
Sbjct  321  SAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPSYLFKSDE  369



>gb|KEH16991.1| senescence-associated protein [Medicago truncatula]
Length=1771

 Score = 97.4 bits (241),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268   SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
             SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  1400  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  1458


 Score = 48.9 bits (115),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99    AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
             A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  1458  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  1486


 Score = 97.4 bits (241),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  367  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  425


 Score = 46.6 bits (109),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 24/31 (77%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTR HVRLL
Sbjct  425  ATHKR--IPPISFLAPNGFTHPLTRIHVRLL  453


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFK  403
            VSAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA PSYLFK
Sbjct  320  VSAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPSYLFK  366


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  543   VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFK  403
             VSAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA PSYLFK
Sbjct  1353  VSAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPSYLFK  1399



>ref|XP_003614396.1| hypothetical protein MTR_5g051150 [Medicago truncatula]
Length=2133

 Score =   118 bits (296),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  418  RRGCFVEPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANLDPTKGVGRLRQQDGGHG  597
            R GC VEP HGI SSKWAIFGKQNWRCGMNRK GYGAQLRA LDPTKG GRLRQQDGGHG
Sbjct  190  RCGCSVEPCHGIESSKWAIFGKQNWRCGMNRKLGYGAQLRAILDPTKGDGRLRQQDGGHG  249

Query  598  SRNPLRSV  621
            SRNPL ++
Sbjct  250  SRNPLPTL  257


 Score = 97.8 bits (242),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  810  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  868


 Score = 46.6 bits (109),  Expect(2) = 7e-26, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  868  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  896


 Score = 80.5 bits (197),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = -3

Query  241   ERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
             ERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  1761  ERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  1810


 Score = 46.6 bits (109),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99    AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
             A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  1810  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  1838



>gb|KEH17027.1| senescence-associated protein [Medicago truncatula]
Length=545

 Score = 97.4 bits (241),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  367  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  425


 Score = 48.9 bits (115),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  425  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  453


 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFK  403
            VSAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA PSYLFK
Sbjct  320  VSAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPSYLFK  366



>gb|KEH17020.1| senescence-associated protein [Medicago truncatula]
Length=621

 Score = 97.4 bits (241),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  367  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  425


 Score = 48.9 bits (115),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  425  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  453


 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFK  403
            VSAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA PSYLFK
Sbjct  320  VSAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPSYLFK  366



>emb|CDY66173.1| BnaAnng21760D [Brassica napus]
Length=548

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  397  SNFK*VGRRGCFVEPRHGINSSKWAIFGKQNWRCGMNRKPGYGAQLRANLDPTKGVGRLR  576
            ++ + V R GCFVEP HGI SSKWAIF KQNWRCGMNRKPGYGAQLRANL+PTKGVG+ R
Sbjct  248  TDMQIVRRGGCFVEPSHGIESSKWAIFCKQNWRCGMNRKPGYGAQLRANLEPTKGVGQFR  307

Query  577  QQDGGHGS  600
            QQDGGHG+
Sbjct  308  QQDGGHGT  315


 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 52/79 (66%), Gaps = 23/79 (29%)
 Frame = +1

Query  7    QESDMCASQRASKPVRRKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGA  186
            +ESDMCA+Q  SKPVRR                       FECEH CRDPKDGELC+SGA
Sbjct  199  KESDMCATQWVSKPVRR-----------------------FECEHACRDPKDGELCMSGA  235

Query  187  KPEETLVEARSDTDVQIVR  243
            KPEETLVEA +DTD+QIVR
Sbjct  236  KPEETLVEAHNDTDMQIVR  254



>ref|XP_003614398.1| hypothetical protein MTR_5g051170 [Medicago truncatula]
Length=950

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/69 (88%), Positives = 63/69 (91%), Gaps = 3/69 (4%)
 Frame = -2

Query  281  TVRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKIKVG  102
            TVRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKI VG
Sbjct  449  TVRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKIGVG  508

Query  101  ---RRCTPV  84
               +R  P+
Sbjct  509  ATHKRIPPI  517


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEA  427
            VSAQLGT+T+LPVHPASPVLLTKNGPLGA+DS+A LN A
Sbjct  410  VSAQLGTITQLPVHPASPVLLTKNGPLGALDSMAWLNRA  448



>ref|XP_002488950.1| hypothetical protein SORBIDRAFT_1303s002040 [Sorghum bicolor]
 gb|EES20261.1| hypothetical protein SORBIDRAFT_1303s002040 [Sorghum bicolor]
Length=58

 Score =   105 bits (263),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 52/58 (90%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = +1

Query  82   LTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV  255
            L G+HR PTLIF EGFE EH CRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV
Sbjct  1    LHGLHRWPTLIFCEGFELEHACRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV  58



>gb|KFK23449.1| hypothetical protein AALP_AAs69095U000100, partial [Arabis alpina]
Length=50

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/50 (100%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = -1

Query  321  SYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            SYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA
Sbjct  1    SYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  50



>ref|XP_002488870.1| hypothetical protein SORBIDRAFT_3036s002010 [Sorghum bicolor]
 gb|EES20457.1| hypothetical protein SORBIDRAFT_3036s002010 [Sorghum bicolor]
Length=50

 Score =   101 bits (251),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/50 (96%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +1

Query  472  IFGKQNWRCGMNRKPGYGAQLRANLDPTKGVGRLRQQDGGHGSRNPLRSV  621
            IFGKQNWRCGMNRKPGYGA+LRANL+PTKGVGRLRQQDGGHGSRNPLRSV
Sbjct  1    IFGKQNWRCGMNRKPGYGAKLRANLEPTKGVGRLRQQDGGHGSRNPLRSV  50



>gb|KEH16988.1| senescence-associated protein, putative [Medicago truncatula]
Length=755

 Score = 86.3 bits (212),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = -3

Query  250  KSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            KSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  507  KSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  559


 Score = 49.3 bits (116),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 2/31 (6%)
 Frame = -1

Query  99   AVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            A H R  IPPISFLAP GFT PLTRTHVRLL
Sbjct  559  ATHKR--IPPISFLAPNGFTHPLTRTHVRLL  587


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/49 (84%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -1

Query  540  SAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFKV*E  394
            SAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA PSYLFK  E
Sbjct  462  SAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPSYLFKSDE  510



>ref|XP_710281.1| hypothetical protein CaO19.6835 [Candida albicans SC5314]
 gb|EAK91016.1| hypothetical protein CaO19.6835 [Candida albicans SC5314]
Length=108

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKIKVGR  99
            VRLVFRPYTQ+RR+ICTS  LRASTRVSSGF   RHSSPSFGS+Q+CS+SNPS+ I++GR
Sbjct  2    VRLVFRPYTQIRRSICTSEPLRASTRVSSGFTLFRHSSPSFGSQQLCSYSNPSEHIRIGR  61

Query  98   RCT  90
             CT
Sbjct  62   WCT  64



>gb|KDP20462.1| hypothetical protein JCGZ_06007 [Jatropha curcas]
Length=117

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 75/116 (65%), Gaps = 1/116 (1%)
 Frame = +2

Query  62   KLIGGIPSRGCTADRP*SSEKGSSASIPVGTRKMVNYA*AGRSQRKLWWRPAAILTCKSF  241
            K+ GG  S   T DR   S K  S S+  GTRKM+NYA  GRSQ+K WWR   +LTCKS 
Sbjct  2    KVNGGGSSHERTVDRSRCSRKDLSTSMAGGTRKMLNYAWIGRSQKKFWWRLVVVLTCKSM  61

Query  242  V*LGYRGERLIEpssswfppkfpsG*LELAREFYRVKPMIRGIGGVTPSTYSQTLN  409
                Y GER IE SSSWF  KFPSG  +   +FY VK MIRG+GG TP TYSQTLN
Sbjct  62   TKSAYGGERPIEASSSWFLSKFPSG-KQYGTQFYEVKRMIRGLGGETPFTYSQTLN  116



>ref|XP_005773285.1| hypothetical protein EMIHUDRAFT_75086, partial [Emiliania huxleyi 
CCMP1516]
 ref|XP_005773289.1| hypothetical protein EMIHUDRAFT_75089, partial [Emiliania huxleyi 
CCMP1516]
 ref|XP_005790931.1| hypothetical protein EMIHUDRAFT_70248, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD20856.1| hypothetical protein EMIHUDRAFT_75086, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD20860.1| hypothetical protein EMIHUDRAFT_75089, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD38502.1| hypothetical protein EMIHUDRAFT_70248, partial [Emiliania huxleyi 
CCMP1516]
Length=101

 Score = 94.0 bits (232),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -1

Query  324  SSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            SSYPEGNFGGNQLLDGSISLSPLYP  TNDLHVSIA  LHQSFLWL P QA
Sbjct  51   SSYPEGNFGGNQLLDGSISLSPLYPDSTNDLHVSIATSLHQSFLWLHPTQA  101


 Score = 38.5 bits (88),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 31/64 (48%), Gaps = 23/64 (36%)
 Frame = -3

Query  538  RAVGHRNPASGSSRIASSAYQKWPTWSC*FRGAAQRSSRAVLPI*SLRIGRGRYAPDASN  359
            R +G+ + A GSSRIASSAYQKWPT                       +    ++P ASN
Sbjct  4    RTLGYLSAAFGSSRIASSAYQKWPT-----------------------LNAPCFSPQASN  40

Query  358  HWLY  347
            H LY
Sbjct  41   HSLY  44



>ref|XP_007132739.1| hypothetical protein PHAVU_011G120900g [Phaseolus vulgaris]
 gb|ESW04733.1| hypothetical protein PHAVU_011G120900g [Phaseolus vulgaris]
Length=99

 Score = 95.9 bits (237),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 49/53 (92%), Gaps = 0/53 (0%)
 Frame = -1

Query  330  ASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            ASSSYP+GNFGGNQLLD SIS SPLYPSQ NDLHVSIAAG+HQSFLWL PAQA
Sbjct  47   ASSSYPKGNFGGNQLLDSSISRSPLYPSQMNDLHVSIAAGVHQSFLWLPPAQA  99



>ref|XP_002450733.1| hypothetical protein SORBIDRAFT_05g016477 [Sorghum bicolor]
 gb|EES09721.1| hypothetical protein SORBIDRAFT_05g016477 [Sorghum bicolor]
Length=149

 Score = 94.0 bits (232),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = -3

Query  307  KLRREPATRRFD*SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPD  146
            KL+REPATR +D SFAPIPKSDERFARQY   PPPEFPLASPRSGIVHHLSGPD
Sbjct  2    KLQREPATRWYDKSFAPIPKSDERFARQYHFEPPPEFPLASPRSGIVHHLSGPD  55


 Score = 35.0 bits (79),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -1

Query  87   REGIPPISFLAPYGFTRPLTRTHVRLL  7
            REG+P +SFLA   F  P TRTHVRLL
Sbjct  75   REGLPLVSFLAHPRFQNPSTRTHVRLL  101



>ref|XP_005792707.1| hypothetical protein EMIHUDRAFT_77663, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD40278.1| hypothetical protein EMIHUDRAFT_77663, partial [Emiliania huxleyi 
CCMP1516]
Length=98

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/51 (88%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -1

Query  324  SSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            SSYPEGNFGGNQLLDGSISLSPLYP  TNDLHVSIA  LHQSFLWL P QA
Sbjct  48   SSYPEGNFGGNQLLDGSISLSPLYPDSTNDLHVSIATSLHQSFLWLHPTQA  98



>ref|XP_007413085.1| hypothetical protein MELLADRAFT_90063 [Melampsora larici-populina 
98AG31]
 gb|EGG03638.1| hypothetical protein MELLADRAFT_90063 [Melampsora larici-populina 
98AG31]
Length=171

 Score = 64.3 bits (155),  Expect(3) = 6e-20, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFL  193
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLHV  A   HQSFL
Sbjct  124  SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHVRTATSFHQSFL  171


 Score = 44.3 bits (103),  Expect(3) = 6e-20, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  60   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  92


 Score = 35.8 bits (81),  Expect(3) = 6e-20, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  99   HLNSAFGSSHIASSAYQKWPTKDFYSC  125



>ref|XP_007417441.1| hypothetical protein MELLADRAFT_94740 [Melampsora larici-populina 
98AG31]
 gb|EGF99313.1| hypothetical protein MELLADRAFT_94740 [Melampsora larici-populina 
98AG31]
Length=172

 Score = 64.3 bits (155),  Expect(3) = 7e-20, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFL  193
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLHV  A   HQSFL
Sbjct  125  SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHVRTATSFHQSFL  172


 Score = 44.3 bits (103),  Expect(3) = 7e-20, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  61   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  93


 Score = 35.8 bits (81),  Expect(3) = 7e-20, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  100  HLNSAFGSSHIASSAYQKWPTKDFYSC  126



>ref|XP_007411659.1| hypothetical protein MELLADRAFT_88128 [Melampsora larici-populina 
98AG31]
 ref|XP_007417434.1| hypothetical protein MELLADRAFT_94732 [Melampsora larici-populina 
98AG31]
 ref|XP_007417438.1| hypothetical protein MELLADRAFT_94737 [Melampsora larici-populina 
98AG31]
 ref|XP_007418755.1| hypothetical protein MELLADRAFT_84125 [Melampsora larici-populina 
98AG31]
 gb|EGF97978.1| hypothetical protein MELLADRAFT_84125 [Melampsora larici-populina 
98AG31]
 gb|EGF99316.1| hypothetical protein MELLADRAFT_94737 [Melampsora larici-populina 
98AG31]
 gb|EGF99319.1| hypothetical protein MELLADRAFT_94732 [Melampsora larici-populina 
98AG31]
 gb|EGG05294.1| hypothetical protein MELLADRAFT_88128 [Melampsora larici-populina 
98AG31]
Length=172

 Score = 64.3 bits (155),  Expect(3) = 7e-20, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFL  193
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLHV  A   HQSFL
Sbjct  125  SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHVRTATSFHQSFL  172


 Score = 44.3 bits (103),  Expect(3) = 7e-20, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  61   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  93


 Score = 35.4 bits (80),  Expect(3) = 7e-20, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  100  HLNSAFGSSHIASSAYQKWPTKDFYSC  126



>gb|KEH17021.1| senescence-associated protein [Medicago truncatula]
Length=1097

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/59 (93%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA TRTL +RS SVGGA
Sbjct  392  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYALTRTLHKRSGSVGGA  450


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFK  403
            VSAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA PSYLFK
Sbjct  345  VSAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPSYLFK  391



>gb|KIJ09669.1| hypothetical protein PAXINDRAFT_177522 [Paxillus involutus ATCC 
200175]
Length=120

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 54/70 (77%), Gaps = 3/70 (4%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPS---QKIK  108
            VRLVFRPYTQ+RR+ICTS SLRASTRVSSGF   RHSSPSFGS+  CS ++PS   Q + 
Sbjct  2    VRLVFRPYTQIRRSICTSESLRASTRVSSGFTLFRHSSPSFGSQHTCSTADPSSKTQHVN  61

Query  107  VGRRCTPVRG  78
            VGR   P RG
Sbjct  62   VGRGPEPSRG  71



>ref|XP_007419459.1| hypothetical protein MELLADRAFT_86114 [Melampsora larici-populina 
98AG31]
 gb|EGF97271.1| hypothetical protein MELLADRAFT_86114 [Melampsora larici-populina 
98AG31]
Length=241

 Score = 63.9 bits (154),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFL  193
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLHV  A   HQSFL
Sbjct  194  SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHVRTATSFHQSFL  241


 Score = 42.0 bits (97),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = -2

Query  641  IRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
            + + SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  131  LDKYSCYTLLSGFRLPWPPCGCLDELTPFVVS  162


 Score = 35.8 bits (81),  Expect(3) = 4e-19, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  169  HLNSAFGSSHIASSAYQKWPTKDFYSC  195



>gb|EGN91295.1| hypothetical protein SERLA73DRAFT_80747 [Serpula lacrymans var. 
lacrymans S7.3]
Length=159

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKIKVGR  99
            VRLVFRPYTQ+RR+ICTS SLRASTRVSSGF   RHSSPSFGS+   S + PSQK   GR
Sbjct  2    VRLVFRPYTQIRRSICTSESLRASTRVSSGFTLFRHSSPSFGSQHTRSTAGPSQKFWSGR  61

Query  98   RCTP  87
            RC P
Sbjct  62   RCPP  65



>gb|KDQ32287.1| hypothetical protein PLEOSDRAFT_1074527 [Pleurotus ostreatus 
PC15]
Length=89

