BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041P15

Length=649
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009605819.1|  PREDICTED: lanC-like protein GCL1                  281   2e-89   Nicotiana tomentosiformis
emb|CDP01505.1|  unnamed protein product                                279   1e-88   Coffea canephora [robusta coffee]
ref|XP_006353211.1|  PREDICTED: lanC-like protein 2-like                273   2e-86   Solanum tuberosum [potatoes]
gb|AAF75794.1|AF272710_1  putative 7-transmembrane G-protein-coup...    273   4e-86   Solanum chacoense
gb|EYU30985.1|  hypothetical protein MIMGU_mgv1a006900mg                270   3e-85   Erythranthe guttata [common monkey flower]
ref|XP_009800854.1|  PREDICTED: lanC-like protein GCL1                  269   2e-84   Nicotiana sylvestris
ref|XP_004250112.1|  PREDICTED: lanC-like protein GCL1                  268   2e-84   Solanum lycopersicum
ref|XP_007207243.1|  hypothetical protein PRUPE_ppa006265m1g            254   2e-81   
ref|XP_011100038.1|  PREDICTED: lanC-like protein GCL1                  259   7e-81   Sesamum indicum [beniseed]
ref|XP_008235076.1|  PREDICTED: lanC-like protein GCL1                  254   7e-79   Prunus mume [ume]
ref|XP_007047870.1|  GCR2-like 1                                        254   8e-79   
ref|XP_004288166.1|  PREDICTED: lanC-like protein GCL1                  252   4e-78   Fragaria vesca subsp. vesca
ref|XP_011031065.1|  PREDICTED: lanC-like protein GCL1                  251   1e-77   Populus euphratica
ref|XP_002268951.3|  PREDICTED: lanC-like protein GCL1                  250   2e-77   Vitis vinifera
ref|XP_002262692.1|  PREDICTED: lanC-like protein GCL1 isoform X2       250   2e-77   Vitis vinifera
ref|XP_002306296.2|  hypothetical protein POPTR_0005s07360g             249   6e-77   Populus trichocarpa [western balsam poplar]
ref|XP_010267103.1|  PREDICTED: lanC-like protein GCL1                  248   1e-76   
ref|XP_002309963.2|  hypothetical protein POPTR_0007s05070g             248   2e-76   Populus trichocarpa [western balsam poplar]
emb|CAN83415.1|  hypothetical protein VITISV_029722                     248   2e-76   Vitis vinifera
ref|XP_004502406.1|  PREDICTED: lanC-like protein 2-like                247   3e-76   Cicer arietinum [garbanzo]
ref|XP_010652678.1|  PREDICTED: lanC-like protein GCL1 isoform X1       247   3e-76   Vitis vinifera
ref|XP_008387575.1|  PREDICTED: lanC-like protein GCL1                  247   4e-76   
ref|XP_009339587.1|  PREDICTED: lanC-like protein GCL1                  245   2e-75   Pyrus x bretschneideri [bai li]
ref|XP_009365826.1|  PREDICTED: lanC-like protein GCL1                  245   2e-75   Pyrus x bretschneideri [bai li]
gb|KHG19988.1|  LanC-like protein 2                                     245   2e-75   Gossypium arboreum [tree cotton]
gb|ADU04157.1|  hypothetical protein                                    242   3e-74   Gossypium hirsutum [American cotton]
gb|KJB48857.1|  hypothetical protein B456_008G090400                    242   4e-74   Gossypium raimondii
ref|XP_003601927.1|  G protein-coupled receptor-like protein            238   5e-74   
gb|ADU04150.1|  hypothetical protein                                    241   8e-74   Gossypium hirsutum [American cotton]
ref|XP_006466262.1|  PREDICTED: lanC-like protein GCL1-like             241   1e-73   Citrus sinensis [apfelsine]
ref|XP_011022825.1|  PREDICTED: lanC-like protein GCL1                  240   1e-73   Populus euphratica
gb|KDO60699.1|  hypothetical protein CISIN_1g013959mg                   240   3e-73   Citrus sinensis [apfelsine]
gb|KDO60700.1|  hypothetical protein CISIN_1g013959mg                   239   4e-73   Citrus sinensis [apfelsine]
gb|KHN44353.1|  LanC-like protein 2                                     239   5e-73   Glycine soja [wild soybean]
ref|XP_003538606.1|  PREDICTED: lanC-like protein 2-like isoform X1     238   7e-73   Glycine max [soybeans]
ref|XP_003552029.2|  PREDICTED: lanC-like protein GCL1-like             239   8e-73   Glycine max [soybeans]
ref|XP_006426333.1|  hypothetical protein CICLE_v10025657mg             238   9e-73   Citrus clementina [clementine]
ref|XP_003601926.1|  G protein-coupled receptor-like protein            238   1e-72   Medicago truncatula
gb|KDP29724.1|  hypothetical protein JCGZ_18659                         238   2e-72   Jatropha curcas
ref|XP_010025417.1|  PREDICTED: lanC-like protein GCL1                  237   3e-72   Eucalyptus grandis [rose gum]
ref|XP_008453808.1|  PREDICTED: lanC-like protein GCL1                  236   7e-72   Cucumis melo [Oriental melon]
ref|XP_004146876.1|  PREDICTED: lanC-like protein 2-like                236   8e-72   Cucumis sativus [cucumbers]
ref|XP_010519354.1|  PREDICTED: lanC-like protein GCL1                  235   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_010463250.1|  PREDICTED: lanC-like protein GCL1                  235   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006591491.1|  PREDICTED: lanC-like protein 2-like isoform X2     234   4e-71   Glycine max [soybeans]
ref|XP_008358138.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    233   7e-71   
ref|XP_002531667.1|  catalytic, putative                                233   1e-70   Ricinus communis