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKIKVGR  99
            VRLVFRPYTQ+RR+ICTS SLRASTRVSSGFA  RHSSPSFGS+  CS + PS     GR
Sbjct  2    VRLVFRPYTQIRRSICTSESLRASTRVSSGFALFRHSSPSFGSQHTCSTAYPSVNFWYGR  61

Query  98   R  96
            R
Sbjct  62   R  62



>gb|KDQ32212.1| hypothetical protein PLEOSDRAFT_49049 [Pleurotus ostreatus PC15]
Length=86

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKIKVGR  99
            VRLVFRPYTQ+RR+ICTS SLRASTRVSSGFA  RHSSPSFGS+  CS + PS     GR
Sbjct  2    VRLVFRPYTQIRRSICTSESLRASTRVSSGFALFRHSSPSFGSQHTCSTAYPSVNFWYGR  61

Query  98   R  96
            R
Sbjct  62   R  62



>gb|ELU05225.1| hypothetical protein CAPTEDRAFT_108619, partial [Capitella teleta]
Length=53

 Score = 84.7 bits (208),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 42/49 (86%), Gaps = 0/49 (0%)
 Frame = -1

Query  318  YPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            YPEGNFGGNQLLDGSISLSPLY S T DLHV  AA LHQSF WLRPAQA
Sbjct  5    YPEGNFGGNQLLDGSISLSPLYTSLTIDLHVRTAAALHQSFPWLRPAQA  53



>gb|KIM34613.1| hypothetical protein M413DRAFT_160682 [Hebeloma cylindrosporum 
h7]
Length=53

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/52 (79%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = -1

Query  327  SSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            S  YPEGNFG NQLLDGSISLSPLYP+ T DLHV IA  LHQSFLWL P QA
Sbjct  2    SFCYPEGNFGRNQLLDGSISLSPLYPNLTIDLHVRIATSLHQSFLWLHPIQA  53



>gb|KEH17029.1| senescence-associated protein [Medicago truncatula]
Length=615

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 60/107 (56%), Gaps = 31/107 (29%)
 Frame = -1

Query  327  SSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIFRVP  148
            ++ YPEGNFGGNQ LDGSISLSPLYPSQTNDLHV   +   Q                  
Sbjct  374  TAGYPEGNFGGNQQLDGSISLSPLYPSQTNDLHVCSHSNPSQKI----------------  417

Query  147  TGMLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
                         G  A H R  IPPISFLAP GFT PLTRT+VRLL
Sbjct  418  -------------GVGATHKR--IPPISFLAPNGFTHPLTRTYVRLL  449



>ref|XP_001785975.1| predicted protein [Physcomitrella patens]
 gb|EDQ49215.1| predicted protein, partial [Physcomitrella patens]
Length=60

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/60 (85%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            SFAPIPKSDERFARQYR  PPPEFPLASP SGIVHHLSGP+RYA T+T  RRSRSV GAP
Sbjct  1    SFAPIPKSDERFARQYRYEPPPEFPLASPCSGIVHHLSGPNRYAHTQTFHRRSRSVDGAP  60



>emb|CDX99709.1| BnaC02g36110D [Brassica napus]
Length=199

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFKV  400
            VSAQLGTVTRLPVHPASPVLLTKNGPLGA+DSV  LN+AA PSYLFKV
Sbjct  152  VSAQLGTVTRLPVHPASPVLLTKNGPLGALDSVGWLNKAATPSYLFKV  199



>ref|XP_004208964.1| PREDICTED: uncharacterized protein LOC100197104 [Hydra vulgaris]
Length=136

 Score = 67.4 bits (163),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 59/128 (46%), Gaps = 45/128 (35%)
 Frame = -3

Query  520  NPASGSSRIASSAYQKWPTWSC*FRGAAQRSSRAVLPI*SLRIGRGRYAPDASNHWLYPI  341
            N A GSSRIASSAYQ WPT +        R+SRA                          
Sbjct  45   NSAFGSSRIASSAYQNWPTKNSHSVPYFNRASRA--------------------------  78

Query  340  ELSRQLQLS*GKLRREPATRRFD*SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHH  161
              S Q +                 SFAPI K D++FARQ R  PP EFPLASP S IVHH
Sbjct  79   --SYQFK-----------------SFAPILKFDDQFARQNRYEPPSEFPLASPYSSIVHH  119

Query  160  LSGPDRYA  137
             SGP+R A
Sbjct  120  HSGPNRCA  127


 Score = 48.1 bits (113),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  632  VSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLAR  534
            V CYTLLSGFRLP PPSCCL++ T FVGS   R
Sbjct  8    VCCYTLLSGFRLPWPPSCCLDQTTHFVGSDERR  40



>ref|XP_006279312.1| hypothetical protein CARUB_v10012753mg [Capsella rubella]
 gb|EOA12210.1| hypothetical protein CARUB_v10012753mg [Capsella rubella]
Length=92

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 42/45 (93%), Gaps = 1/45 (2%)
 Frame = -1

Query  141  MLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
            ML LEPFSEDQGRSAVHPR GIPPISFLAPYGFT PLTRTHVRLL
Sbjct  1    MLTLEPFSEDQGRSAVHPR-GIPPISFLAPYGFTHPLTRTHVRLL  44



>gb|KFZ88834.1| hypothetical protein Thpro_03127, partial [Thiobacillus prosperus]
Length=106

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/50 (88%), Positives = 46/50 (92%), Gaps = 1/50 (2%)
 Frame = -2

Query  218  LRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKIKVGRRCTPVRGSRQ  69
            +RASTRVSSGFAPLRHSSPSFGSRQ CSHSNPSQKIKVGRRCT  +GS Q
Sbjct  1    MRASTRVSSGFAPLRHSSPSFGSRQACSHSNPSQKIKVGRRCT-QKGSHQ  49



>ref|XP_007405670.1| hypothetical protein MELLADRAFT_92511 [Melampsora larici-populina 
98AG31]
 gb|EGG11068.1| hypothetical protein MELLADRAFT_92511 [Melampsora larici-populina 
98AG31]
Length=202

 Score = 51.6 bits (122),  Expect(3) = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 44/110 (40%), Gaps = 41/110 (37%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIF  157
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLH      L  +              
Sbjct  77   SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHTGRCCTLRIT--------------  122

Query  156  RVPTGMLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
                              S +H         F   +GF  P TR HVRLL
Sbjct  123  ------------------SEIH---------FHYAFGFQHPNTRKHVRLL  145


 Score = 44.7 bits (104),  Expect(3) = 2e-16, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
            +IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  13   VIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  45


 Score = 36.6 bits (83),  Expect(3) = 2e-16, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  52   HLNSAFGSSHIASSAYQKWPTKDFYSC  78



>gb|EMD31866.1| hypothetical protein CERSUDRAFT_162690 [Ceriporiopsis subvermispora 
B]
Length=108

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 0/67 (0%)
 Frame = +1

Query  55   RKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPKDGELCLSGAKPEETLVEARSDTDVQ  234
            R E++ RD   G HRRP L F +G   EH C DPKDGELCL+  KPEETLVEARSD+DVQ
Sbjct  42   RNESEGRDLCHGGHRRPDLKFSDGSAVEHVCWDPKDGELCLNRVKPEETLVEARSDSDVQ  101

Query  235  IVRLTWV  255
            I R  WV
Sbjct  102  IDRQIWV  108



>ref|XP_009016464.1| hypothetical protein HELRODRAFT_92454, partial [Helobdella robusta]
 gb|ESO05439.1| hypothetical protein HELRODRAFT_92454, partial [Helobdella robusta]
Length=94

 Score = 67.8 bits (164),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -1

Query  294  NQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            NQLLDGSISLSPLYP+ T DLHV IA  LHQSFLWL P QA
Sbjct  54   NQLLDGSISLSPLYPNLTIDLHVRIATSLHQSFLWLHPIQA  94


 Score = 38.9 bits (89),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 18/25 (72%), Gaps = 0/25 (0%)
 Frame = -3

Query  538  RAVGHRNPASGSSRIASSAYQKWPT  464
            R   H N   GSSRIASSAYQKWPT
Sbjct  4    RVFRHLNFTFGSSRIASSAYQKWPT  28


 Score = 25.8 bits (55),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 0/21 (0%)
 Frame = -2

Query  440  GSTKQPRRPTYLKFENRSRAL  378
             S K+  R TYLKFENR++ L
Sbjct  37   ASIKKTWRLTYLKFENRNQLL  57



>ref|XP_007419023.1| hypothetical protein MELLADRAFT_84531 [Melampsora larici-populina 
98AG31]
 gb|EGF97700.1| hypothetical protein MELLADRAFT_84531 [Melampsora larici-populina 
98AG31]
Length=314

 Score = 51.6 bits (122),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 44/110 (40%), Gaps = 41/110 (37%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIF  157
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLH      L  +              
Sbjct  125  SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHTGRCCTLRIT--------------  170

Query  156  RVPTGMLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
                              S +H         F   +GF  P TR HVRLL
Sbjct  171  ------------------SEIH---------FHYAFGFQHPNTRKHVRLL  193


 Score = 44.3 bits (103),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  61   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  93


 Score = 35.8 bits (81),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  100  HLNSAFGSSHIASSAYQKWPTKDFYSC  126



>ref|XP_007415539.1| hypothetical protein MELLADRAFT_92706 [Melampsora larici-populina 
98AG31]
 gb|EGG01189.1| hypothetical protein MELLADRAFT_92706 [Melampsora larici-populina 
98AG31]
Length=289

 Score = 51.2 bits (121),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 44/110 (40%), Gaps = 41/110 (37%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIF  157
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLH      L  +              
Sbjct  125  SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHTGRCCTLRIT--------------  170

Query  156  RVPTGMLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
                              S +H         F   +GF  P TR HVRLL
Sbjct  171  ------------------SEIH---------FHYAFGFQHPNTRKHVRLL  193


 Score = 44.7 bits (104),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  61   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  93


 Score = 35.8 bits (81),  Expect(3) = 3e-16, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  100  HLNSAFGSSHIASSAYQKWPTKDFYSC  126



>ref|XP_007417426.1| hypothetical protein MELLADRAFT_94723 [Melampsora larici-populina 
98AG31]
 gb|EGF99326.1| hypothetical protein MELLADRAFT_94723 [Melampsora larici-populina 
98AG31]
Length=244

 Score = 51.2 bits (121),  Expect(3) = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 44/110 (40%), Gaps = 41/110 (37%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIF  157
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLH      L  +              
Sbjct  125  SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHTGQCCTLRIT--------------  170

Query  156  RVPTGMLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
                              S +H         F   +GF  P TR HVRLL
Sbjct  171  ------------------SEIH---------FHYAFGFQHPNTRKHVRLL  193


 Score = 44.3 bits (103),  Expect(3) = 5e-16, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  61   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  93


 Score = 35.8 bits (81),  Expect(3) = 5e-16, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  100  HLNSAFGSSHIASSAYQKWPTKDFYSC  126



>gb|ACG27665.1| hypothetical protein [Zea mays]
 gb|ACG30028.1| hypothetical protein [Zea mays]
Length=40

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = +1

Query  502  MNRKPGYGAQLRANLDPTKGVGRLRQQDGGHGSRNPLRSV  621
            MNRKPGYGA+LRANL+PTKGVGRLRQQDGGHGSRNPLRSV
Sbjct  1    MNRKPGYGAKLRANLEPTKGVGRLRQQDGGHGSRNPLRSV  40



>ref|XP_007414632.1| hypothetical protein MELLADRAFT_91701 [Melampsora larici-populina 
98AG31]
 gb|EGG02095.1| hypothetical protein MELLADRAFT_91701 [Melampsora larici-populina 
98AG31]
Length=250

 Score = 50.8 bits (120),  Expect(3) = 5e-16, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGL  208
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLH      L
Sbjct  125  SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHTGRCCTL  167


 Score = 44.3 bits (103),  Expect(3) = 5e-16, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  61   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  93


 Score = 35.8 bits (81),  Expect(3) = 5e-16, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  100  HLNSAFGSSHIASSAYQKWPTKDFYSC  126



>ref|XP_002489152.1| hypothetical protein SORBIDRAFT_0016s002240 [Sorghum bicolor]
 gb|EES20332.1| hypothetical protein SORBIDRAFT_0016s002240 [Sorghum bicolor]
Length=220

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            SFAPIPKSDERFARQYR  PPPEFPLASPRSGIVHHLSGPDR A TRTL RRS S  GA 
Sbjct  1    SFAPIPKSDERFARQYRFEPPPEFPLASPRSGIVHHLSGPDRRAPTRTLHRRSGSASGAA  60

Query  88   P*GDPANQLPCALRVYSPVDSHTCQTPGP  2
              G P        R  +P      +  GP
Sbjct  61   REGLPLVSFLAHPRFQNPSTRTHVRLLGP  89



>gb|KIK49843.1| hypothetical protein GYMLUDRAFT_78612 [Gymnopus luxurians FD-317 
M1]
Length=243

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -1

Query  321  SYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
             YPEGNFG NQLLDGSISLSPLYP+ T DLHV IA  LHQSFLWL P QA
Sbjct  194  CYPEGNFGRNQLLDGSISLSPLYPNSTIDLHVRIATSLHQSFLWLHPIQA  243


 Score = 48.9 bits (115),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  632  VSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
            VSCYTLLSGFRLP PPSCCL+  TPFV S
Sbjct  129  VSCYTLLSGFRLPWPPSCCLDELTPFVVS  157


 Score = 38.9 bits (89),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  538  RAVGHRNPASGSSRIASSAYQKWPT  464
            R   H N A GSSRIASSAYQKWPT
Sbjct  160  REFRHLNLAFGSSRIASSAYQKWPT  184



>ref|XP_007416288.1| hypothetical protein MELLADRAFT_93283 [Melampsora larici-populina 
98AG31]
 ref|XP_007417782.1| hypothetical protein MELLADRAFT_95026 [Melampsora larici-populina 
98AG31]
 gb|EGF98956.1| hypothetical protein MELLADRAFT_95026 [Melampsora larici-populina 
98AG31]
 gb|EGG00442.1| hypothetical protein MELLADRAFT_93283 [Melampsora larici-populina 
98AG31]
Length=209

 Score = 50.8 bits (120),  Expect(3) = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 44/110 (40%), Gaps = 41/110 (37%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIF  157
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLH      L  +              
Sbjct  125  SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHTGRCCTLRIT--------------  170

Query  156  RVPTGMLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
                              S +H         F   +GF  P TR HVRLL
Sbjct  171  ------------------SEIH---------FHYAFGFQHPNTRKHVRLL  193


 Score = 44.3 bits (103),  Expect(3) = 7e-16, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  61   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  93


 Score = 35.4 bits (80),  Expect(3) = 7e-16, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  100  HLNSAFGSSHIASSAYQKWPTKDFYSC  126



>gb|AFK36149.1| unknown [Lotus japonicus]
Length=40

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/40 (98%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +1

Query  502  MNRKPGYGAQLRANLDPTKGVGRLRQQDGGHGSRNPLRSV  621
            MNRK GYGAQLRANLDPTKGVGRLRQQDGGHGSRNPLRSV
Sbjct  1    MNRKLGYGAQLRANLDPTKGVGRLRQQDGGHGSRNPLRSV  40



>gb|ADI72904.1| hypothetical protein, partial [Ophiocordyceps unilateralis]
Length=74

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            SFAPIPK D+RFARQ RC PPPEFPLASP SGIVHHLSGP+ YA T+   R S SV GAP
Sbjct  1    SFAPIPKFDDRFARQNRCEPPPEFPLASPYSGIVHHLSGPNSYALTQIHPRTSGSVDGAP  60



>gb|KEH17348.1| hypothetical protein MTR_0021s0160 [Medicago truncatula]
Length=514

 Score = 63.5 bits (153),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 40/78 (51%), Gaps = 35/78 (45%)
 Frame = -1

Query  321  SYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIFRVPTG  142
            SYPEGNFGGNQLLDGSISLSPLYPS                                   
Sbjct  28   SYPEGNFGGNQLLDGSISLSPLYPS-----------------------------------  52

Query  141  MLALEPFSEDQGRSAVHP  88
            +L LEPF+EDQGR AV P
Sbjct  53   VLQLEPFTEDQGRPAVRP  70


 Score = 46.6 bits (109),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -2

Query  473  MAHLELLIPWRGSTKQPRRPTYLKFEN  393
            MAHLE  IPW GS KQP  PTYLKFEN
Sbjct  1    MAHLEHPIPWHGSPKQPSHPTYLKFEN  27



>ref|XP_006405910.1| hypothetical protein EUTSA_v10028284mg [Eutrema salsugineum]
 ref|XP_006405914.1| hypothetical protein EUTSA_v10028221mg [Eutrema salsugineum]
 ref|XP_006405920.1| hypothetical protein EUTSA_v10028160mg [Eutrema salsugineum]
 gb|ESQ47363.1| hypothetical protein EUTSA_v10028284mg [Eutrema salsugineum]
 gb|ESQ47367.1| hypothetical protein EUTSA_v10028221mg [Eutrema salsugineum]
 gb|ESQ47373.1| hypothetical protein EUTSA_v10028160mg [Eutrema salsugineum]
Length=83

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/39 (97%), Positives = 39/39 (100%), Gaps = 0/39 (0%)
 Frame = +1

Query  502  MNRKPGYGAQLRANLDPTKGVGRLRQQDGGHGSRNPLRS  618
            MNRKPGYGAQLRANL+PTKGVGRLRQQDGGHGSRNPLRS
Sbjct  1    MNRKPGYGAQLRANLEPTKGVGRLRQQDGGHGSRNPLRS  39



>ref|XP_007410495.1| hypothetical protein MELLADRAFT_87416 [Melampsora larici-populina 
98AG31]
 gb|EGG06257.1| hypothetical protein MELLADRAFT_87416 [Melampsora larici-populina 
98AG31]
Length=209

 Score = 50.8 bits (120),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 44/110 (40%), Gaps = 41/110 (37%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIF  157
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLH      L  +              
Sbjct  125  SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHTGRCCTLRIT--------------  170

Query  156  RVPTGMLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
                              S +H         F   +GF  P TR HVRLL
Sbjct  171  ------------------SEIH---------FHYAFGFQHPNTRKHVRLL  193


 Score = 44.3 bits (103),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  61   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  93


 Score = 34.3 bits (77),  Expect(3) = 2e-15, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 19/27 (70%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N   GSS IASSAYQKWPT   +SC
Sbjct  100  HLNSVFGSSHIASSAYQKWPTKDFYSC  126



>ref|XP_007682037.1| hypothetical protein BAUCODRAFT_57269, partial [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC90812.1| hypothetical protein BAUCODRAFT_57269, partial [Baudoinia compniacensis 
UAMH 10762]
Length=60

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPK D+RFARQ RC PPPEFPLASP SGIVHHLSGP+ YA T+   + S SV GA
Sbjct  1    SFAPIPKFDDRFARQNRCEPPPEFPLASPYSGIVHHLSGPNSYALTQIHPKTSGSVDGA  59



>ref|XP_006455542.1| hypothetical protein AGABI2DRAFT_121457 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV44281.1| hypothetical protein AGABI2DRAFT_121457 [Agaricus bisporus var. 
bisporus H97]
Length=152

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 65/134 (49%), Gaps = 51/134 (38%)
 Frame = -3

Query  538  RAVGHRNPASGSSRIASSAYQKWPTWSC*FRGAAQRSSRAVLPI*SLRIGRGRYAPDASN  359
            R   H N A GSSRIASSAYQKWPT                         R   +P  S 
Sbjct  19   REFRHLNLAFGSSRIASSAYQKWPT-------------------------RNSQSPSGS-  52

Query  358  HWLYPIELSRQLQLS*GKLRREPATRRFD*SFAPIPKSDERFARQYRCGPPPEFPLASPR  179
                   + ++L                  SFAPIPK D+RFARQ R  PPPEFPLASP 
Sbjct  53   -------IKKRL------------------SFAPIPKFDDRFARQNRYEPPPEFPLASPY  87

Query  178  SGIVHHLSGPDRYA  137
            SGIVHHLSGP+ +A
Sbjct  88   SGIVHHLSGPNIHA  101



>ref|XP_006405917.1| hypothetical protein EUTSA_v10028144mg [Eutrema salsugineum]
 gb|ESQ47370.1| hypothetical protein EUTSA_v10028144mg [Eutrema salsugineum]
Length=71

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/40 (93%), Positives = 40/40 (100%), Gaps = 0/40 (0%)
 Frame = +1

Query  502  MNRKPGYGAQLRANLDPTKGVGRLRQQDGGHGSRNPLRSV  621
            MNRKPGYGAQLRANL+PTKGVGRLRQQDGGHGSRNPLR++
Sbjct  1    MNRKPGYGAQLRANLEPTKGVGRLRQQDGGHGSRNPLRNL  40



>ref|XP_002488918.1| hypothetical protein SORBIDRAFT_1836s002010 [Sorghum bicolor]
 gb|EES20352.1| hypothetical protein SORBIDRAFT_1836s002010 [Sorghum bicolor]
Length=57

 Score = 73.2 bits (178),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  511  KPGYGAQLRANLDPTKGVGRLRQQDGGHGSRNPLRSV  621
            KPGYGA+LRANL+PTKGVGRLRQQDGGHGSRNPLRSV
Sbjct  21   KPGYGAKLRANLEPTKGVGRLRQQDGGHGSRNPLRSV  57


 Score = 35.8 bits (81),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 17/18 (94%), Positives = 17/18 (94%), Gaps = 0/18 (0%)
 Frame = +2

Query  449  ESTAPSGPFLVSRTGDAG  502
            ES APSGPFLVSRTGDAG
Sbjct  2    ESGAPSGPFLVSRTGDAG  19



>ref|XP_003851049.1| hypothetical protein MYCGRDRAFT_45572, partial [Zymoseptoria 
tritici IPO323]
 ref|XP_003851055.1| hypothetical protein MYCGRDRAFT_45273, partial [Zymoseptoria 
tritici IPO323]
 gb|EGP86025.1| hypothetical protein MYCGRDRAFT_45572 [Zymoseptoria tritici IPO323]
 gb|EGP86031.1| hypothetical protein MYCGRDRAFT_45273 [Zymoseptoria tritici IPO323]
Length=72

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPK D+RFARQ RC PPPEFPLASP SGIVHHLSGP+ YA T+   R S SV GA
Sbjct  1    SFAPIPKFDDRFARQNRCEPPPEFPLASPYSGIVHHLSGPNSYALTQIHPRTSGSVDGA  59



>dbj|GAA49464.1| hypothetical protein CLF_103095 [Clonorchis sinensis]
Length=55

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  327  SSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            ++SYP+G++ GNQLLDGSI LSPLY   T DLHV IAA LHQSFLWL+PAQ 
Sbjct  4    NTSYPDGHYRGNQLLDGSIGLSPLYSRLTIDLHVRIAAVLHQSFLWLQPAQT  55



>gb|ETW38010.1| hypothetical protein PFTANZ_01288 [Plasmodium falciparum Tanzania 
(2000708)]
Length=83

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +3

Query  495  MRDEPEAGLRCPTAR*PRSHKGCWSIKTAGRWSWKSKSAKECVTTHLPNQL  647
            MRD P A +RC      RSHK CW I T GRWSWKSKSAKECVTTHLPN+L
Sbjct  1    MRDAPNAWIRCLNYSLMRSHKRCWFIMTVGRWSWKSKSAKECVTTHLPNEL  51



>gb|KIM92488.1| hypothetical protein OIDMADRAFT_139572, partial [Oidiodendron 
maius Zn]
 gb|KIN06739.1| hypothetical protein OIDMADRAFT_111751, partial [Oidiodendron 
maius Zn]
Length=81

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            SFAP+PK D+RFARQ RC PPPEFPLASP SGIVHHLSGP+ YA T+   + S SV  AP
Sbjct  1    SFAPMPKFDDRFARQNRCEPPPEFPLASPYSGIVHHLSGPNSYALTQIHPKTSGSVDDAP  60



>ref|WP_037545229.1| hypothetical protein, partial [Spirochaeta sp. JC230]
Length=67

 Score = 76.6 bits (187),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +1

Query  136  EHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV*GRKTNRTV  282
            EHTC DPKDGELCL   K EETL+E RSDTDVQIVR  WV GRKTNRT+
Sbjct  19   EHTCWDPKDGELCLGRLKSEETLMEDRSDTDVQIVRRIWVLGRKTNRTI  67



>gb|EME38016.1| hypothetical protein DOTSEDRAFT_101619, partial [Dothistroma 
septosporum NZE10]
Length=54

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 39/44 (89%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ RC PPPEFPLASP SGIVHHLSGP+ YA
Sbjct  1    SFAPIPKFDDRFARQNRCEPPPEFPLASPYSGIVHHLSGPNSYA  44



>ref|XP_007419020.1| hypothetical protein MELLADRAFT_84525 [Melampsora larici-populina 
98AG31]
 gb|EGF97697.1| hypothetical protein MELLADRAFT_84525 [Melampsora larici-populina 
98AG31]
Length=347

 Score = 45.4 bits (106),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 43/110 (39%), Gaps = 41/110 (37%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIF  157
            S  SS   +GNF GNQLLDG ISLSPL+P  T +LH      L  +              
Sbjct  263  SCTSSIKKQGNFSGNQLLDGLISLSPLHPDSTINLHTGRCCTLRIT--------------  308

Query  156  RVPTGMLALEPFSEDQGRSAVHPREGIPPISFLAPYGFTRPLTRTHVRLL  7
                              S +H         F   +GF  P TR HVRLL
Sbjct  309  ------------------SEIH---------FHYAFGFQHPNTRKHVRLL  331


 Score = 44.7 bits (104),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  199  FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  231


 Score = 35.8 bits (81),  Expect(3) = 2e-14, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  238  HLNSAFGSSHIASSAYQKWPTKDFYSC  264



>dbj|BAD46202.1| hypothetical protein [Oryza sativa Japonica Group]
Length=248

 Score = 63.2 bits (152),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  265  FAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPD  146
              PIPKSD+RF RQYR  PP +FPL SPRS I+HHLSGPD
Sbjct  36   LIPIPKSDKRFVRQYRFEPPLDFPLTSPRSSIIHHLSGPD  75


 Score = 42.4 bits (98),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  333  RASSSYPEGNFGGNQLLDGSISLSPL  256
            + +  YPEGNFGGNQLLDGSI L P+
Sbjct  14   KEADDYPEGNFGGNQLLDGSIGLIPI  39



>dbj|GAA96381.1| hypothetical protein E5Q_03048 [Mixia osmundae IAM 14324]
Length=98

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            +RAS ++ +GNFG NQL DGSISLSPLYP+ T DLHV  A  LHQSFLWL P QA
Sbjct  45   TRASDTF-KGNFGRNQLPDGSISLSPLYPNLTIDLHVRTATSLHQSFLWLHPIQA  98



>gb|KEI39782.1| hypothetical protein L969DRAFT_47306 [Mixia osmundae IAM 14324]
Length=94

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/55 (69%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
            +RAS ++ +GNFG NQL DGSISLSPLYP+ T DLHV  A  LHQSFLWL P QA
Sbjct  41   TRASDTF-KGNFGRNQLPDGSISLSPLYPNLTIDLHVRTATSLHQSFLWLHPIQA  94



>gb|EFX62989.1| hypothetical protein DAPPUDRAFT_37179 [Daphnia pulex]
Length=105

 Score = 70.9 bits (172),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQKIKVGR  99
            VRLVFRPYTQ+RR+ICTS SLR+S RVS  F   RHSSPSFGS++VCS  +   ++   R
Sbjct  2    VRLVFRPYTQLRRSICTSESLRSSIRVSPDFNLARHSSPSFGSQRVCSCCSARCEVAAKR  61

Query  98   R  96
            R
Sbjct  62   R  62


 Score = 33.5 bits (75),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 16/22 (73%), Gaps = 0/22 (0%)
 Frame = -1

Query  72  PISFLAPYGFTRPLTRTHVRLL  7
           P +F AP G  RP+ RTHVRLL
Sbjct  77  PFAFTAPLGLVRPMARTHVRLL  98



>ref|XP_009846274.1| hypothetical protein H257_18840, partial [Aphanomyces astaci]
 gb|ETV64240.1| hypothetical protein H257_18840, partial [Aphanomyces astaci]
Length=201

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 75/165 (45%), Gaps = 55/165 (33%)
 Frame = -3

Query  583  PAVLIDQHPLWDLG*RAVGHRNPASGSSRIASSAYQKWPTWSC*FRGAAQRSSRAVLPI*  404
            P V+ D+ PL         H NPA GSSRIASSAYQKWPT                    
Sbjct  66   PFVVSDERPL--------RHLNPAFGSSRIASSAYQKWPT--------------------  97

Query  403  SLRIGRGRYAPDASNHWLYPIELSRQLQLS*GKLRREPATRRFD*SFAPIPKSDERFARQ  224
                  G +       W+              K ++ P       SFAP+ + D+RFARQ
Sbjct  98   ----SVGTFE---CPQWM--------------KAKKRPR------SFAPMLRFDDRFARQ  130

Query  223  YRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
             RC PPPEFPLASP   IVHHLSGP   A T+     S SV  AP
Sbjct  131  NRCEPPPEFPLASPYPSIVHHLSGPRLNALTQIHPNTSGSVDDAP  175


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = -2

Query  641  IRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
            IRQVSCYT+LSGFRLP PPSCC +  TPFV S
Sbjct  39   IRQVSCYTVLSGFRLPWPPSCCQDVLTPFVVS  70



>ref|WP_029759542.1| hypothetical protein [Fusobacterium nucleatum]
Length=68

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +1

Query  121  EGFECEHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV  255
            E FECEHTC DPKDGELCLS AKP ETLVE RSD++VQI R TWV
Sbjct  24   ERFECEHTCWDPKDGELCLSRAKPGETLVEVRSDSNVQIDRRTWV  68



>ref|XP_011116925.1| hypothetical protein H072_8238 [Dactylellina haptotyla CBS 200.50]
 gb|EPS38042.1| hypothetical protein H072_8238 [Dactylellina haptotyla CBS 200.50]
Length=73

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 47/76 (62%), Gaps = 20/76 (26%)
 Frame = +1

Query  94   HRRPTLIF*EGFECEHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV*GRKTN  273
            H RP L+F +GFE E +C DPKDGELCL+  KPEETLVEARS +D               
Sbjct  12   HHRPILMFSDGFEYERSCWDPKDGELCLNRVKPEETLVEARSGSD---------------  56

Query  274  RTV**LVPSEVSLRIA  321
                 LVP+EVSLRIA
Sbjct  57   -----LVPAEVSLRIA  67



>ref|XP_009030137.1| hypothetical protein HELRODRAFT_70460, partial [Helobdella robusta]
 gb|ESN91276.1| hypothetical protein HELRODRAFT_70460, partial [Helobdella robusta]
Length=62

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ RCGPPPEFPLAS  SGIVHHLSGP+  A
Sbjct  1    SFAPIPKFDDRFARQNRCGPPPEFPLASSCSGIVHHLSGPNACA  44



>gb|EJU02318.1| hypothetical protein DACRYDRAFT_51410, partial [Dacryopinax sp. 
DJM-731 SS1]
Length=50

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ YA
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIYA  44



>gb|KFM56506.1| hypothetical protein X975_24482, partial [Stegodyphus mimosarum]
Length=111

 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  125  GSSASIPVGTRKMVNYA*AGRSQRKLWWRPAAILTCKSFV*LGYRGERLIE  277
            G S S+ VGTRKMVNYA AGR QRKLWWR  A+LTCKS V  G RGERLIE
Sbjct  48   GRSMSVHVGTRKMVNYARAGRGQRKLWWRSVAVLTCKSIVRSGPRGERLIE  98



>ref|XP_007418897.1| hypothetical protein MELLADRAFT_84215 [Melampsora larici-populina 
98AG31]
 gb|EGF97827.1| hypothetical protein MELLADRAFT_84215 [Melampsora larici-populina 
98AG31]
Length=255

 Score = 58.2 bits (139),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 54/133 (41%), Gaps = 58/133 (44%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC*FRGAAQRSSRAVLPI*SLRIGRGRYAPDASNH  356
            H N A GSS IASSAYQKWPT   +SC                 +  I +  +AP     
Sbjct  41   HLNSAFGSSHIASSAYQKWPTKDFYSC-----------------TSSIKKQSFAP-----  78

Query  355  WLYPIELSRQLQLS*GKLRREPATRRFD*SFAPIPKSDERFARQYRCGPPPEFPLASPRS  176
                                             IP+  +RFARQ R   P EFPL SP  
Sbjct  79   ---------------------------------IPRFYDRFARQNRYELPSEFPLTSPYP  105

Query  175  GIVHHLSGPDRYA  137
            GIVHHLSGP+  A
Sbjct  106  GIVHHLSGPNILA  118


 Score = 43.5 bits (101),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTL SGFRLP PP  CL+  TPFV S
Sbjct  2    FIRPLSCYTLFSGFRLPWPPCGCLDELTPFVVS  34



>ref|XP_007405673.1| hypothetical protein MELLADRAFT_92517 [Melampsora larici-populina 
98AG31]
 gb|EGG11071.1| hypothetical protein MELLADRAFT_92517 [Melampsora larici-populina 
98AG31]
Length=198