ref|XP_010484384.1|  PREDICTED: lanC-like protein GCL1                  233   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_007163665.1|  hypothetical protein PHAVU_001G253500g             232   2e-70   Phaseolus vulgaris [French bean]
ref|XP_002866662.1|  hypothetical protein ARALYDRAFT_358729             232   2e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_006280490.1|  hypothetical protein CARUB_v10026430mg             231   5e-70   
ref|XP_010444546.1|  PREDICTED: lanC-like protein GCL1                  229   4e-69   Camelina sativa [gold-of-pleasure]
gb|AAK96841.1|  G protein-coupled receptor-like protein                 228   7e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201331.1|  protein GCR2-like 1                                   228   8e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28210.1|  hypothetical protein AALP_AA8G486800                    228   9e-69   Arabis alpina [alpine rockcress]
emb|CBI33140.3|  unnamed protein product                                227   5e-68   Vitis vinifera
emb|CDY08803.1|  BnaA06g24210D                                          226   7e-68   Brassica napus [oilseed rape]
ref|XP_009150615.1|  PREDICTED: lanC-like protein GCL1                  225   1e-67   Brassica rapa
ref|XP_006394052.1|  hypothetical protein EUTSA_v10004256mg             223   7e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010680997.1|  PREDICTED: lanC-like protein GCL1                  211   4e-62   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN31391.1|  LanC-like protein 2                                     210   5e-62   Glycine soja [wild soybean]
ref|XP_010937380.1|  PREDICTED: lanC-like protein GCL1                  210   6e-62   Elaeis guineensis
gb|ABK24484.1|  unknown                                                 204   1e-59   Picea sitchensis
ref|XP_006829929.1|  hypothetical protein AMTR_s00073p00158570          178   1e-51   
gb|KJB48858.1|  hypothetical protein B456_008G090400                    166   3e-45   Gossypium raimondii
ref|XP_002966453.1|  hypothetical protein SELMODRAFT_86123              165   9e-45   
ref|XP_001776967.1|  predicted protein                                  156   1e-41   
ref|XP_001758715.1|  predicted protein                                  148   1e-38   
ref|XP_010462143.1|  PREDICTED: lanC-like protein GCR2                  133   5e-33   Camelina sativa [gold-of-pleasure]
emb|CDY53809.1|  BnaA06g01740D                                          132   1e-32   Brassica napus [oilseed rape]
gb|EYU26400.1|  hypothetical protein MIMGU_mgv1a007259mg                131   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_010500915.1|  PREDICTED: lanC-like protein GCR2                  131   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006303704.1|  hypothetical protein CARUB_v10011802mg             130   7e-32   Capsella rubella
emb|CDY26028.1|  BnaC06g05960D                                          129   1e-31   Brassica napus [oilseed rape]
gb|KDP27026.1|  hypothetical protein JCGZ_20961                         129   1e-31   Jatropha curcas
ref|XP_009147647.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    129   1e-31   Brassica rapa
ref|XP_010051804.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    128   3e-31   Eucalyptus grandis [rose gum]
ref|XP_006392852.1|  hypothetical protein EUTSA_v10011533mg             128   3e-31   Eutrema salsugineum [saltwater cress]
ref|XP_002517941.1|  catalytic, putative                                128   3e-31   Ricinus communis
ref|XP_010062888.1|  PREDICTED: lanC-like protein GCR2                  128   4e-31   Eucalyptus grandis [rose gum]
ref|XP_002894411.1|  predicted protein                                  127   6e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010099009.1|  hypothetical protein L484_025669                   126   2e-30   Morus notabilis
gb|KJB84324.1|  hypothetical protein B456_N018400                       126   2e-30   Gossypium raimondii
ref|XP_007021343.1|  G protein coupled receptor                         126   2e-30   
ref|XP_004141231.1|  PREDICTED: lanC-like protein 2-like                126   2e-30   Cucumis sativus [cucumbers]
ref|XP_008348578.1|  PREDICTED: lanC-like protein GCL1                  119   2e-30   
ref|XP_010245303.1|  PREDICTED: lanC-like protein GCL2                  125   2e-30   Nelumbo nucifera [Indian lotus]
ref|XP_009617548.1|  PREDICTED: lanC-like protein GCL2 isoform X1       125   3e-30   Nicotiana tomentosiformis
ref|XP_008676974.1|  PREDICTED: LOC100282928 isoform X1                 126   3e-30   Zea mays [maize]
ref|XP_011042485.1|  PREDICTED: lanC-like protein GCR2                  125   4e-30   Populus euphratica
ref|XP_010241998.1|  PREDICTED: lanC-like protein GCL2 isoform X2       125   4e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006370294.1|  hypothetical protein POPTR_0001s41360g             125   6e-30   Populus trichocarpa [western balsam poplar]
ref|XP_009617549.1|  PREDICTED: lanC-like protein GCL2 isoform X2       124   6e-30   Nicotiana tomentosiformis
gb|ACN31611.1|  unknown                                                 124   6e-30   Zea mays [maize]
ref|XP_009767465.1|  PREDICTED: lanC-like protein GCL2 isoform X1       124   6e-30   Nicotiana sylvestris