 Score = 57.0 bits (136),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 54/133 (41%), Gaps = 58/133 (44%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC*FRGAAQRSSRAVLPI*SLRIGRGRYAPDASNH  356
            H N A GSS IASSAYQKWPT   +SC                 +  I +  +AP     
Sbjct  100  HLNSAFGSSHIASSAYQKWPTKDFYSC-----------------TSSIKKQSFAP-----  137

Query  355  WLYPIELSRQLQLS*GKLRREPATRRFD*SFAPIPKSDERFARQYRCGPPPEFPLASPRS  176
                                             IP+  +RFARQ R   P EFPL SP  
Sbjct  138  ---------------------------------IPRFYDRFARQNRYELPSEFPLTSPYP  164

Query  175  GIVHHLSGPDRYA  137
            GIVHHLSGP+  A
Sbjct  165  GIVHHLSGPNILA  177


 Score = 44.3 bits (103),  Expect(2) = 4e-13, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  61   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  93



>ref|WP_032484877.1| hypothetical protein [Yersinia pestis]
Length=67

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  SASIPVGTRKMVNYA*AGRSQRKLWWRPAAILTCKSFV*LGYRGERLIE  277
            S S  V TRKMVNYA AGRSQRKLWWR  A+LTCKS V  GYRGERLIE
Sbjct  6    STSARVRTRKMVNYAWAGRSQRKLWWRSVAVLTCKSVVRPGYRGERLIE  54



>gb|KDQ05627.1| hypothetical protein BOTBODRAFT_122476, partial [Botryobasidium 
botryosum FD-172 SS1]
Length=83

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A  R   RRS +  GAP
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNMHALPRARRRRSATGVGAP  60

Query  88   P*GDPANQLPCALRVYSPVDSHTC  17
              G P           SP  S TC
Sbjct  61   RKGFPTITF-ITRSGLSPKHSQTC  83



>gb|KGG52127.1| hypothetical protein DI09_206p20 [Microsporidia sp. UGP3]
Length=144

 Score = 73.6 bits (179),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  280  RFD*SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            R   SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ YA
Sbjct  52   RLRSSFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNTYA  99



>gb|AAX26869.1| unknown [Schistosoma japonicum]
Length=102

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  SASIPVGTRKMVNYA*AGRSQRKLWWRPAAILTCKSFV*LGYRGERLIE  277
            S S  V TRKMVNYA AGRSQRKLWWR  A+LTCKS V  GYRGERLIE
Sbjct  41   STSARVRTRKMVNYAWAGRSQRKLWWRSVAVLTCKSVVRPGYRGERLIE  89



>gb|KIM19404.1| hypothetical protein M408DRAFT_231258 [Serendipita vermifera 
MAFF 305830]
Length=65

 Score = 71.2 bits (173),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  91   VHRRPTLIF*EGFECEHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV  255
            VHRRP   F +    E  C DPKDGELCL+  KPEETLVEARSD+DVQI R  WV
Sbjct  11   VHRRPEQTFCDASAVERICWDPKDGELCLNRVKPEETLVEARSDSDVQIDRQIWV  65



>ref|XP_001617522.1| hypothetical protein NEMVEDRAFT_v1g157418 [Nematostella vectensis]
 ref|XP_001617998.1| hypothetical protein NEMVEDRAFT_v1g156102, partial [Nematostella 
vectensis]
 ref|XP_001619497.1| hypothetical protein NEMVEDRAFT_v1g151180, partial [Nematostella 
vectensis]
 ref|XP_001619525.1| hypothetical protein NEMVEDRAFT_v1g151074, partial [Nematostella 
vectensis]
 ref|XP_001619588.1| hypothetical protein NEMVEDRAFT_v1g150899, partial [Nematostella 
vectensis]
 ref|XP_001619991.1| hypothetical protein NEMVEDRAFT_v1g149572, partial [Nematostella 
vectensis]
 ref|XP_001620113.1| hypothetical protein NEMVEDRAFT_v1g149125, partial [Nematostella 
vectensis]
 ref|XP_001621197.1| hypothetical protein NEMVEDRAFT_v1g145709, partial [Nematostella 
vectensis]
 ref|XP_001621427.1| hypothetical protein NEMVEDRAFT_v1g144945, partial [Nematostella 
vectensis]
 ref|XP_001622068.1| hypothetical protein NEMVEDRAFT_v1g142631, partial [Nematostella 
vectensis]
 ref|XP_001622108.1| predicted protein, partial [Nematostella vectensis]
 ref|XP_001622477.1| predicted protein, partial [Nematostella vectensis]
 ref|XP_001623986.1| predicted protein, partial [Nematostella vectensis]
 ref|XP_001624574.1| predicted protein, partial [Nematostella vectensis]
 ref|XP_001624692.1| predicted protein, partial [Nematostella vectensis]
 ref|XP_001624694.1| predicted protein, partial [Nematostella vectensis]
 ref|XP_001624696.1| predicted protein, partial [Nematostella vectensis]
 ref|XP_001625710.1| predicted protein, partial [Nematostella vectensis]
 ref|XP_001626302.1| predicted protein, partial [Nematostella vectensis]
 ref|XP_001626304.1| predicted protein [Nematostella vectensis]
 ref|XP_001639018.1| predicted protein, partial [Nematostella vectensis]
 ref|XP_001618805.1| hypothetical protein NEMVEDRAFT_v1g153280, partial [Nematostella 
vectensis]
 ref|XP_001618892.1| hypothetical protein NEMVEDRAFT_v1g153006, partial [Nematostella 
vectensis]
 gb|EDO25422.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO25898.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO26705.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO26792.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO27397.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO27425.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO27488.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO27891.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO28013.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO29097.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO29327.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO29968.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO30008.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO30377.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO31886.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO32474.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO32592.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO32594.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO32596.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO33610.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO34202.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO34204.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO46955.1| predicted protein, partial [Nematostella vectensis]
Length=53

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+R A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNRCA  44



>ref|XP_007373419.1| hypothetical protein SPAPADRAFT_134376, partial [Spathaspora 
passalidarum NRRL Y-27907]
 gb|EGW33835.1| hypothetical protein SPAPADRAFT_134376, partial [Spathaspora 
passalidarum NRRL Y-27907]
Length=81

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            SFAPIPK D+RFARQ R  PPPEFP ASP SGIVHHLSGP+ YA T+   + S SV  AP
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPSASPYSGIVHHLSGPNSYALTQIHPKTSGSVDDAP  60



>ref|XP_006676538.1| hypothetical protein BATDEDRAFT_9655, partial [Batrachochytrium 
dendrobatidis JAM81]
 ref|XP_006678322.1| hypothetical protein BATDEDRAFT_10945, partial [Batrachochytrium 
dendrobatidis JAM81]
 ref|XP_006678337.1| hypothetical protein BATDEDRAFT_11060, partial [Batrachochytrium 
dendrobatidis JAM81]
 ref|XP_006680240.1| hypothetical protein BATDEDRAFT_12531 [Batrachochytrium dendrobatidis 
JAM81]
 ref|XP_006680241.1| hypothetical protein BATDEDRAFT_12535 [Batrachochytrium dendrobatidis 
JAM81]
 ref|XP_006681341.1| hypothetical protein BATDEDRAFT_13675 [Batrachochytrium dendrobatidis 
JAM81]
 ref|XP_006682942.1| hypothetical protein BATDEDRAFT_14869 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76344.1| hypothetical protein BATDEDRAFT_14869 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78069.1| hypothetical protein BATDEDRAFT_13675 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78784.1| hypothetical protein BATDEDRAFT_12535 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79151.1| hypothetical protein BATDEDRAFT_12531 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80571.1| hypothetical protein BATDEDRAFT_11060 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80575.1| hypothetical protein BATDEDRAFT_10945 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82910.1| hypothetical protein BATDEDRAFT_9655, partial [Batrachochytrium 
dendrobatidis JAM81]
Length=100

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ YA
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNMYA  44



>ref|WP_000385345.1| hypothetical protein, partial [Bacillus cereus]
Length=83

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -3

Query  265  FAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            FAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ YA T+   + S SV  AP
Sbjct  1    FAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNSYALTQIHPKTSGSVDCAP  59



>ref|XP_001383615.2| hypothetical protein PICST_56758 [Scheffersomyces stipitis CBS 
6054]
 gb|ABN65586.2| predicted protein, partial [Scheffersomyces stipitis CBS 6054]
Length=81

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFP ASP SGIVHHLSGP+ YA
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPSASPYSGIVHHLSGPNSYA  44



>ref|WP_044794659.1| hypothetical protein, partial [Campylobacter jejuni]
 gb|KJD20933.1| hypothetical protein TM01_09170, partial [Campylobacter jejuni 
subsp. jejuni]
Length=110

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/49 (78%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  131  SASIPVGTRKMVNYA*AGRSQRKLWWRPAAILTCKSFV*LGYRGERLIE  277
            S S  V TRKMVNYA AGRSQRKLWWR  A+LTCKS V  GYRGERLIE
Sbjct  49   SMSARVRTRKMVNYAWAGRSQRKLWWRSVAVLTCKSVVRPGYRGERLIE  97



>gb|KIL53776.1| hypothetical protein M378DRAFT_293576 [Amanita muscaria Koide 
BX008]
Length=62

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  13   SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  56



>ref|XP_003370414.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003370381.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003369857.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003368945.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003368944.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003368941.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003368819.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003368734.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003368403.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003368297.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003368186.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003367910.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003367337.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003367250.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003367084.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003367013.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003366814.1| conserved hypothetical protein [Trichinella spiralis]
 ref|XP_003366288.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46192.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46195.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46200.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46210.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46211.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46219.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46222.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46440.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46582.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46700.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46715.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46818.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46899.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46947.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV47119.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV47190.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV47356.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV47449.1| conserved hypothetical protein [Trichinella spiralis]
Length=52

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFG  153
            VRLVFRPYTQVRR ICTS  LR STRVSSGF  L+HSSPSFG
Sbjct  2    VRLVFRPYTQVRRVICTSTPLRTSTRVSSGFILLKHSSPSFG  43



>ref|XP_001891749.1| hypothetical protein Bm1_01160 [Brugia malayi]
Length=57

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQV  141
            VRLVFRPYT+VRR+ICTS SLR  TRVSSGF  LR+SSPSFGS+ +
Sbjct  2    VRLVFRPYTKVRRSICTSESLRTFTRVSSGFILLRYSSPSFGSQHI  47



>ref|XP_003368606.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46201.1| conserved hypothetical protein [Trichinella spiralis]
Length=43

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFG  153
            VRLVFRPYTQVRR ICTS  LR STRVSSGF  L+HSSPSFG
Sbjct  2    VRLVFRPYTQVRRVICTSTPLRTSTRVSSGFILLKHSSPSFG  43



>ref|XP_004154316.1| PREDICTED: uncharacterized protein LOC101218508, partial [Cucumis 
sativus]
Length=108

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/33 (100%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +3

Query  549  SHKGCWSIKTAGRWSWKSKSAKECVTTHLPNQL  647
            SHKGCWSIKTAGRWSWKSKSAKECVTTHLPNQL
Sbjct  1    SHKGCWSIKTAGRWSWKSKSAKECVTTHLPNQL  33



>ref|XP_003369888.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46187.1| conserved hypothetical protein [Trichinella spiralis]
Length=44

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFG  153
            VRLVFRPYTQVRR ICTS  LR STRVSSGF  L+HSSPSFG
Sbjct  2    VRLVFRPYTQVRRVICTSTPLRTSTRVSSGFILLKHSSPSFG  43



>ref|XP_003368880.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46199.1| conserved hypothetical protein [Trichinella spiralis]
Length=48

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFG  153
            VRLVFRPYTQVRR ICTS  LR STRVSSGF  L+HSSPSFG
Sbjct  2    VRLVFRPYTQVRRVICTSTPLRTSTRVSSGFILLKHSSPSFG  43



>ref|XP_003367735.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46231.1| conserved hypothetical protein [Trichinella spiralis]
Length=49

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/42 (83%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFG  153
            VRLVFRPYTQVRR ICTS  LR STRVSSGF  L+HSSPSFG
Sbjct  2    VRLVFRPYTQVRRVICTSTPLRTSTRVSSGFILLKHSSPSFG  43



>gb|EMD30418.1| hypothetical protein CERSUDRAFT_61186, partial [Ceriporiopsis 
subvermispora B]
Length=95

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNMHA  44



>ref|XP_001624571.1| predicted protein [Nematostella vectensis]
 gb|EDO32471.1| predicted protein, partial [Nematostella vectensis]
Length=90

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFI-PHRQFCLPKMA  468
            L+RQVSCYTLLSGF+LP PPSCCL +PTPFVGS   R W      R + P     L K  
Sbjct  1    LLRQVSCYTLLSGFQLPWPPSCCLEQPTPFVGSDERRLWHLNLTARSVHPASPVLLTKNG  60

Query  467  HLELLIPWRGSTKQPRRPTYLKFENRSR  384
             L   I    S KQ    T LKFENR R
Sbjct  61   PLGTRIHCPASIKQVGLLTNLKFENRLR  88



>ref|XP_008045699.1| hypothetical protein TRAVEDRAFT_137427, partial [Trametes versicolor 
FP-101664 SS1]
 gb|EIW51412.1| hypothetical protein TRAVEDRAFT_137427, partial [Trametes versicolor 
FP-101664 SS1]
Length=95

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  44



>gb|KIK72365.1| hypothetical protein PAXRUDRAFT_47302, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=55

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  44



>ref|XP_008037628.1| hypothetical protein TRAVEDRAFT_121800, partial [Trametes versicolor 
FP-101664 SS1]
 gb|EIW59145.1| hypothetical protein TRAVEDRAFT_121800, partial [Trametes versicolor 
FP-101664 SS1]
Length=74

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  44



>gb|EQL27843.1| hypothetical protein BDFG_09352 [Blastomyces dermatitidis ATCC 
26199]
Length=94

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -3

Query  256  IPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            +PK D+RFARQ RC PPPEFPLASP SGIVHHLSGP+ +A T+   + S SV GAP
Sbjct  1    MPKFDDRFARQNRCEPPPEFPLASPYSGIVHHLSGPNSHALTQIHPKTSGSVDGAP  56



>ref|XP_005644354.1| hypothetical protein COCSUDRAFT_9899, partial [Coccomyxa subellipsoidea 
C-169]
 ref|XP_005646551.1| hypothetical protein COCSUDRAFT_10986, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19810.1| hypothetical protein COCSUDRAFT_9899, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22007.1| hypothetical protein COCSUDRAFT_10986, partial [Coccomyxa subellipsoidea 
C-169]
Length=59

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGA  92
            SFAPIPKS++RFARQ+   PPPEFPLASP SGIVHHLSG +++ART+T  RRS SV GA
Sbjct  1    SFAPIPKSEKRFARQHIYEPPPEFPLASPCSGIVHHLSGHNKHARTQTFHRRSWSVDGA  59



>gb|KIN97676.1| hypothetical protein M404DRAFT_159840, partial [Pisolithus tinctorius 
Marx 270]
Length=56

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  44



>gb|EMD30404.1| hypothetical protein CERSUDRAFT_61201, partial [Ceriporiopsis 
subvermispora B]
Length=95

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  44



>gb|EGN91036.1| hypothetical protein SERLA73DRAFT_81370 [Serpula lacrymans var. 
lacrymans S7.3]
Length=75

 Score = 69.3 bits (168),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  44



>ref|XP_001635423.1| predicted protein [Nematostella vectensis]
 gb|EDO43360.1| predicted protein, partial [Nematostella vectensis]
Length=53

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFP+ASP SGI+HHLSGP R A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPMASPYSGIIHHLSGPKRCA  44



>gb|KDR65243.1| hypothetical protein GALMADRAFT_82103, partial [Galerina marginata 
CBS 339.88]
Length=95

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  44



>gb|EMD30512.1| hypothetical protein CERSUDRAFT_61093, partial [Ceriporiopsis 
subvermispora B]
Length=94

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 56/108 (52%), Gaps = 30/108 (28%)
 Frame = -2

Query  641  IRQVSCYTLLSGFRLP*PPSCCLNRPTPFV---------------GSRLARSWAP*PGFR  507
            IRQVSCYT+LSGFRLP PPSCCL+  TPFV                SR+A S      ++
Sbjct  2    IRQVSCYTVLSGFRLPWPPSCCLDELTPFVVSDERVFRHLNFTFGSSRIASS-----AYQ  56

Query  506  FIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRPRCL  363
              P R      MA          S K+  R TYLKFENR RA RP+ L
Sbjct  57   KWPTRNSTFIAMA----------SIKKTWRLTYLKFENRLRAFRPQGL  94



>ref|XP_002489033.1| hypothetical protein SORBIDRAFT_0351s002020 [Sorghum bicolor]
 gb|EES20475.1| hypothetical protein SORBIDRAFT_0351s002020 [Sorghum bicolor]
Length=55

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/32 (100%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = +3

Query  552  HKGCWSIKTAGRWSWKSKSAKECVTTHLPNQL  647
            HKGCWSIKTAGRWSWKSKSAKECVTTHLPNQL
Sbjct  1    HKGCWSIKTAGRWSWKSKSAKECVTTHLPNQL  32



>ref|XP_002957133.1| hypothetical protein VOLCADRAFT_38607 [Volvox carteri f. nagariensis]
 ref|XP_002958430.1| hypothetical protein VOLCADRAFT_38586, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959376.1| hypothetical protein VOLCADRAFT_39334, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959385.1| hypothetical protein VOLCADRAFT_39263, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959430.1| hypothetical protein VOLCADRAFT_38587, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959765.1| hypothetical protein VOLCADRAFT_39673, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959802.1| hypothetical protein VOLCADRAFT_39606, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959810.1| hypothetical protein VOLCADRAFT_39468, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959836.1| hypothetical protein VOLCADRAFT_39734, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959866.1| hypothetical protein VOLCADRAFT_39604, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959972.1| hypothetical protein VOLCADRAFT_40005, partial [Volvox carteri 
f. nagariensis]
 ref|XP_002959975.1| hypothetical protein VOLCADRAFT_72141, partial [Volvox carteri 
f. nagariensis]
 gb|EFJ38960.1| hypothetical protein VOLCADRAFT_72141 [Volvox carteri f. nagariensis]
 gb|EFJ38962.1| hypothetical protein VOLCADRAFT_40005 [Volvox carteri f. nagariensis]
 gb|EFJ39068.1| hypothetical protein VOLCADRAFT_39604 [Volvox carteri f. nagariensis]
 gb|EFJ39099.1| hypothetical protein VOLCADRAFT_39734 [Volvox carteri f. nagariensis]
 gb|EFJ39124.1| hypothetical protein VOLCADRAFT_39468 [Volvox carteri f. nagariensis]
 gb|EFJ39133.1| hypothetical protein VOLCADRAFT_39606 [Volvox carteri f. nagariensis]
 gb|EFJ39170.1| hypothetical protein VOLCADRAFT_39673 [Volvox carteri f. nagariensis]
 gb|EFJ39504.1| hypothetical protein VOLCADRAFT_38587 [Volvox carteri f. nagariensis]
 gb|EFJ39549.1| hypothetical protein VOLCADRAFT_39263 [Volvox carteri f. nagariensis]
 gb|EFJ39561.1| hypothetical protein VOLCADRAFT_39334 [Volvox carteri f. nagariensis]
 gb|EFJ40506.1| hypothetical protein VOLCADRAFT_38586 [Volvox carteri f. nagariensis]
 gb|EFJ41787.1| hypothetical protein VOLCADRAFT_38607 [Volvox carteri f. nagariensis]
Length=53

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPKS++RFARQ+   PPPE  LASP SGIVHHLSGP+RYA
Sbjct  1    SFAPIPKSEKRFARQHIYEPPPEVTLASPCSGIVHHLSGPNRYA  44



>ref|XP_002477792.1| predicted protein [Postia placenta Mad-698-R]
 gb|EED77009.1| predicted protein, partial [Postia placenta Mad-698-R]
Length=60

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  44



>gb|KEI36423.1| hypothetical protein L969DRAFT_55109, partial [Mixia osmundae 
IAM 14324]
 gb|KEI37815.1| hypothetical protein L969DRAFT_52737, partial [Mixia osmundae 
IAM 14324]
Length=85

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  44



>emb|CAN73055.1| hypothetical protein VITISV_007595 [Vitis vinifera]
Length=747

 Score = 72.8 bits (177),  Expect(2) = 9e-12, Method: Composition-based stats.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 2/71 (3%)
 Frame = -3

Query  232  ARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAPP*GDPANQLPCA  53
            + QYRC PP EFPLASP  GI+HHL G DR+A TRT L R R V GAP   DPA+QLPCA
Sbjct  288  SNQYRCKPPSEFPLASPCLGILHHLLGFDRHALTRTCLIRLRLVDGAPE--DPADQLPCA  345

Query  52   LRVYSPVDSHT  20
            L+V++ + + T
Sbjct  346  LQVFTGLLTRT  356


 Score = 23.9 bits (50),  Expect(2) = 9e-12, Method: Composition-based stats.
 Identities = 10/13 (77%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = -1

Query  45   FTRPLTRTHVRLL  7
            FT  LTRTH+RLL
Sbjct  349  FTGLLTRTHIRLL  361



>ref|XP_001620119.1| hypothetical protein NEMVEDRAFT_v1g149069 [Nematostella vectensis]
 gb|EDO28019.1| predicted protein, partial [Nematostella vectensis]
Length=59

 Score = 60.1 bits (144),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSW  528
            L+RQVSCYTLLSGF+LP PPSCCL +PT FVGS   R W
Sbjct  1    LLRQVSCYTLLSGFQLPWPPSCCLEQPTTFVGSDERRLW  39


 Score = 37.0 bits (84),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  538  RAVGHRNPASGSSRIASSAYQKWP  467
            R + H N A GSSRIASSAYQKWP
Sbjct  36   RRLWHLNRAFGSSRIASSAYQKWP  59



>ref|XP_009037534.1| hypothetical protein AURANDRAFT_27183, partial [Aureococcus anophagefferens]
 gb|EGB07529.1| hypothetical protein AURANDRAFT_27183, partial [Aureococcus anophagefferens]
Length=56

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGP  149
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGP  40



>ref|XP_007297914.1| hypothetical protein MBM_10038 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD11810.1| hypothetical protein MBM_10038 [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=288

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            SFAPI K D+RFARQ RC PPPEFPLASP S IVHHLSGP+ YA T+   + S SV  AP
Sbjct  148  SFAPIRKFDDRFARQNRCEPPPEFPLASPYSRIVHHLSGPNSYALTQIHPKTSGSVDDAP  207



>ref|XP_009550270.1| hypothetical protein HETIRDRAFT_326154, partial [Heterobasidion 
irregulare TC 32-1]
 gb|ETW78289.1| hypothetical protein HETIRDRAFT_326154, partial [Heterobasidion 
irregulare TC 32-1]
Length=83

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGPNIHA  44



>gb|EJK58440.1| hypothetical protein THAOC_21442 [Thalassiosira oceanica]
Length=70

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +1

Query  94   HRRPTLIF*EGFECEHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV  255
            H   +L +    ECEHTC DPKDGELCL  AKP ETLVEARSD+DVQI    WV
Sbjct  17   HGPRSLTYVRMSECEHTCWDPKDGELCLIRAKPGETLVEARSDSDVQIDHQNWV  70



>ref|XP_006960893.1| hypothetical protein WALSEDRAFT_4042, partial [Wallemia sebi 
CBS 633.66]
 gb|EIM19060.1| hypothetical protein WALSEDRAFT_4042, partial [Wallemia sebi 
CBS 633.66]
Length=61

 Score = 54.7 bits (130),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV S
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVS  33


 Score = 41.2 bits (95),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  538  RAVGHRNPASGSSRIASSAYQKWPT  464
            R   H NP  GSSRIASSAYQKWPT
Sbjct  36   RIFRHLNPTIGSSRIASSAYQKWPT  60



>gb|ETO69135.1| hypothetical protein F444_14193, partial [Phytophthora parasitica 
P1976]
Length=55

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R   PPEFPLASP SGIVHHLSG + YA
Sbjct  1    SFAPIPKFDDRFARQNRYELPPEFPLASPYSGIVHHLSGTNIYA  44



>gb|EFX61403.1| hypothetical protein DAPPUDRAFT_38512 [Daphnia pulex]
Length=65

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPKS++RFARQ+   PPP F LASP SGIVHHLSGP+RYA
Sbjct  1    SFAPIPKSEKRFARQHIYEPPPGFHLASPCSGIVHHLSGPNRYA  44



>gb|KIK74325.1| hypothetical protein PAXRUDRAFT_176060, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=72

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            SFAP+ + D+RFARQ RC PPPEFPLASP   IVHHLSGP+ YA T+   + S SV  AP
Sbjct  1    SFAPMRRFDDRFARQNRCEPPPEFPLASPYPRIVHHLSGPNSYALTQIHPKTSGSVDDAP  60



>gb|KEH16993.1| senescence-associated protein [Medicago truncatula]
Length=574

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFKV  400
            VSAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA P  L + 
Sbjct  320  VSAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPYALTRT  367



>gb|KEH17024.1| senescence-associated protein [Medicago truncatula]
Length=691

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVARLNEAAAPSYLFKV  400
            VSAQLGTVT+LPVHPASPVLLTKNGPLGA+DS+A LN AA P  L + 
Sbjct  320  VSAQLGTVTQLPVHPASPVLLTKNGPLGALDSMAWLNRAATPYALTRT  367



>gb|EFX60771.1| hypothetical protein DAPPUDRAFT_70661 [Daphnia pulex]
Length=99

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIP SD+RFARQ RCGPPP FPLAS   GI HHLSGP+  A
Sbjct  1    SFAPIPNSDDRFARQNRCGPPPGFPLASSWPGIGHHLSGPNVCA  44



>ref|XP_005711500.1| unnamed protein product [Chondrus crispus]
 emb|CDF41206.1| unnamed protein product [Chondrus crispus]
Length=52

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  161  MVNYA*AGRSQRKLWWRPAAILTCKSFV*LGYRGERLIE  277
            MVNYA  GRSQRKLWWR  A+LTCKS V LGYRGERLIE
Sbjct  1    MVNYARVGRSQRKLWWRSVAVLTCKSIVKLGYRGERLIE  39



>gb|KDQ49116.1| hypothetical protein JAAARDRAFT_143833, partial [Jaapia argillacea 
MUCL 33604]
 gb|KDQ49125.1| hypothetical protein JAAARDRAFT_143872, partial [Jaapia argillacea 
MUCL 33604]
Length=95

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R   PPEFPLASP SGIVHHLSGP+ +A
Sbjct  1    SFAPIPKFDDRFARQNRYELPPEFPLASPYSGIVHHLSGPNIHA  44



>gb|EFX62075.1| hypothetical protein DAPPUDRAFT_68247 [Daphnia pulex]
Length=123

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQK  114
            VRLVFRPYTQ+RR+ICTS SLR+S RVS  F  +RH SPSFGS++V S   PS K
Sbjct  2    VRLVFRPYTQLRRSICTSESLRSSIRVSPDFNLVRHRSPSFGSQRVRSGFVPSTK  56



>ref|XP_007402182.1| hypothetical protein PHACADRAFT_167261 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM49264.1| hypothetical protein PHACADRAFT_167261 [Phanerochaete carnosa 
HHB-10118-sp]
Length=90

 Score = 54.7 bits (130),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV S
Sbjct  11   FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVS  43


 Score = 39.7 bits (91),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  538  RAVGHRNPASGSSRIASSAYQKWPT  464
            R   H N A GSSRIASSAYQKWPT
Sbjct  46   RVFRHLNLAFGSSRIASSAYQKWPT  70



>emb|CCI11719.1| unnamed protein product [Albugo candida]
Length=59

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +1

Query  121  EGFECEHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTW  252
            E FE EH C  PKDGELCLS  KP ETLVEARSD+DVQI R TW
Sbjct  6    ERFEFEHICWYPKDGELCLSRVKPGETLVEARSDSDVQIDRQTW  49



>ref|XP_009846712.1| hypothetical protein H257_19262, partial [Aphanomyces astaci]
 gb|ETV63804.1| hypothetical protein H257_19262, partial [Aphanomyces astaci]
Length=112

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPK D+RFARQ R   PPEFPLASP SGIVHHLSG + YA
Sbjct  1    SFAPIPKFDDRFARQNRYELPPEFPLASPYSGIVHHLSGTNIYA  44



>gb|KIM19403.1| hypothetical protein M408DRAFT_83569, partial [Serendipita vermifera 
MAFF 305830]
Length=71

 Score = 55.1 bits (131),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV S
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVS  33


 Score = 39.3 bits (90),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = -3

Query  538  RAVGHRNPASGSSRIASSAYQKWPT  464
            R   H N A GSSRIASSAYQKWPT
Sbjct  36   RVFRHLNLAFGSSRIASSAYQKWPT  60



>emb|CCM06164.1| predicted protein [Fibroporia radiculosa]
Length=71

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +1

Query  136  EHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV  255
            EH C DPKDGELCL+  KPEETLVEARSD+DVQI R  WV
Sbjct  32   EHVCWDPKDGELCLNRVKPEETLVEARSDSDVQIDRQIWV  71



>gb|KDQ49126.1| hypothetical protein JAAARDRAFT_143876, partial [Jaapia argillacea 
MUCL 33604]
 gb|KDQ49133.1| hypothetical protein JAAARDRAFT_114037, partial [Jaapia argillacea 
MUCL 33604]
Length=93

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 58/101 (57%), Gaps = 15/101 (15%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQFCLPKMAH  465
             IRQVSCYTLLSGFRLP PPSCCL+ PTPFV S   +       FR + +  F   ++A 
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDEPTPFVVSDERK-------FRHL-NLTFGSSRIAS  52

Query  464  LELLIPWRGSTKQPRRP-------TYLKFENRSRALRPRCL  363
                     +++ P  P       TYLKFENRSR+ +P+ L
Sbjct  53   SAYQKWPTRNSQSPSGPIKRRLVLTYLKFENRSRSFQPQFL  93



>gb|EFX60889.1| hypothetical protein DAPPUDRAFT_275081 [Daphnia pulex]
Length=166

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPD  146
            SFAPIP SD+RFARQ RCGPPP FPLAS   GI HHLSGP+
Sbjct  28   SFAPIPNSDDRFARQNRCGPPPGFPLASSWPGIGHHLSGPN  68



>ref|XP_003368605.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV47288.1| conserved hypothetical protein [Trichinella spiralis]
Length=102

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHSNPSQK  114
            VRLVF PYTQVRR ICTS  LR STRVSSGF  L+HSSPSF    VC+   P+ +
Sbjct  2    VRLVFPPYTQVRRVICTSTPLRTSTRVSSGFILLKHSSPSFRV-PVCTLPKPTDR  55



>ref|XP_002160886.1| PREDICTED: uncharacterized protein LOC100204220, partial [Hydra 
vulgaris]
 ref|XP_002171034.1| PREDICTED: uncharacterized protein LOC100205440, partial [Hydra 
vulgaris]
Length=52

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  265  FAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            FAPI K D+RFARQ R  PPPEFPLASP S IVHHLSGP+R A
Sbjct  1    FAPILKFDDRFARQNRYEPPPEFPLASPYSSIVHHLSGPNRCA  43



>ref|XP_009533744.1| hypothetical protein PHYSODRAFT_520257 [Phytophthora sojae]
 gb|EGZ10999.1| hypothetical protein PHYSODRAFT_520257 [Phytophthora sojae]
Length=50

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = +1

Query  121  EGFECEHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV  255
            E FE EH C  PKDGEL LS  KP ETLVEARSD+DVQI R TWV
Sbjct  6    ERFEFEHICWYPKDGELYLSRVKPGETLVEARSDSDVQIDRQTWV  50



>ref|XP_002780099.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 ref|XP_002787965.1| conserved hypothetical protein, partial [Perkinsus marinus ATCC 
50983]
 gb|EER11894.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gb|EER19761.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
Length=50

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -3

Query  247  SDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SDERFARQYR  PPPEFPLASP SGIVHHLSGP+ YA
Sbjct  1    SDERFARQYRYEPPPEFPLASPCSGIVHHLSGPNGYA  37



>emb|CDW61223.1| hypothetical protein TTRE_0000966601 [Trichuris trichiura]
Length=83

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGS  150
            VRLVFRPY QV R ICTS  LR STRVSSGF  L HSSPSFGS
Sbjct  2    VRLVFRPYAQVGRVICTSTPLRTSTRVSSGFVLLMHSSPSFGS  44



>ref|XP_002118265.1| hypothetical protein TRIADDRAFT_33825 [Trichoplax adhaerens]
 gb|EDV19268.1| hypothetical protein TRIADDRAFT_33825, partial [Trichoplax adhaerens]
Length=53

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  256  IPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            IPK D+RFARQ R   PPEFPLASP SGIVHHLSGP+RYA
Sbjct  1    IPKFDDRFARQDRYELPPEFPLASPYSGIVHHLSGPNRYA  40