gb|ABB47830.2|  Lanthionine synthetase C-like protein, expressed        124   7e-30   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064963.1|  Os10g0497900                                       124   8e-30   
ref|XP_010241999.1|  PREDICTED: lanC-like protein GCL2 isoform X3       124   8e-30   Nelumbo nucifera [Indian lotus]
tpg|DAA49459.1|  TPA: hypothetical protein ZEAMMB73_373795              124   9e-30   
ref|XP_011085355.1|  PREDICTED: lanC-like protein GCL2                  124   1e-29   Sesamum indicum [beniseed]
ref|XP_004982728.1|  PREDICTED: lanC-like protein 2-like                124   1e-29   
tpg|DAA49457.1|  TPA: LOW QUALITY PROTEIN: lanC-like protein 2          124   1e-29   
ref|NP_001149305.1|  LOC100282928                                       124   1e-29   
gb|ABB47829.2|  Lanthionine synthetase C-like protein, expressed        124   1e-29   Oryza sativa Japonica Group [Japonica rice]
gb|AAL58268.1|AC068923_10  putative lanthionine synthetase              124   1e-29   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009767466.1|  PREDICTED: lanC-like protein GCL2 isoform X2       123   1e-29   Nicotiana sylvestris
ref|XP_002284781.1|  PREDICTED: lanC-like protein GCR2                  123   2e-29   Vitis vinifera
gb|KDO74126.1|  hypothetical protein CISIN_1g015433mg                   122   2e-29   Citrus sinensis [apfelsine]
gb|KHG14999.1|  LanC-like protein 2                                     123   3e-29   Gossypium arboreum [tree cotton]
ref|XP_008452476.1|  PREDICTED: lanC-like protein GCL2 isoform X2       123   3e-29   Cucumis melo [Oriental melon]
ref|XP_008452475.1|  PREDICTED: lanC-like protein GCL2 isoform X1       123   3e-29   Cucumis melo [Oriental melon]
ref|XP_010542278.1|  PREDICTED: lanC-like protein GCR2                  122   3e-29   Tarenaya hassleriana [spider flower]
ref|XP_002534246.1|  catalytic, putative                                122   4e-29   Ricinus communis
ref|XP_002467007.1|  hypothetical protein SORBIDRAFT_01g018190          122   4e-29   
ref|XP_008381258.1|  PREDICTED: lanC-like protein GCL2                  122   5e-29   
ref|XP_010234867.1|  PREDICTED: lanC-like protein GCR2 isoform X1       122   6e-29   Brachypodium distachyon [annual false brome]
ref|XP_007043560.1|  GCR2-like 2 isoform 2                              120   7e-29   
dbj|BAJ96048.1|  predicted protein                                      120   7e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO74125.1|  hypothetical protein CISIN_1g015433mg                   121   7e-29   Citrus sinensis [apfelsine]
ref|XP_006464716.1|  PREDICTED: lanC-like protein GCR2-like             121   8e-29   Citrus sinensis [apfelsine]
ref|NP_175700.2|  G-protein coupled receptor 2                          121   8e-29   Arabidopsis thaliana [mouse-ear cress]
pdb|3T33|A  Chain A, Crystal Structure Of Arabidopsis Gcr2              121   8e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52264.1|AC019018_1  putative G protein-coupled receptor; 80...    121   9e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008226665.1|  PREDICTED: lanC-like protein GCR2                  121   1e-28   Prunus mume [ume]
ref|XP_003539910.1|  PREDICTED: lanC-like protein GCL2-like             120   2e-28   Glycine max [soybeans]
ref|XP_008229171.1|  PREDICTED: lanC-like protein GCL2                  120   2e-28   Prunus mume [ume]
ref|XP_003574129.2|  PREDICTED: lanC-like protein GCR2 isoform X2       120   2e-28   Brachypodium distachyon [annual false brome]
ref|XP_007043559.1|  GCR2-like 2 isoform 1                              120   2e-28   
gb|KFK35758.1|  hypothetical protein AALP_AA4G032600                    120   2e-28   Arabis alpina [alpine rockcress]
gb|AGV54697.1|  lanC-like protein 2                                     120   3e-28   Phaseolus vulgaris [French bean]
gb|KJB84326.1|  hypothetical protein B456_N018400                       120   3e-28   Gossypium raimondii
gb|KDP24150.1|  hypothetical protein JCGZ_25807                         120   3e-28   Jatropha curcas
gb|KJB79968.1|  hypothetical protein B456_013G075200                    120   3e-28   Gossypium raimondii
ref|XP_006348234.1|  PREDICTED: lanC-like protein 2-like                120   3e-28   Solanum tuberosum [potatoes]
emb|CAN64758.1|  hypothetical protein VITISV_008093                     120   3e-28   Vitis vinifera
ref|XP_002263345.1|  PREDICTED: lanC-like protein GCL2                  119   4e-28   Vitis vinifera
ref|XP_006827807.1|  hypothetical protein AMTR_s00009p00267750          119   4e-28   
ref|XP_008366750.1|  PREDICTED: lanC-like protein GCL2                  119   4e-28   Malus domestica [apple tree]
ref|XP_010327070.1|  PREDICTED: lanC-like protein GCL2 isoform X2       119   4e-28   
gb|KHG20582.1|  LanC-like protein 2                                     119   5e-28   Gossypium arboreum [tree cotton]
gb|KEH24852.1|  G protein coupled receptor                              118   6e-28   Medicago truncatula
ref|XP_004244211.1|  PREDICTED: lanC-like protein GCL2                  119   6e-28   Solanum lycopersicum
ref|XP_009357824.1|  PREDICTED: lanC-like protein GCL2                  119   6e-28   Pyrus x bretschneideri [bai li]
ref|XP_007212308.1|  hypothetical protein PRUPE_ppa006721mg             119   7e-28   Prunus persica
ref|XP_009400288.1|  PREDICTED: lanC-like protein GCL2                  118   1e-27   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES74528.2|  G protein coupled receptor                              118   1e-27   Medicago truncatula
emb|CDP05888.1|  unnamed protein product                                118   1e-27   Coffea canephora [robusta coffee]
ref|XP_004487685.1|  PREDICTED: lanC-like protein 2-like                118   1e-27   Cicer arietinum [garbanzo]
ref|XP_004248157.1|  PREDICTED: lanC-like protein GCL2 isoform X1       118   1e-27   Solanum lycopersicum
ref|XP_011098332.1|  PREDICTED: lanC-like protein GCR2                  117   2e-27   
gb|KEH38770.1|  G protein coupled receptor                              117   2e-27   Medicago truncatula
ref|XP_009588409.1|  PREDICTED: lanC-like protein GCL2                  117   3e-27   Nicotiana tomentosiformis
ref|XP_006451926.1|  hypothetical protein CICLE_v10008488mg             117   3e-27   Citrus clementina [clementine]
ref|XP_003540453.1|  PREDICTED: lanC-like protein GCR2-like             117   4e-27   Glycine max [soybeans]
ref|XP_008809400.1|  PREDICTED: lanC-like protein GCL2                  117   4e-27   Phoenix dactylifera
gb|KHN28043.1|  LanC-like protein 2                                     117   4e-27   Glycine soja [wild soybean]
ref|XP_009766748.1|  PREDICTED: lanC-like protein GCL2                  116   5e-27   Nicotiana sylvestris
ref|XP_007149603.1|  hypothetical protein PHAVU_005G083500g             116   5e-27   Phaseolus vulgaris [French bean]
ref|XP_010918434.1|  PREDICTED: lanC-like protein GCL2 isoform X1       116   6e-27   Elaeis guineensis
ref|XP_009400289.1|  PREDICTED: lanC-like protein GCL2                  115   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007215460.1|  hypothetical protein PRUPE_ppa006408mg             115   1e-26   Prunus persica
ref|XP_010686440.1|  PREDICTED: lanC-like protein GCL2                  115   2e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS68258.1|  LanC-like protein 2                                     115   2e-26   Triticum urartu
ref|XP_010675629.1|  PREDICTED: lanC-like protein GCR2                  115   2e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007132705.1|  hypothetical protein PHAVU_011G117700g             115   2e-26   Phaseolus vulgaris [French bean]
ref|XP_009343572.1|  PREDICTED: lanC-like protein GCR2                  114   3e-26   Pyrus x bretschneideri [bai li]
ref|XP_006661914.1|  PREDICTED: lanC-like protein GCR2-like             114   3e-26   
ref|XP_011045509.1|  PREDICTED: lanC-like protein GCL2                  114   4e-26   Populus euphratica
gb|EAZ16566.1|  hypothetical protein OsJ_32039                          113   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004514463.1|  PREDICTED: lanC-like protein 2-like                112   1e-25   
ref|XP_010661310.1|  PREDICTED: lanC-like protein GCL2                  110   2e-25   Vitis vinifera
gb|EMT26581.1|  LanC-like protein 2                                     113   2e-25   
ref|XP_006409014.1|  hypothetical protein EUTSA_v10002001mg             111   3e-25   Eutrema salsugineum [saltwater cress]
gb|KFK43530.1|  hypothetical protein AALP_AA1G138200                    110   3e-25   Arabis alpina [alpine rockcress]
ref|XP_004244212.1|  PREDICTED: lanC-like protein GCR2                  111   3e-25   Solanum lycopersicum
ref|XP_002884221.1|  hypothetical protein ARALYDRAFT_480913             111   4e-25   
ref|NP_850003.1|  protein GCR2-LIKE 2                                   110   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ABQ14360.1|  abscisic acid ABA receptor                              110   9e-25   Populus trichocarpa [western balsam poplar]
ref|XP_008338576.1|  PREDICTED: uncharacterized protein LOC103401641    106   1e-24   
ref|XP_006348233.1|  PREDICTED: lanC-like protein 2-like                109   1e-24   Solanum tuberosum [potatoes]
ref|XP_010241996.1|  PREDICTED: lanC-like protein GCL2 isoform X1       109   2e-24   Nelumbo nucifera [Indian lotus]
gb|EYU26156.1|  hypothetical protein MIMGU_mgv1a007017mg                109   2e-24   Erythranthe guttata [common monkey flower]
emb|CDP14758.1|  unnamed protein product                                109   2e-24   Coffea canephora [robusta coffee]
gb|KFK40450.1|  hypothetical protein AALP_AA3G374700                    108   3e-24   Arabis alpina [alpine rockcress]
ref|NP_001174024.1|  Os04g0529600                                       107   6e-24   
emb|CAJ86377.1|  OSIGBa0155K17.4                                        107   7e-24   Oryza sativa [red rice]
ref|XP_004291663.1|  PREDICTED: lanC-like protein GCR2                  107   9e-24   Fragaria vesca subsp. vesca
ref|XP_006299729.1|  hypothetical protein CARUB_v10015922mg             106   2e-23   Capsella rubella
ref|XP_003618310.1|  LanC-like protein                                  106   3e-23   
ref|XP_002319360.2|  hypothetical protein POPTR_0013s13850g             104   4e-23   
gb|AAD20918.1|  hypothetical protein                                    102   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102106.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    101   8e-22   Brassica rapa
gb|AGV54199.1|  lanC-like protein                                       100   1e-21   Phaseolus vulgaris [French bean]