>ref|XP_001896196.1| hypothetical protein Bm1_23695 [Brugia malayi]
Length=53

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPKSD+RFARQ R G  PEFPLAS  S IVHHLSGP  YA
Sbjct  1    SFAPIPKSDDRFARQNRFGLSPEFPLASSCSXIVHHLSGPSIYA  44



>gb|KFD59603.1| LOW QUALITY PROTEIN: hypothetical protein M514_28217 [Trichuris 
suis]
Length=62

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLRHSSPSFGSRQVCSHS  129
            VRLVFRPY+QV R ICTS  LR STRVSSGF  L HSSPSFG   VC+ S
Sbjct  2    VRLVFRPYSQVGRVICTSTPLRTSTRVSSGFVLLMHSSPSFG---VCAPS  48



>gb|EFX62166.1| hypothetical protein DAPPUDRAFT_68172 [Daphnia pulex]
Length=99

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPI  SD+RFARQ RCGPPP FPLAS   GI HHLSGP+  A
Sbjct  1    SFAPISNSDDRFARQNRCGPPPGFPLASSWPGIGHHLSGPNVCA  44



>gb|EME38015.1| hypothetical protein DOTSEDRAFT_181978, partial [Dothistroma 
septosporum NZE10]
Length=88

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 55/97 (57%), Gaps = 12/97 (12%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQFCLPKMAH  465
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV S           FR + +  F   ++A 
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVSDER-------TFRHL-NLAFGSSRIAS  52

Query  464  LELLIPW---RGSTKQPRRPTYLKFENRSRALRPRCL  363
                  W    G+ K PR  TYLKFENR R  +P+ L
Sbjct  53   -SAYQKWPTSNGAFKCPRLLTYLKFENRLRLFQPQGL  88



>ref|XP_004205829.1| PREDICTED: uncharacterized protein LOC101237073 [Hydra vulgaris]
Length=65

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPI K D+RFARQ    PPPEFPLASP S IVHHLSGP+R A
Sbjct  13   SFAPILKFDDRFARQNCYEPPPEFPLASPYSSIVHHLSGPNRCA  56



>gb|EMD91246.1| hypothetical protein COCHEDRAFT_1103737, partial [Bipolaris maydis 
C5]
 gb|ENH98553.1| hypothetical protein COCC4DRAFT_155479, partial [Bipolaris maydis 
ATCC 48331]
Length=79

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 50/87 (57%), Gaps = 10/87 (11%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS--RLARSWAP*PGFRFIPHRQFCLPKM  471
             IRQVSCYTLLSGFRLP PPSCCL+ PTPFV S  R+ R   P  G   I    +     
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDEPTPFVVSDERVLRHRNPSFGSSRIASSAYQKWPT  60

Query  470  AHLELLIPWRGSTKQPRRPTYLKFENR  390
             ++        S K PR  TYLKFENR
Sbjct  61   NNV--------SFKCPRLLTYLKFENR  79



>ref|XP_007929417.1| hypothetical protein MYCFIDRAFT_141089, partial [Pseudocercospora 
fijiensis CIRAD86]
 gb|EME80502.1| hypothetical protein MYCFIDRAFT_141089, partial [Pseudocercospora 
fijiensis CIRAD86]
Length=88

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 53/99 (54%), Gaps = 16/99 (16%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQ--FCLPKM  471
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV S            R   H    F   ++
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVS----------DERIFRHLNLAFGSSRI  50

Query  470  AHLELLIPW---RGSTKQPRRPTYLKFENRSRALRPRCL  363
            A       W    G+ K PR  TYLKFENR R  +P+ L
Sbjct  51   AS-SAYQKWPTSNGTFKCPRLLTYLKFENRLRLFQPQGL  88



>ref|XP_007413992.1| hypothetical protein MELLADRAFT_90626 [Melampsora larici-populina 
98AG31]
 gb|EGG02879.1| hypothetical protein MELLADRAFT_90626 [Melampsora larici-populina 
98AG31]
Length=320

 Score = 44.3 bits (103),  Expect(3) = 5e-10, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  61   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  93


 Score = 41.6 bits (96),  Expect(3) = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 45/123 (37%), Gaps = 58/123 (47%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC*FRGAAQRSSRAVLPI*SLRIGRGRYAPDASNH  356
            H N A GSS IASSAYQKWPT   +SC                 +  I +  +AP     
Sbjct  100  HLNSAFGSSNIASSAYQKWPTKDFYSC-----------------TSSIKKQSFAP-----  137

Query  355  WLYPIELSRQLQLS*GKLRREPATRRFD*SFAPIPKSDERFARQYRCGPPPEFPLASPRS  176
                                             IP+  +RFARQ R   P EFPL SP  
Sbjct  138  ---------------------------------IPRFYDRFARQNRYELPSEFPLTSPYP  164

Query  175  GIV  167
            GI 
Sbjct  165  GIT  167


 Score = 24.6 bits (52),  Expect(3) = 5e-10, Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 13/21 (62%), Gaps = 0/21 (0%)
 Frame = -1

Query  69   ISFLAPYGFTRPLTRTHVRLL  7
            I F   +GF  P TR HVRLL
Sbjct  179  IHFHYAFGFQHPNTRKHVRLL  199



>ref|XP_007411820.1| hypothetical protein MELLADRAFT_88317 [Melampsora larici-populina 
98AG31]
 ref|XP_007418752.1| hypothetical protein MELLADRAFT_84121 [Melampsora larici-populina 
98AG31]
 gb|EGF97980.1| hypothetical protein MELLADRAFT_84121 [Melampsora larici-populina 
98AG31]
 gb|EGG05067.1| hypothetical protein MELLADRAFT_88317 [Melampsora larici-populina 
98AG31]
Length=122

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -1

Query  336  SRASSSYPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFL  193
            S  SS   +GNFG NQLLDGSISLSPLYP  T DLHV  A   HQSFL
Sbjct  75   SCTSSIKKQGNFGRNQLLDGSISLSPLYPDSTIDLHVRTATSFHQSFL  122


 Score = 41.2 bits (95),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -2

Query  635  QVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
            + SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  14   KYSCYTLLSGFRLPWPPCGCLDELTPFVVS  43


 Score = 35.8 bits (81),  Expect(2) = 7e-06, Method: Compositional matrix adjust.
 Identities = 17/21 (81%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT  464
            H N A GSS IASSAYQKWPT
Sbjct  50   HLNSAFGSSHIASSAYQKWPT  70



>ref|XP_001617556.1| hypothetical protein NEMVEDRAFT_v1g78756 [Nematostella vectensis]
 gb|EDO25456.1| predicted protein, partial [Nematostella vectensis]
Length=53

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSW  528
            L+RQVSCYTLLSGF+LP PPSCCL +PTPFVGS   R W
Sbjct  1    LLRQVSCYTLLSGFQLPWPPSCCLEQPTPFVGSDERRLW  39



>ref|XP_001624697.1| predicted protein [Nematostella vectensis]
 gb|EDO32597.1| predicted protein, partial [Nematostella vectensis]
Length=70

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSW  528
            L+RQVSCYTLLSGF+LP PPSCCL +PTPFVGS   R W
Sbjct  1    LLRQVSCYTLLSGFQLPWPPSCCLEQPTPFVGSDERRLW  39



>ref|XP_001618625.1| hypothetical protein NEMVEDRAFT_v1g69194 [Nematostella vectensis]
 ref|XP_001624556.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO26525.1| predicted protein, partial [Nematostella vectensis]
 gb|EDO32456.1| predicted protein, partial [Nematostella vectensis]
Length=63

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSW  528
            L+RQVSCYTLLSGF+LP PPSCCL +PTPFVGS   R W
Sbjct  1    LLRQVSCYTLLSGFQLPWPPSCCLEQPTPFVGSDERRLW  39



>gb|ELT98715.1| hypothetical protein CAPTEDRAFT_61794, partial [Capitella teleta]
Length=66

 Score = 52.8 bits (125),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRL  540
             IRQVSCYTLLSG RLP PPSCCL  PTPF+GS +
Sbjct  1    WIRQVSCYTLLSGCRLPWPPSCCLYPPTPFLGSAV  35


 Score = 37.7 bits (86),  Expect(2) = 9e-10, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = -3

Query  532  VGHRNPASGSSRIASSAYQKWPT  464
            VGH NP  GSS  ASSAYQKWPT
Sbjct  39   VGHLNPPFGSSHSASSAYQKWPT  61



>gb|KIJ09673.1| hypothetical protein PAXINDRAFT_177523 [Paxillus involutus ATCC 
200175]
Length=114

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 57/111 (51%), Gaps = 35/111 (32%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFV---------------GSRLARSWAP*PGF  510
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV                SR+A S      +
Sbjct  22   FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVSDERVFRHLNLPFGSSRIASS-----AY  76

Query  509  RFIPHRQFCLPKMAHLELLIPWRGSTKQPRRP--TYLKFENRSRALRPRCL  363
            +  P R    P            G TK  RRP  TYLKFENR R+ RP+ L
Sbjct  77   QKWPTRNSQSPS-----------GPTK--RRPVLTYLKFENRLRSFRPQGL  114



>ref|XP_008027951.1| hypothetical protein SETTUDRAFT_161947 [Setosphaeria turcica 
Et28A]
 gb|EOA84416.1| hypothetical protein SETTUDRAFT_161947 [Setosphaeria turcica 
Et28A]
Length=118

 Score = 63.5 bits (153),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  256  IPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            +PK D+RFARQ RC PPPEFPLASP S IVHHLSGP+ +A
Sbjct  1    MPKFDDRFARQNRCEPPPEFPLASPYSSIVHHLSGPNSHA  40



>ref|XP_003839870.1| predicted protein [Leptosphaeria maculans JN3]
 emb|CBX96391.1| predicted protein [Leptosphaeria maculans JN3]
Length=124

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -3

Query  256  IPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            +PK D+RFARQ RC PPPEFPLASP S IVHHLSGP+ +A
Sbjct  1    MPKFDDRFARQNRCEPPPEFPLASPYSSIVHHLSGPNSHA  40



>ref|XP_009533743.1| hypothetical protein PHYSODRAFT_521105, partial [Phytophthora 
sojae]
 gb|EGZ10998.1| hypothetical protein PHYSODRAFT_521105 [Phytophthora sojae]
Length=54

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPD  146
            SFAP PK D+RFARQ R   PPEFPLASP SGIVHHLSG +
Sbjct  1    SFAPTPKFDDRFARQNRYELPPEFPLASPYSGIVHHLSGTN  41



>ref|XP_006455550.1| hypothetical protein AGABI2DRAFT_75975, partial [Agaricus bisporus 
var. bisporus H97]
 ref|XP_007335031.1| hypothetical protein AGABI1DRAFT_48198, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 ref|XP_007335729.1| hypothetical protein AGABI1DRAFT_49524, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM73631.1| hypothetical protein AGABI1DRAFT_49524, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKM74330.1| hypothetical protein AGABI1DRAFT_48198, partial [Agaricus bisporus 
var. burnettii JB137-S8]
 gb|EKV44289.1| hypothetical protein AGABI2DRAFT_75975, partial [Agaricus bisporus 
var. bisporus H97]
Length=93

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 54/109 (50%), Gaps = 31/109 (28%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFV---------------GSRLARSWAP*PGF  510
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV                SR+A S      +
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVSDEREFRHLNLAFGSSRIASS-----AY  55

Query  509  RFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRPRCL  363
            +  P R    P            GS K+    TYLKFENR R  +P+ L
Sbjct  56   QKWPTRNSQSPS-----------GSIKKRLVLTYLKFENRLRLFQPQGL  93



>ref|XP_003851048.1| hypothetical protein MYCGRDRAFT_74254, partial [Zymoseptoria 
tritici IPO323]
 ref|XP_003851054.1| hypothetical protein MYCGRDRAFT_74248, partial [Zymoseptoria 
tritici IPO323]
 gb|EGP86024.1| hypothetical protein MYCGRDRAFT_74254 [Zymoseptoria tritici IPO323]
 gb|EGP86030.1| hypothetical protein MYCGRDRAFT_74248 [Zymoseptoria tritici IPO323]
Length=88

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 54/97 (56%), Gaps = 12/97 (12%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQFCLPKMAH  465
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV S           FR + +  F   ++A 
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVSDER-------TFRHL-NLAFGSSRIAS  52

Query  464  LELLIPW---RGSTKQPRRPTYLKFENRSRALRPRCL  363
                  W     + K PR  TYLKFENR R  +P+ L
Sbjct  53   -SAYQKWPTSNDTFKCPRLLTYLKFENRLRLFQPQGL  88



>gb|ADI72883.1| hypothetical protein [Ophiocordyceps unilateralis]
Length=57

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  277  FD*SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
             D +FAPIPK D+RF     C P P +PLASP SGI+HHLSGP  YA
Sbjct  1    LDYTFAPIPKFDDRFVHHNLCEPTPYYPLASPYSGILHHLSGPHLYA  47



>gb|ELT91110.1| hypothetical protein CAPTEDRAFT_97599, partial [Capitella teleta]
 gb|ELT99732.1| hypothetical protein CAPTEDRAFT_98192, partial [Capitella teleta]
Length=76

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 51/94 (54%), Gaps = 20/94 (21%)
 Frame = -2

Query  641  IRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQFCLPKMAHL  462
            IRQVSCYTLLSG RLP PPSCCL  PTPF+GS +                    P++ HL
Sbjct  2    IRQVSCYTLLSGCRLPWPPSCCLYPPTPFLGSAVR-------------------PRVGHL  42

Query  461  ELLIPWRGS-TKQPRRPTYLKFENRSRALRPRCL  363
                    +  ++    T+LKFENRSR  RPR L
Sbjct  43   NRQHSIAAAPIRRAGLLTHLKFENRSRTFRPRDL  76



>gb|EHA21129.1| hypothetical protein ASPNIDRAFT_144328 [Aspergillus niger ATCC 
1015]
Length=60

 Score = 48.5 bits (114),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR VSCYTLLSGFRLP PPS CL+  TPFV S
Sbjct  1    FIRPVSCYTLLSGFRLPWPPSGCLDELTPFVVS  33


 Score = 40.8 bits (94),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -3

Query  538  RAVGHRNPASGSSRIASSAYQKWPT  464
            RA  H N A GSSRIASSAYQKWPT
Sbjct  36   RAFRHLNLAFGSSRIASSAYQKWPT  60



>ref|XP_006279316.1| hypothetical protein CARUB_v10012757mg, partial [Capsella rubella]
 ref|XP_006279320.1| hypothetical protein CARUB_v10012761mg, partial [Capsella rubella]
 gb|EOA12214.1| hypothetical protein CARUB_v10012757mg, partial [Capsella rubella]
 gb|EOA12218.1| hypothetical protein CARUB_v10012761mg, partial [Capsella rubella]
Length=122

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -2

Query  488  FCLPKMAHLELLIPWRGSTKQPRRPTYLKFEN  393
            FCLPKMAHLEL IPW GSTKQP RPTYLKFEN
Sbjct  91   FCLPKMAHLELSIPWDGSTKQPPRPTYLKFEN  122



>emb|CEP08712.1| hypothetical protein [Parasitella parasitica]
Length=101

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  256  IPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGP  149
            IPK D+RFARQ R  PPPEFPLASP SGIVHHLSGP
Sbjct  10   IPKFDDRFARQNRYEPPPEFPLASPYSGIVHHLSGP  45



>gb|EMF07912.1| hypothetical protein SEPMUDRAFT_55174, partial [Sphaerulina musiva 
SO2202]
Length=86

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 52/97 (54%), Gaps = 16/97 (16%)
 Frame = -2

Query  638  RQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQ--FCLPKMAH  465
            RQVSCYTLLSGFRLP PPSCCL+  TPFV S            R   H    F   ++A 
Sbjct  1    RQVSCYTLLSGFRLPWPPSCCLDELTPFVVS----------DERIFRHLNLAFGSSRIAS  50

Query  464  LELLIPW---RGSTKQPRRPTYLKFENRSRALRPRCL  363
                  W    G+ K PR  TYLKFENR R  +P+ L
Sbjct  51   -SAYQKWPTSNGAFKCPRLLTYLKFENRLRLFQPQGL  86



>emb|CDW61210.1| hypothetical protein TTRE_0000965101, partial [Trichuris trichiura]
Length=321

 Score = 51.2 bits (121),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  154  PKDGELCLSGAKPEETLVEARSDTDVQIVRLTW  252
            PKDGELC+S  KPEETLVE RS  DVQI R T+
Sbjct  219  PKDGELCMSRTKPEETLVEVRSGVDVQITRPTF  251


 Score = 37.0 bits (84),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 19/25 (76%), Gaps = 0/25 (0%)
 Frame = +2

Query  335  EFYRVKPMIRGIGGVTPSTYSQTLN  409
            +FY VK MIRGIG    S+YSQTLN
Sbjct  261  QFYPVKRMIRGIGDAMSSSYSQTLN  285



>ref|XP_004209857.1| PREDICTED: uncharacterized protein LOC101237391 [Hydra vulgaris]
Length=65

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPI K D++FARQ    PPPEFPLA P S IVHHLSGP+R A
Sbjct  13   SFAPILKFDDQFARQNCYEPPPEFPLALPYSSIVHHLSGPNRCA  56



>gb|EHK21459.1| hypothetical protein TRIVIDRAFT_152580 [Trichoderma virens Gv29-8]
 gb|EHK21463.1| hypothetical protein TRIVIDRAFT_152445 [Trichoderma virens Gv29-8]
 gb|EHK21467.1| hypothetical protein TRIVIDRAFT_223069 [Trichoderma virens Gv29-8]
 gb|EHK21471.1| hypothetical protein TRIVIDRAFT_152567 [Trichoderma virens Gv29-8]
 gb|EHK21475.1| hypothetical protein TRIVIDRAFT_223071 [Trichoderma virens Gv29-8]
Length=131

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -3

Query  256  IPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAPP*GD  77
            +P  D+RFARQ RC PPPEFPLASP +GIVH LSGP  YA T+   R S SV  AP    
Sbjct  1    MPIFDDRFARQNRCEPPPEFPLASPYTGIVHLLSGPAPYALTQIRPRTSGSVDDAPK-LS  59

Query  76   PANQLPCALRVYSPVDSHTCQTP  8
            PA       R  +P  SHT  TP
Sbjct  60   PAFTF-ITRRGLTPEHSHTKTTP  81



>gb|EHK48867.1| hypothetical protein TRIATDRAFT_262275 [Trichoderma atroviride 
IMI 206040]
Length=131

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -3

Query  256  IPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAPP*GD  77
            +P  D+RFARQ RC PPPEFPLASP +GIVH LSGP  YA T+   R S SV  AP    
Sbjct  1    MPIFDDRFARQNRCEPPPEFPLASPYTGIVHLLSGPAPYALTQIHPRTSGSVDDAPK-LS  59

Query  76   PANQLPCALRVYSPVDSHTCQTP  8
            PA       R  +P  SHT  TP
Sbjct  60   PAFTF-ITRRGLTPEHSHTKTTP  81



>gb|KFM58614.1| hypothetical protein X975_11578, partial [Stegodyphus mimosarum]
Length=47

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSR  543
            L+RQVSCYTLLSGFRLP PPSCCL +PTPF+GS 
Sbjct  1    LLRQVSCYTLLSGFRLPWPPSCCLEQPTPFMGSH  34



>gb|ABI52743.1| 10 kDa putative secreted protein [Argas monolakensis]
Length=102

 Score = 61.2 bits (147),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  546  RSHKGCWSIKTAGRWSWKSKSAKECVTTHLPNQL  647
            RSH+GCW ++TAGRW WK +SAKECVTTHLP QL
Sbjct  2    RSHEGCWLLRTAGRWPWKLESAKECVTTHLPKQL  35



>gb|EJU02319.1| hypothetical protein DACRYDRAFT_51577, partial [Dacryopinax sp. 
DJM-731 SS1]
Length=88

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 49/103 (48%), Gaps = 24/103 (23%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQFCLPKMAH  465
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV S                 R F    +A 
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVS---------------DERVFRHLNLAI  45

Query  464  LELLIPWRGSTKQPRRP---------TYLKFENRSRALRPRCL  363
                I      K P R          TYLKFENR R  +P+ L
Sbjct  46   GSSRIASSAYQKWPTRSSHSKVRGLLTYLKFENRLRLFQPQGL  88



>emb|CCT65050.1| uncharacterized protein FFUJ_14433 [Fusarium fujikuroi IMI 58289]
Length=148

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -3

Query  256  IPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAPP*GD  77
            +P  D+RFARQ RC PPPEFPLASP +GIVH LSGP  YA T+   R S SV  AP    
Sbjct  1    MPIFDDRFARQNRCEPPPEFPLASPYTGIVHLLSGPAPYALTQIHPRTSGSVDDAPK-LS  59

Query  76   PANQLPCALRVYSPVDSHTCQTP  8
            PA       R  +P  SHT  TP
Sbjct  60   PAFTF-ITRRGLTPEHSHTKTTP  81



>ref|XP_003297441.1| hypothetical protein PTT_07856 [Pyrenophora teres f. teres 0-1]
 gb|EFQ94463.1| hypothetical protein PTT_07856 [Pyrenophora teres f. teres 0-1]
 gb|ENH63551.1| hypothetical protein FOC1_g10000050 [Fusarium oxysporum f. sp. 
cubense race 1]
Length=148

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -3

Query  256  IPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAPP*GD  77
            +P  D+RFARQ RC PPPEFPLASP +GIVH LSGP  YA T+   R S SV  AP    
Sbjct  1    MPIFDDRFARQNRCEPPPEFPLASPYTGIVHLLSGPAPYALTQIHPRTSGSVDDAPK-LS  59

Query  76   PANQLPCALRVYSPVDSHTCQTP  8
            PA       R  +P  SHT  TP
Sbjct  60   PAFTF-ITRRGLTPEHSHTKTTP  81



>ref|XP_007324734.1| hypothetical protein SERLADRAFT_353240 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO18707.1| hypothetical protein SERLADRAFT_353240 [Serpula lacrymans var. 
lacrymans S7.9]
Length=91

 Score = 48.1 bits (113),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  632  VSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
            VSCYTLLSGFRLP PPSCCL+  TPFV S
Sbjct  18   VSCYTLLSGFRLPWPPSCCLDELTPFVVS  46


 Score = 38.5 bits (88),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = -3

Query  535  AVGHRNPASGSSRIASSAYQKWPT  464
            A  H N A GSSRIASSAYQKWPT
Sbjct  50   AFRHLNLAFGSSRIASSAYQKWPT  73



>gb|KEH16543.1| senescence-associated protein, putative, partial [Medicago truncatula]
Length=513

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 17/64 (27%)
 Frame = -1

Query  261  PLYP---SQTNDLHVSIAAGLHQSFLWLRPAQA*FTIFRVPTGMLALEPFSEDQGRSAVH  91
            PL P   SQTN+L VSIAAGLHQSFLWLR              ML+ EPF++D+GRSAV 
Sbjct  187  PLIPHLLSQTNNLQVSIAAGLHQSFLWLR--------------MLSFEPFTKDRGRSAVQ  232

Query  90   PREG  79
            P  G
Sbjct  233  PTRG  236



>ref|XP_003614377.1| hypothetical protein MTR_5g050920 [Medicago truncatula]
Length=518

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 17/64 (27%)
 Frame = -1

Query  261  PLYP---SQTNDLHVSIAAGLHQSFLWLRPAQA*FTIFRVPTGMLALEPFSEDQGRSAVH  91
            PL P   SQTN+L VSIAAGLHQSFLWLR              ML+ EPF++D+GRSAV 
Sbjct  217  PLIPHLLSQTNNLQVSIAAGLHQSFLWLR--------------MLSFEPFTKDRGRSAVQ  262

Query  90   PREG  79
            P  G
Sbjct  263  PTRG  266



>gb|KEH16540.1| senescence-associated protein, putative [Medicago truncatula]
Length=619

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 40/63 (63%), Gaps = 14/63 (22%)
 Frame = -1

Query  267  LSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIFRVPTGMLALEPFSEDQGRSAVHP  88
            L P   SQTN+L VSIAAGLHQSFLWLR              ML+ EPF++D+GRSAV P
Sbjct  251  LIPHLSSQTNNLQVSIAAGLHQSFLWLR--------------MLSFEPFTKDRGRSAVQP  296

Query  87   REG  79
              G
Sbjct  297  TRG  299



>ref|XP_003614352.1| hypothetical protein MTR_5g050460 [Medicago truncatula]
Length=649

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 40/63 (63%), Gaps = 14/63 (22%)
 Frame = -1

Query  267  LSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA*FTIFRVPTGMLALEPFSEDQGRSAVHP  88
            L P   SQTN+L VSIAAGLHQSFLWLR              ML+ EPF++D+GRSAV P
Sbjct  251  LIPHLSSQTNNLQVSIAAGLHQSFLWLR--------------MLSFEPFTKDRGRSAVQP  296

Query  87   REG  79
              G
Sbjct  297  TRG  299



>emb|CCE34895.1| uncharacterized protein CPUR_08834 [Claviceps purpurea 20.1]
Length=129

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  244  DERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAPP*GDPANQ  65
            D+RFARQ RC PPPEFPLASP +GIVH LSGP  YA T+   R S SV  AP    PA  
Sbjct  3    DDRFARQNRCEPPPEFPLASPYTGIVHLLSGPAPYALTQIHPRTSGSVDDAPK-LSPAFT  61

Query  64   LPCALRVYSPVDSHTCQTP  8
                 R  +P  SHT  TP
Sbjct  62   F-ITRRGLTPEHSHTKTTP  79



>ref|XP_003614355.1| hypothetical protein MTR_5g050490 [Medicago truncatula]
Length=535

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 41/64 (64%), Gaps = 17/64 (27%)
 Frame = -1

Query  261  PLYP---SQTNDLHVSIAAGLHQSFLWLRPAQA*FTIFRVPTGMLALEPFSEDQGRSAVH  91
            PL P   SQTN+L VSIAAGLHQSFLWLR              ML+ EPF++D+GRSAV 
Sbjct  209  PLIPHLLSQTNNLQVSIAAGLHQSFLWLR--------------MLSFEPFTKDRGRSAVQ  254

Query  90   PREG  79
            P  G
Sbjct  255  PTRG  258



>emb|CCD58743.1| unnamed protein product [Schistosoma mansoni]
Length=98

 Score = 60.1 bits (144),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLAR  534
            LIRQVSCYTLLSGFRLP PPSCCL++P PFV S   R
Sbjct  26   LIRQVSCYTLLSGFRLPWPPSCCLDQPAPFVVSNERR  62



>ref|XP_001887546.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR01733.1| predicted protein, partial [Laccaria bicolor S238N-H82]
Length=93

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 49/108 (45%), Gaps = 29/108 (27%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQFCLPKMAH  465
             IRQVSCYTLLSGFR P PPSCCL+  TPFV S                 R+F    +A 
Sbjct  1    FIRQVSCYTLLSGFRFPWPPSCCLDELTPFVVS---------------DEREFRHLNLAF  45

Query  464  LELLIPWRGSTKQPRRP--------------TYLKFENRSRALRPRCL  363
                I      K P R               TYLKFENR R  +P+ L
Sbjct  46   SSSHIASSAYQKWPTRNSQSPSSPIKRRLVLTYLKFENRLRLFQPQGL  93



>ref|XP_729764.1| hypothetical protein [Plasmodium yoelii yoelii 17XNL]
 gb|EAA21329.1| hypothetical protein [Plasmodium yoelii yoelii]
Length=193

 Score = 43.1 bits (100),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -1

Query  309  GNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSFLWLRPAQA  172
             +F  NQL+  SISLSPL   + NDLHVSI + LHQ+F  L+   A
Sbjct  148  SSFENNQLIGFSISLSPLNVIEMNDLHVSINSILHQAFTRLQSHHA  193


 Score = 35.4 bits (80),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 29/51 (57%), Gaps = 1/51 (2%)
 Frame = -3

Query  535  AVGHRNPASGSSRIASSAYQKWPTWSC*FRG-AAQRSSRAVLPI*SLRIGR  386
             + H   A G+S IASSAYQKWPT S  F     Q     +L I SLRIG+
Sbjct  84   VLLHLIQALGASLIASSAYQKWPTRSSLFIMRKLQLRYYPMLRIGSLRIGQ  134


 Score = 26.6 bits (57),  Expect(3) = 2e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 12/15 (80%), Gaps = 0/15 (0%)
 Frame = -1

Query  648  LVDSAGELLHTP*RI  604
            LV S GELLHTP RI
Sbjct  63   LVHSVGELLHTPWRI  77



>ref|XP_007324730.1| hypothetical protein SERLADRAFT_353212 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007324739.1| hypothetical protein SERLADRAFT_353292, partial [Serpula lacrymans 
var. lacrymans S7.9]
 ref|XP_007324742.1| hypothetical protein SERLADRAFT_353306, partial [Serpula lacrymans 
var. lacrymans S7.9]
 ref|XP_007324746.1| hypothetical protein SERLADRAFT_353235, partial [Serpula lacrymans 
var. lacrymans S7.9]
 gb|EGN91347.1| hypothetical protein SERLA73DRAFT_67568 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGN91395.1| hypothetical protein SERLA73DRAFT_67493 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGN91491.1| hypothetical protein SERLA73DRAFT_67318 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO18703.1| hypothetical protein SERLADRAFT_353212 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO18712.1| hypothetical protein SERLADRAFT_353292 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO18715.1| hypothetical protein SERLADRAFT_353306 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO18719.1| hypothetical protein SERLADRAFT_353235 [Serpula lacrymans var. 
lacrymans S7.9]
Length=93

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 54/101 (53%), Gaps = 15/101 (15%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQFCLPKMAH  465
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV S           FR + +  F   ++A 
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVSDEC-------AFRHL-NLAFGSSRIAS  52

Query  464  LELLIPWRGSTKQPRRP-------TYLKFENRSRALRPRCL  363
                     +++ P  P       TYLKFENR R  +P+ L
Sbjct  53   SAYQKWPTRNSQSPSGPIKRRLVLTYLKFENRLRLFQPQGL  93



>ref|XP_009550271.1| hypothetical protein HETIRDRAFT_421044 [Heterobasidion irregulare 
TC 32-1]
 gb|EMD31867.1| hypothetical protein CERSUDRAFT_109224 [Ceriporiopsis subvermispora 
B]
 gb|ETW78290.1| hypothetical protein HETIRDRAFT_421044 [Heterobasidion irregulare 
TC 32-1]
Length=103

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 53/109 (49%), Gaps = 31/109 (28%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFV---------------GSRLARSWAP*PGF  510
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV                SR+A S      +
Sbjct  11   FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVSDERVFRHLNLAFGSSRIASS-----AY  65

Query  509  RFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRPRCL  363
            +  P R    P            G  K+    TYLKFENR R  +P+ L
Sbjct  66   QKWPTRNSQSPS-----------GPIKRRLVLTYLKFENRLRLFQPQGL  103



>ref|XP_007311851.1| hypothetical protein STEHIDRAFT_23631, partial [Stereum hirsutum 
FP-91666 SS1]
 ref|XP_007311972.1| hypothetical protein STEHIDRAFT_70108, partial [Stereum hirsutum 
FP-91666 SS1]
 ref|XP_008045698.1| hypothetical protein TRAVEDRAFT_137430, partial [Trametes versicolor 
FP-101664 SS1]
 gb|EGZ76071.1| hypothetical protein NEUTE2DRAFT_76164, partial [Neurospora tetrasperma 
FGSC 2509]
 gb|EIM78931.1| hypothetical protein STEHIDRAFT_70108, partial [Stereum hirsutum 
FP-91666 SS1]
 gb|EIM79048.1| hypothetical protein STEHIDRAFT_23631, partial [Stereum hirsutum 
FP-91666 SS1]
 gb|EIW51411.1| hypothetical protein TRAVEDRAFT_137430, partial [Trametes versicolor 
FP-101664 SS1]
Length=93

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 53/109 (49%), Gaps = 31/109 (28%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFV---------------GSRLARSWAP*PGF  510
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV                SR+A S      +
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVSDERVFRHLNLAFGSSRIASS-----AY  55

Query  509  RFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRPRCL  363
            +  P R    P            G  K+    TYLKFENR R  +P+ L
Sbjct  56   QKWPTRNSQSPS-----------GPIKRRLVLTYLKFENRLRLFQPQGL  93



>ref|XP_001891761.1| LD48059p [Brugia malayi]
 ref|XP_001892386.1| LD48059p, partial [Brugia malayi]
 ref|XP_001893702.1| LD48059p, partial [Brugia malayi]
Length=43

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +1

Query  130  ECEHTCRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV  255
            E E  C DPKDGEL LS  KPEETLV+ RSD+DVQI RLT V
Sbjct  2    EVERICWDPKDGELYLSRMKPEETLVKVRSDSDVQIDRLTLV  43



>ref|XP_003370312.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46768.1| conserved hypothetical protein [Trichinella spiralis]
Length=142