emb|CDY55165.1|  BnaCnng28300D                                        99.8    2e-21   Brassica napus [oilseed rape]
emb|CBI38211.3|  unnamed protein product                              97.4    8e-21   Vitis vinifera
ref|XP_010918435.1|  PREDICTED: lanC-like protein GCL2 isoform X2     94.4    3e-19   
emb|CDY31938.1|  BnaA07g00570D                                        93.6    5e-19   Brassica napus [oilseed rape]
ref|XP_010555129.1|  PREDICTED: lanC-like protein GCL2                88.2    5e-17   Tarenaya hassleriana [spider flower]
ref|XP_010555131.1|  PREDICTED: lanC-like protein GCL2                87.4    1e-16   Tarenaya hassleriana [spider flower]
gb|KCW62074.1|  hypothetical protein EUGRSUZ_H04744                   87.0    2e-16   Eucalyptus grandis [rose gum]
ref|XP_006591493.1|  PREDICTED: lanC-like protein 2-like isoform X4   82.8    2e-15   Glycine max [soybeans]
gb|EPS72953.1|  hypothetical protein M569_01804                       79.7    3e-15   Genlisea aurea
gb|KJB84322.1|  hypothetical protein B456_N018400                     73.6    3e-12   Gossypium raimondii
gb|KJB84323.1|  hypothetical protein B456_N018400                     73.6    5e-12   Gossypium raimondii
ref|XP_004172119.1|  PREDICTED: lanC-like protein 2-like              70.5    3e-11   
gb|KDO74127.1|  hypothetical protein CISIN_1g015433mg                 69.7    7e-11   Citrus sinensis [apfelsine]
tpg|DAA49458.1|  TPA: hypothetical protein ZEAMMB73_373795            65.5    4e-10   
emb|CBG76444.1|  OO_Ba0013J05-OO_Ba0033A15.31                         69.3    4e-10   Oryza officinalis
ref|XP_001605213.2|  PREDICTED: lanC-like protein 1 isoform X1        65.1    6e-09   
ref|XP_003424467.1|  PREDICTED: lanC-like protein 2 isoform X2        64.7    6e-09   Nasonia vitripennis
ref|XP_004172511.1|  PREDICTED: lanC-like protein 2-like              60.8    9e-09   
ref|XP_004335796.1|  LanC lantibiotic synthetase                      63.2    2e-08   Acanthamoeba castellanii str. Neff
ref|XP_002110672.1|  hypothetical protein TRIADDRAFT_54925            62.4    3e-08   Trichoplax adhaerens
ref|XP_009967231.1|  PREDICTED: lanC-like protein 1                   58.5    9e-08   Tyto alba [Schleiereule]
ref|XP_005021837.1|  PREDICTED: lanC-like protein 1                   60.8    1e-07   
ref|XP_009015183.1|  hypothetical protein HELRODRAFT_188186           60.8    1e-07   Helobdella robusta
ref|XP_010406143.1|  PREDICTED: lanC-like protein 1                   60.5    1e-07   Corvus cornix cornix
gb|KFO54122.1|  LanC-like 1                                           60.5    2e-07   Corvus brachyrhynchos
ref|XP_008641803.1|  PREDICTED: lanC-like protein 1                   60.5    2e-07   
ref|XP_003766010.1|  PREDICTED: lanC-like protein 1                   60.5    2e-07   
ref|XP_001364295.2|  PREDICTED: lanC-like protein 1 isoform X1        60.5    2e-07   Monodelphis domestica
ref|XP_007501858.1|  PREDICTED: lanC-like protein 1 isoform X2        60.1    2e-07   
ref|XP_007470076.1|  PREDICTED: lanC-like protein 1                   59.7    3e-07   Lipotes vexillifer [baiji]
gb|KGL95390.1|  LanC-like 1                                           59.7    3e-07   Charadrius vociferus
ref|XP_009885874.1|  PREDICTED: lanC-like protein 1 isoform X1        59.7    3e-07   Charadrius vociferus
ref|XP_009885875.1|  PREDICTED: lanC-like protein 1 isoform X2        59.3    4e-07   Charadrius vociferus
ref|XP_010281072.1|  PREDICTED: lanC-like protein 1                   59.3    4e-07   Phaethon lepturus
gb|KFP32110.1|  LanC-like 1                                           59.3    4e-07   Colius striatus
ref|XP_010581555.1|  PREDICTED: lanC-like protein 1                   58.9    5e-07   Haliaeetus leucocephalus
ref|XP_010201115.1|  PREDICTED: lanC-like protein 1                   58.9    5e-07   Colius striatus
ref|XP_008926719.1|  PREDICTED: lanC-like protein 1                   58.5    6e-07   
gb|KFW84735.1|  LanC-like 1                                           58.5    7e-07   Manacus vitellinus
ref|XP_005486943.1|  PREDICTED: lanC-like protein 1                   58.5    8e-07   Zonotrichia albicollis
gb|KFV88367.1|  LanC-like 1                                           58.2    9e-07   Struthio camelus australis
gb|KFO80625.1|  LanC-like 1                                           58.2    9e-07   Cuculus canorus
gb|KFP09242.1|  LanC-like 1                                           58.2    9e-07   Egretta garzetta
ref|XP_009686963.1|  PREDICTED: lanC-like protein 1                   58.2    9e-07   Struthio camelus australis
ref|XP_009634935.1|  PREDICTED: lanC-like protein 1                   58.2    9e-07   Egretta garzetta
ref|XP_009279358.1|  PREDICTED: lanC-like protein 1                   58.2    1e-06   
ref|XP_005244494.1|  PREDICTED: lanC-like protein 1                   58.2    1e-06   
gb|KFQ90951.1|  LanC-like 1                                           58.2    1e-06   Nipponia nippon
ref|XP_009565204.1|  PREDICTED: lanC-like protein 1                   58.2    1e-06   Cuculus canorus
ref|XP_009460226.1|  PREDICTED: lanC-like protein 1                   58.2    1e-06   Nipponia nippon
ref|XP_005428015.1|  PREDICTED: lanC-like protein 1                   57.8    1e-06   Geospiza fortis
ref|XP_002197149.1|  PREDICTED: lanC-like protein 1                   57.8    1e-06   Taeniopygia guttata
ref|XP_005441569.1|  PREDICTED: lanC-like protein 1                   57.8    1e-06   Falco cherrug
ref|XP_010711615.1|  PREDICTED: lanC-like protein 1                   57.8    1e-06   Meleagris gallopavo [common turkey]
ref|XP_009327921.1|  PREDICTED: lanC-like protein 1                   57.8    1e-06   Pygoscelis adeliae
gb|KFM08745.1|  LanC-like 1                                           57.8    1e-06   Aptenodytes forsteri
ref|XP_008143428.1|  PREDICTED: lanC-like protein 1                   57.8    1e-06   Eptesicus fuscus
ref|XP_010309333.1|  PREDICTED: lanC-like protein 1                   57.4    2e-06   Balearica regulorum gibbericeps
ref|NP_001082380.1|  LanC lantibiotic synthetase component C-like 1   57.4    2e-06   Xenopus laevis [clawed frog]
ref|XP_010084089.1|  PREDICTED: lanC-like protein 1                   57.0    2e-06   Pterocles gutturalis
gb|KFV02516.1|  LanC-like 1                                           57.0    2e-06   Pterocles gutturalis
ref|XP_005144230.1|  PREDICTED: lanC-like protein 1                   56.6    3e-06   Melopsittacus undulatus
ref|XP_009491749.1|  PREDICTED: lanC-like protein 1                   56.6    3e-06   Pelecanus crispus
ref|XP_006022339.1|  PREDICTED: lanC-like protein 1                   56.6    3e-06   Alligator sinensis
ref|XP_005528946.1|  PREDICTED: lanC-like protein 1                   56.6    4e-06   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005279741.1|  PREDICTED: lanC-like protein 1                   56.2    4e-06   Chrysemys picta bellii
gb|KFR03138.1|  LanC-like 1                                           56.2    4e-06   Opisthocomus hoazin [hoatzin]
gb|EMC79581.1|  LanC-like protein 1                                   56.2    4e-06   
ref|XP_005874242.1|  PREDICTED: lanC-like protein 1                   56.2    4e-06   Myotis brandtii
ref|XP_009942928.1|  PREDICTED: lanC-like protein 1                   56.2    4e-06   Opisthocomus hoazin [hoatzin]
ref|XP_007524577.1|  PREDICTED: lanC-like protein 1                   56.2    5e-06   Erinaceus europaeus [common hedgehog]
ref|XP_009086433.1|  PREDICTED: lanC-like protein 1                   56.2    5e-06   Serinus canaria [canary]
ref|XP_005501752.1|  PREDICTED: lanC-like protein 1                   56.2    5e-06   Columba livia [carrier pigeon]
ref|XP_006872805.1|  PREDICTED: lanC-like protein 1                   56.2    5e-06   Chrysochloris asiatica
ref|XP_003991153.1|  PREDICTED: lanC-like protein 1                   56.2    5e-06   Felis catus [cat]
gb|KFW90395.1|  LanC-like 1                                           55.8    5e-06   Phalacrocorax carbo [common cormorant]
ref|XP_006082817.1|  PREDICTED: lanC-like protein 1                   55.8    5e-06   
ref|XP_009501831.1|  PREDICTED: lanC-like protein 1                   55.8    6e-06   Phalacrocorax carbo [common cormorant]
gb|KFQ83337.1|  LanC-like 1                                           55.8    6e-06   Phoenicopterus ruber ruber
gb|EMP24291.1|  LanC-like protein 1                                   55.8    6e-06   Chelonia mydas [green seaturtle]
gb|KFQ03534.1|  LanC-like 1                                           55.8    6e-06   Leptosomus discolor
ref|XP_007086146.1|  PREDICTED: lanC-like protein 1                   55.8    6e-06   Panthera tigris altaica
ref|XP_009995128.1|  PREDICTED: lanC-like protein 1                   55.5    7e-06   Chaetura pelagica
ref|XP_009954662.1|  PREDICTED: lanC-like protein 1                   55.5    7e-06   Leptosomus discolor
ref|XP_011173044.1|  PREDICTED: lanC-like protein 1 isoform X2        55.5    7e-06   Solenopsis invicta [imported red fire ant]
ref|XP_007071974.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...  55.5    7e-06   
ref|XP_008503139.1|  PREDICTED: lanC-like protein 1                   55.5    7e-06   
gb|KFO96908.1|  LanC-like 1                                           55.5    8e-06   
ref|XP_008548061.1|  PREDICTED: lanC-like protein 2                   55.5    8e-06   
ref|XP_003215180.1|  PREDICTED: lanC-like protein 1                   55.5    8e-06   
ref|XP_006276713.1|  PREDICTED: lanC-like protein 1                   55.5    9e-06   
ref|NP_001026416.1|  lanC-like protein 1                              55.1    1e-05   
ref|XP_005170667.1|  PREDICTED: lanC-like protein 2 isoform X1        55.1    1e-05   
ref|XP_010224061.1|  PREDICTED: lanC-like protein 1                   54.7    1e-05   
ref|XP_004262814.1|  PREDICTED: lanC-like protein 1                   54.7    1e-05   
ref|XP_010012429.1|  PREDICTED: lanC-like protein 1                   54.7    2e-05   
gb|AAI08635.1|  LOC733417 protein                                     54.3    2e-05   
ref|XP_009810346.1|  PREDICTED: lanC-like protein 1                   54.3    2e-05   
gb|KGL84870.1|  LanC-like 1                                           54.3    2e-05   
gb|KFQ71604.1|  LanC-like 1                                           54.3    2e-05   
ref|XP_006190570.1|  PREDICTED: lanC-like protein 1                   54.3    2e-05   
ref|XP_006205316.1|  PREDICTED: lanC-like protein 1                   54.3    2e-05   
ref|XP_536055.1|  PREDICTED: lanC-like protein 1                      53.9    2e-05   