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = -3

Query  616  SLADFDFHDHRPAVLIDQHPLWDLG*RAVGHRNPASGSSRIASSAYQKWPT  464
            SLAD +FH HRPAV IDQH  W      V H N   GS  IASSAYQ WPT
Sbjct  37   SLADSNFHGHRPAVYIDQHLFWYFMSANVWHLNKKFGSFHIASSAYQNWPT  87


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/30 (87%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSG  189
            VRLVFRPYTQVRR ICTS  LR STRVSSG
Sbjct  113  VRLVFRPYTQVRRVICTSSPLRTSTRVSSG  142



>ref|XP_001383614.1| hypothetical protein PICST_57317 [Scheffersomyces stipitis CBS 
6054]
 gb|ABN65585.1| predicted protein, partial [Scheffersomyces stipitis CBS 6054]
Length=94

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 52/96 (54%), Gaps = 4/96 (4%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS--RLARSWAP*PGFRFIPHRQFCLPKM  471
             IR VSCYTLLSGFRLP PPS CL+  TPFV S  R+ R +    G   I    +     
Sbjct  1    FIRPVSCYTLLSGFRLPWPPSGCLDELTPFVVSDERVFRHFNFTFGSSRIASSAYQKWPT  60

Query  470  AHLELLIPWRGSTKQPRRPTYLKFENRSRALRPRCL  363
                 + P   S KQ    TYLKFENR R+ +P+ L
Sbjct  61   KSSSFICP--RSIKQQGLLTYLKFENRLRSFQPQDL  94



>ref|XP_008037273.1| hypothetical protein TRAVEDRAFT_36643 [Trametes versicolor FP-101664 
SS1]
 gb|EIW59146.1| hypothetical protein TRAVEDRAFT_36643 [Trametes versicolor FP-101664 
SS1]
Length=112

 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 53/109 (49%), Gaps = 31/109 (28%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFV---------------GSRLARSWAP*PGF  510
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV                SR+A S      +
Sbjct  20   FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVSDERVFRHLNLAFGSSRIASS-----AY  74

Query  509  RFIPHRQFCLPKMAHLELLIPWRGSTKQPRRPTYLKFENRSRALRPRCL  363
            +  P R    P            G  K+    TYLKFENR R  +P+ L
Sbjct  75   QKWPTRNSQSPS-----------GPIKRRLVLTYLKFENRLRLFQPQGL  112



>ref|XP_002427897.1| hypothetical protein Phum_PHUM351800 [Pediculus humanus corporis]
 gb|EEB15159.1| hypothetical protein Phum_PHUM351800 [Pediculus humanus corporis]
Length=120

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  318  YPEGNFGGNQLLDGSISLSPLYPSQTNDLHVSIAAGLHQSF  196
            YPEGNF  NQL D SISLSPL P Q  DLHV I+  LHQ F
Sbjct  79   YPEGNFRRNQLTDDSISLSPLCPVQEIDLHVRISTDLHQGF  119



>gb|EKC17825.1| hypothetical protein CGI_10000151 [Crassostrea gigas]
 gb|EKC17832.1| hypothetical protein CGI_10000142 [Crassostrea gigas]
 gb|EKC17865.1| hypothetical protein CGI_10000104 [Crassostrea gigas]
 gb|EKC17887.1| hypothetical protein CGI_10000079 [Crassostrea gigas]
 gb|EKC17949.1| hypothetical protein CGI_10000010 [Crassostrea gigas]
 gb|EKC23129.1| hypothetical protein CGI_10000253 [Crassostrea gigas]
 gb|EKC26880.1| hypothetical protein CGI_10000514 [Crassostrea gigas]
Length=86

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  256  IPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            + K D+RFARQ RCGPP EFPL S  S IVHHLSG + YA
Sbjct  1    MLKFDDRFARQNRCGPPSEFPLTSSYSSIVHHLSGTNVYA  40



>gb|KDR65247.1| hypothetical protein GALMADRAFT_82099, partial [Galerina marginata 
CBS 339.88]
Length=147

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 49/107 (46%), Gaps = 29/107 (27%)
 Frame = -2

Query  641  IRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQFCLPKMAHL  462
            IRQVSCYT LSGFRLP PPSCCL+  TPFV S                 R+F    +A  
Sbjct  56   IRQVSCYTFLSGFRLPWPPSCCLDELTPFVVSD---------------EREFRHLNLAFG  100

Query  461  ELLIPWRGSTKQPRRP--------------TYLKFENRSRALRPRCL  363
               I      K P R               TYLKFENR R  +P+ L
Sbjct  101  SSRIASSAYQKWPTRNSQSPSGPIKRRLVLTYLKFENRLRLFQPQGL  147



>gb|EQB46020.1| hypothetical protein CGLO_15009 [Colletotrichum gloeosporioides 
Cg-14]
Length=135

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -3

Query  244  DERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            D+RFARQ RC PPPEFPLASP + IVH LSGP  YA T+   R S SV  AP
Sbjct  5    DDRFARQNRCEPPPEFPLASPYTRIVHLLSGPTLYALTQIHPRTSGSVDDAP  56



>gb|AII97892.1| BLTX527 [Nephila pilipes]
Length=88

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 44/85 (52%), Gaps = 9/85 (11%)
 Frame = +1

Query  19   MCASQRAS-KPVR--------RKEADWRDPLTGVHRRPTLIF*EGFECEHTCRDPKDGEL  171
            MCAS   S KP          R ++     L G HRRP  +     E EHT  DPKDGEL
Sbjct  1    MCASHWVSQKPTGAEKLTSTLRSQSGSPASLRGAHRRPATLLGVAAEPEHTRWDPKDGEL  60

Query  172  CLSGAKPEETLVEARSDTDVQIVRL  246
            C    K  ETL+E RS +DVQI RL
Sbjct  61   CPDRTKTGETLLEVRSGSDVQIDRL  85



>gb|EGZ74197.1| hypothetical protein NEUTE2DRAFT_35651, partial [Neurospora tetrasperma 
FGSC 2509]
Length=70

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  244  DERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            D+RFARQ RC PPPEFPLASP   IVHHLSGP   A T+     S SV  AP
Sbjct  5    DDRFARQNRCEPPPEFPLASPYPSIVHHLSGPRLNALTQIHPNTSGSVDDAP  56



>ref|XP_007373420.1| hypothetical protein SPAPADRAFT_134444, partial [Spathaspora 
passalidarum NRRL Y-27907]
 gb|EGW33836.1| hypothetical protein SPAPADRAFT_134444, partial [Spathaspora 
passalidarum NRRL Y-27907]
Length=94

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 51/94 (54%), Gaps = 4/94 (4%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS--RLARSWAP*PGFRFIPHRQFCLPKM  471
             IR VSCYTLLSGFRLP PPS CL+  TPFV S  R+ R +    G   I    +     
Sbjct  1    FIRPVSCYTLLSGFRLPWPPSGCLDELTPFVVSDERVFRHFNFTFGSSRIASSAYQKWPT  60

Query  470  AHLELLIPWRGSTKQPRRPTYLKFENRSRALRPR  369
                 + P   S KQ    TYLKFEN+ R+ +P+
Sbjct  61   KSSSFICP--RSIKQQGLLTYLKFENKLRSFQPQ  92



>gb|KFX41037.1| hypothetical protein GQ26_0740040, partial [Talaromyces marneffei 
PM1]
Length=46

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  182  GRSQRKLWWRPAAILTCKSFV*LGYRGERLIE  277
            GRSQRKLWWR AA+LTCKS V  GYRGERLIE
Sbjct  2    GRSQRKLWWRLAAVLTCKSIVKFGYRGERLIE  33



>ref|XP_003366709.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV46218.1| conserved hypothetical protein [Trichinella spiralis]
Length=36

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGFAPLR  174
            VRLVFRPYTQVRR ICTS  LR STRVSSGF  L+
Sbjct  2    VRLVFRPYTQVRRVICTSTPLRTSTRVSSGFILLK  36



>ref|XP_009050220.1| hypothetical protein LOTGIDRAFT_149064, partial [Lottia gigantea]
 ref|XP_009056829.1| hypothetical protein LOTGIDRAFT_145545, partial [Lottia gigantea]
 ref|XP_009067196.1| hypothetical protein LOTGIDRAFT_148535, partial [Lottia gigantea]
 gb|ESO82116.1| hypothetical protein LOTGIDRAFT_148535, partial [Lottia gigantea]
 gb|ESO92478.1| hypothetical protein LOTGIDRAFT_145545, partial [Lottia gigantea]
 gb|ESO99092.1| hypothetical protein LOTGIDRAFT_149064, partial [Lottia gigantea]
Length=50

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAP PK  +RFARQ   GPPP F  AS RSG+VHHLSGP+  A
Sbjct  1    SFAPTPKFRDRFARQNHLGPPPAFLPASSRSGLVHHLSGPNASA  44



>ref|XP_004212671.1| PREDICTED: uncharacterized protein LOC101237460, partial [Hydra 
vulgaris]
Length=62

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 35/55 (64%), Gaps = 11/55 (20%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASP-----------RSGIVHHLSGPDRYA  137
            SFAPI K D+RFARQ R  PPPEFPLASP            S IVHHLS P+R A
Sbjct  1    SFAPILKFDDRFARQNRYEPPPEFPLASPYSSIVAPSGLTYSSIVHHLSDPNRCA  55



>gb|EFN71375.1| hypothetical protein EAG_03557 [Camponotus floridanus]
Length=306

 Score = 41.6 bits (96),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 2/50 (4%)
 Frame = -1

Query  543  VSAQLGTVTRLPVHPASPVLLTKNGPLGAVDSVAR--LNEAAAPSYLFKV  400
            +S +LG +T   VHP +PVLLTKNGPLG +   AR  + + +  S+ FKV
Sbjct  257  MSVELGALTLRLVHPTAPVLLTKNGPLGTLIRDARGFIIQESQRSHPFKV  306


 Score = 40.0 bits (92),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -3

Query  628  VVTHSLADFDFHDHRPAVLIDQHPLW  551
            +VTHSLAD DFH HRPAVL +Q   W
Sbjct  229  LVTHSLADSDFHGHRPAVLSNQRLSW  254



>gb|EGZ76056.1| hypothetical protein NEUTE2DRAFT_35677, partial [Neurospora tetrasperma 
FGSC 2509]
Length=118

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  244  DERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            D+RFARQ RC PPPEFPLASP   IVHHLSGP   A T+     S SV  AP
Sbjct  5    DDRFARQNRCEPPPEFPLASPYPSIVHHLSGPRLNALTQIHPNTSGSVDDAP  56



>gb|KIK74324.1| hypothetical protein PAXRUDRAFT_176058, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=72

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  641  IRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSW  528
            IRQVSCYTLLSGFRLP PPSCCL+  TPFV S     W
Sbjct  2    IRQVSCYTLLSGFRLPWPPSCCLDELTPFVVSDERLLW  39



>gb|ADI72888.1| hypothetical protein, partial [Ophiocordyceps unilateralis]
Length=72

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV S
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVS  33



>gb|EMF07894.1| hypothetical protein SEPMUDRAFT_55199, partial [Sphaerulina musiva 
SO2202]
Length=72

 Score = 55.1 bits (131),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IRQVSCYTLLSGFRLP PPSCCL+  TPFV S
Sbjct  1    FIRQVSCYTLLSGFRLPWPPSCCLDELTPFVVS  33



>gb|KDR65244.1| hypothetical protein GALMADRAFT_82084, partial [Galerina marginata 
CBS 339.88]
Length=90

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 47/105 (45%), Gaps = 29/105 (28%)
 Frame = -2

Query  635  QVSCYTLLSGFRLP*PPSCCLNRPTPFVGSRLARSWAP*PGFRFIPHRQFCLPKMAHLEL  456
            QVSCYT LSGFRLP PPSCCL+  TPFV S                 R+F    +A    
Sbjct  1    QVSCYTFLSGFRLPWPPSCCLDELTPFVVS---------------DEREFRHLNLAFGSS  45

Query  455  LIPWRGSTKQPRRP--------------TYLKFENRSRALRPRCL  363
             I      K P R               TYLKFENR R  +P+ L
Sbjct  46   RIASSAYQKWPTRNSQSPSGPIKRRLVLTYLKFENRLRLFQPQGL  90



>ref|XP_005017309.1| PREDICTED: olfactory receptor 14C36-like [Anas platyrhynchos]
Length=358

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  253  PKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            P SD+RFARQ R GPPPEFPLASP  GIVHHLSGP   A
Sbjct  194  PGSDDRFARQDRYGPPPEFPLASPCPGIVHHLSGPSTRA  232



>ref|XP_001891961.1| LD48059p [Brugia malayi]
Length=39

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  145  CRDPKDGELCLSGAKPEETLVEARSDTDVQIVRLTWV  255
            C DPKDGEL LS  KPEETLV+ RSD+DVQI RLT V
Sbjct  3    CWDPKDGELYLSRMKPEETLVKVRSDSDVQIDRLTLV  39



>ref|XP_001756672.1| predicted protein [Physcomitrella patens]
 gb|EDQ78626.1| predicted protein, partial [Physcomitrella patens]
Length=129

 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 31/44 (70%), Gaps = 9/44 (20%)
 Frame = -3

Query  268  SFAPIPKSDERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYA  137
            SFAPIPKSDERFARQYR   PP         GIVH+LSGP+RY 
Sbjct  1    SFAPIPKSDERFARQYRYESPP---------GIVHYLSGPNRYT  35



>ref|XP_007413089.1| hypothetical protein MELLADRAFT_90069 [Melampsora larici-populina 
98AG31]
 gb|EGG03642.1| hypothetical protein MELLADRAFT_90069 [Melampsora larici-populina 
98AG31]
Length=147

 Score = 44.7 bits (104),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -2

Query  644  LIRQVSCYTLLSGFRLP*PPSCCLNRPTPFVGS  546
             IR +SCYTLLSGFRLP PP  CL+  TPFV S
Sbjct  67   FIRPLSCYTLLSGFRLPWPPCGCLDELTPFVVS  99


 Score = 35.4 bits (80),  Expect(2) = 8e-07, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 20/27 (74%), Gaps = 3/27 (11%)
 Frame = -3

Query  526  HRNPASGSSRIASSAYQKWPT---WSC  455
            H N A GSS IASSAYQKWPT   +SC
Sbjct  106  HLNSAFGSSHIASSAYQKWPTKDFYSC  132



>gb|EHA21130.1| hypothetical protein ASPNIDRAFT_195725 [Aspergillus niger ATCC 
1015]
Length=67

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 39/57 (68%), Gaps = 1/57 (2%)
 Frame = -3

Query  220  RCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAPP*GDPAN-QLPCA  53
            RC PPPEFPLASP SGIVHHLSGP  YA T+   + S SV GAP  G P + +  CA
Sbjct  2    RCEPPPEFPLASPYSGIVHHLSGPHSYALTQIHPKTSGSVDGAPRKGAPTSVRFHCA  58



>gb|EMD30538.1| hypothetical protein CERSUDRAFT_61068 [Ceriporiopsis subvermispora 
B]
Length=142

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = -3

Query  244  DERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            D+RFARQ RC PPPEFPLASP   IVHHLSGP   A T+     S SV  AP
Sbjct  5    DDRFARQNRCEPPPEFPLASPYPSIVHHLSGPRLNALTQIHPNTSGSVDDAP  56



>ref|XP_001230221.1| hypothetical protein CHGG_11100 [Chaetomium globosum CBS 148.51]
 gb|EAQ82864.1| hypothetical protein CHGG_11100 [Chaetomium globosum CBS 148.51]
Length=135

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  244  DERFARQYRCGPPPEFPLASPRSGIVHHLSGPDRYArtrtllrrsrSVGGAP  89
            D+RFARQ RC PPPEFPLASP   IVHHLSGP   A T+   + S SV  AP
Sbjct  5    DDRFARQNRCEPPPEFPLASPYPSIVHHLSGPRLNAPTQIHPKTSGSVDDAP  56



>gb|EHA21137.1| hypothetical protein ASPNIDRAFT_138531 [Aspergillus niger ATCC 
1015]
Length=44

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  185  RSQRKLWWRPAAILTCKSFV*LGYRGERLIE  277
            RSQRKLWWR AA+LTCKS V  GYRGERLIE
Sbjct  1    RSQRKLWWRLAAVLTCKSIVKFGYRGERLIE  31



>ref|XP_003368961.1| conserved hypothetical protein [Trichinella spiralis]
 gb|EFV48988.1| conserved hypothetical protein [Trichinella spiralis]
Length=33

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -2

Query  278  VRLVFRPYTQVRRTICTSVSLRASTRVSSGF  186
            VRLVFRPYTQVRR ICTS  LR STRVSSGF
Sbjct  2    VRLVFRPYTQVRRVICTSTPLRTSTRVSSGF  32



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625