gb|KFV64229.1|  LanC-like 1                                           53.9    2e-05   
emb|CAN83472.1|  hypothetical protein VITISV_004795                   52.0    2e-05   
ref|XP_010890392.1|  PREDICTED: lanC-like protein 1                   53.9    3e-05   
gb|EPY76822.1|  lanC-like protein                                     53.9    3e-05   
ref|XP_009065953.1|  hypothetical protein LOTGIDRAFT_179770           53.9    3e-05   
ref|XP_009894709.1|  PREDICTED: lanC-like protein 1                   53.9    3e-05   
gb|ELR61273.1|  LanC-like protein 1                                   53.9    3e-05   
ref|XP_006050069.1|  PREDICTED: lanC-like protein 1 isoform X1        53.9    3e-05   
ref|XP_005331925.1|  PREDICTED: lanC-like protein 1                   53.5    3e-05   
ref|XP_005889054.1|  PREDICTED: lanC-like protein 1                   53.5    3e-05   
gb|KFW71076.1|  LanC-like 1                                           53.5    3e-05   
ref|NP_001014209.1|  lanC-like protein 2                              53.5    4e-05   
ref|NP_001076472.1|  lanC-like protein 2                              53.5    4e-05   
ref|XP_004646693.1|  PREDICTED: lanC-like protein 2                   53.5    4e-05   
gb|EDL88039.1|  rCG52346, isoform CRA_c                               53.1    4e-05   
ref|XP_006779000.1|  PREDICTED: lanC-like protein 1                   53.5    4e-05   
gb|KFP85016.1|  LanC-like 2                                           53.1    4e-05   
ref|XP_009863709.1|  PREDICTED: lanC-like protein 2                   53.1    4e-05   
gb|EDL88038.1|  rCG52346, isoform CRA_b                               53.1    5e-05   
ref|XP_011227157.1|  PREDICTED: lanC-like protein 1 isoform X2        53.1    5e-05   
ref|XP_011173043.1|  PREDICTED: lanC-like protein 1 isoform X1        53.1    6e-05   
gb|KFV53979.1|  LanC-like 1                                           50.4    6e-05   
ref|XP_010778897.1|  PREDICTED: lanC-like protein 1                   52.8    6e-05   
ref|NP_001016046.1|  LanC lantibiotic synthetase component C-like 1   52.8    7e-05   
ref|XP_418874.2|  PREDICTED: lanC-like protein 2                      52.8    7e-05   
gb|ENN75886.1|  hypothetical protein YQE_07615                        52.8    7e-05   
gb|EFB30089.1|  hypothetical protein PANDA_011374                     52.8    7e-05   
ref|XP_011227156.1|  PREDICTED: lanC-like protein 1 isoform X1        52.8    8e-05   
ref|XP_005049050.1|  PREDICTED: lanC-like protein 1 isoform X1        52.8    8e-05   
ref|XP_004004942.1|  PREDICTED: lanC-like protein 1                   52.4    8e-05   
ref|XP_007421728.1|  PREDICTED: lanC-like protein 1 isoform X4        52.4    8e-05   
ref|XP_010859418.1|  PREDICTED: lanC-like protein 1                   52.4    8e-05   
gb|KFO91723.1|  LanC-like 2                                           52.4    8e-05   
gb|EDL04744.1|  LanC (bacterial lantibiotic synthetase component ...  52.4    9e-05   
gb|ERL88810.1|  hypothetical protein D910_06192                       52.4    9e-05   
ref|XP_005676543.1|  PREDICTED: lanC-like protein 1 isoform X1        52.4    9e-05   
emb|CAG12678.1|  unnamed protein product                              52.4    9e-05   
ref|XP_006992062.1|  PREDICTED: lanC-like protein 2-like              52.4    1e-04   
gb|KFZ53917.1|  LanC-like 1                                           52.0    1e-04   
ref|XP_005076162.1|  PREDICTED: lanC-like protein 2-like              52.0    1e-04   
ref|XP_008685682.1|  PREDICTED: lanC-like protein 1 isoform X1        52.0    1e-04   
ref|XP_010137609.1|  PREDICTED: lanC-like protein 2                   52.0    1e-04   
ref|NP_598498.1|  lanC-like protein 2                                 52.0    1e-04   
gb|KFV53555.1|  LanC-like 1                                           52.0    1e-04   
gb|KFO15126.1|  LanC-like 1                                           52.0    1e-04   
ref|XP_006140153.1|  PREDICTED: lanC-like protein 1 isoform X1        52.0    1e-04   
gb|KFU97310.1|  LanC-like 2                                           52.0    1e-04   
ref|XP_007421725.1|  PREDICTED: lanC-like protein 1 isoform X1        52.0    1e-04   
gb|KFV14132.1|  LanC-like 1                                           52.0    1e-04   
gb|ELW72707.1|  LanC-like protein 1                                   52.0    1e-04   
ref|XP_006140154.1|  PREDICTED: lanC-like protein 1 isoform X2        52.0    1e-04   
ref|XP_008685684.1|  PREDICTED: lanC-like protein 1 isoform X2        51.6    1e-04   
ref|XP_004576925.1|  PREDICTED: lanC-like protein 1                   52.0    1e-04   
ref|XP_007187922.1|  PREDICTED: lanC-like protein 1 isoform X1        52.0    1e-04   
ref|XP_004839896.1|  PREDICTED: lanC-like protein 2 isoform X1        52.0    1e-04   
ref|XP_004877353.1|  PREDICTED: lanC-like protein 2                   51.6    1e-04   
gb|AAX37077.1|  LanC lantibiotic synthetase component C-like 1        51.6    1e-04   
ref|XP_003254074.1|  PREDICTED: lanC-like protein 1 isoform 1         51.6    2e-04   
gb|KFV83634.1|  LanC-like 2                                           51.6    2e-04   
ref|XP_009677694.1|  PREDICTED: lanC-like protein 2                   51.6    2e-04   
gb|ACU17850.1|  unknown                                               51.2    2e-04   
emb|CAG46576.1|  LANCL1                                               51.6    2e-04   
ref|XP_003785027.1|  PREDICTED: lanC-like protein 1                   51.6    2e-04   
ref|XP_009980699.1|  PREDICTED: lanC-like protein 1                   51.6    2e-04   
gb|EHA98285.1|  LanC-like protein 2                                   51.6    2e-04   
ref|XP_007233451.1|  PREDICTED: lanC-like protein 2                   51.6    2e-04   
gb|KFQ96721.1|  LanC-like 2                                           51.2    2e-04   
gb|KFP38661.1|  LanC-like 1                                           51.2    2e-04   
ref|XP_002749787.2|  PREDICTED: lanC-like protein 1 isoform X1        51.6    2e-04   
ref|XP_005041412.1|  PREDICTED: lanC-like protein 2                   51.6    2e-04   
ref|XP_009092160.1|  PREDICTED: lanC-like protein 2                   51.6    2e-04   
ref|XP_003925633.1|  PREDICTED: lanC-like protein 1                   51.6    2e-04   
ref|XP_005360945.1|  PREDICTED: lanC-like protein 2                   51.6    2e-04   
ref|XP_010085360.1|  PREDICTED: lanC-like protein 2                   51.2    2e-04   
ref|XP_010127468.1|  PREDICTED: lanC-like protein 1                   51.2    2e-04   
ref|XP_010396952.1|  PREDICTED: lanC-like protein 2                   51.2    2e-04   
ref|XP_008997665.1|  PREDICTED: lanC-like protein 1 isoform X2        51.2    2e-04   
ref|XP_004839897.1|  PREDICTED: lanC-like protein 2 isoform X2        51.2    2e-04   
ref|XP_009463056.1|  PREDICTED: lanC-like protein 2                   51.2    2e-04   
ref|XP_005425762.1|  PREDICTED: lanC-like protein 2                   51.2    2e-04   
ref|XP_004066586.1|  PREDICTED: lanC-like protein 1                   51.2    2e-04   
ref|XP_010353221.1|  PREDICTED: lanC-like protein 1                   51.2    2e-04   
gb|KFP61249.1|  LanC-like 1                                           51.2    2e-04   
ref|XP_003907950.1|  PREDICTED: lanC-like protein 1 isoform X2        51.2    2e-04   
ref|XP_010742160.1|  PREDICTED: lanC-like protein 1                   51.2    2e-04   
gb|KFP51381.1|  LanC-like 2                                           51.2    2e-04   
gb|KFQ21954.1|  LanC-like 2                                           51.2    2e-04   
gb|KFO59252.1|  LanC-like 2                                           51.2    2e-04   
gb|KFO08104.1|  LanC-like 2                                           51.2    2e-04   
ref|XP_009704758.1|  PREDICTED: lanC-like protein 1                   51.2    2e-04   
ref|XP_005445171.1|  PREDICTED: lanC-like protein 2                   51.2    2e-04   
ref|XP_009181236.1|  PREDICTED: lanC-like protein 1 isoform X1        51.2    2e-04   
gb|KFV53091.1|  LanC-like 2                                           51.2    2e-04   
ref|XP_010286842.1|  PREDICTED: lanC-like protein 2                   50.8    2e-04   
ref|XP_003309499.1|  PREDICTED: lanC-like protein 1 isoform X2        51.2    2e-04   
ref|XP_009887721.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
ref|XP_009572443.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
gb|KFW01635.1|  LanC-like 2                                           50.8    3e-04   
ref|XP_009928472.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
ref|XP_008632157.1|  PREDICTED: lanC-like protein 2                   51.2    3e-04   
ref|XP_009075666.1|  PREDICTED: lanC-like protein 1                   51.2    3e-04   
ref|XP_010311253.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
ref|XP_009999832.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
ref|XP_009703975.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
ref|XP_005519153.1|  PREDICTED: lanC-like protein 2                   51.2    3e-04   
ref|XP_004033195.1|  PREDICTED: lanC-like protein 1 isoform 1         50.8    3e-04   
ref|NP_006046.1|  lanC-like protein 1                                 50.8    3e-04   
ref|NP_001245050.1|  lanC-like protein 1                              50.8    3e-04   
gb|AAV38168.1|  LanC lantibiotic synthetase component C-like 1 (b...  50.8    3e-04   
pdb|3E6U|A  Chain A, Crystal Structure Of Human Lancl1                50.8    3e-04   
gb|KFP97922.1|  LanC-like 2                                           50.8    3e-04   
gb|KFV65638.1|  LanC-like 2                                           50.8    3e-04   
ref|XP_008489494.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
dbj|BAG35299.1|  unnamed protein product                              50.8    3e-04   
ref|XP_005574229.1|  PREDICTED: lanC-like protein 1 isoform X2        50.8    3e-04   
ref|XP_005246300.1|  PREDICTED: lanC-like protein 1 isoform X1        50.8    3e-04   
gb|KGL96810.1|  LanC-like 2                                           50.8    3e-04   
ref|XP_002712500.1|  PREDICTED: lanC-like protein 1                   50.8    3e-04   
gb|KFP49501.1|  LanC-like 1                                           50.8    3e-04   
ref|XP_008305653.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
ref|XP_005487037.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
ref|XP_008934094.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
ref|XP_009966730.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
ref|XP_005574228.1|  PREDICTED: lanC-like protein 1 isoform X1        50.8    3e-04   
gb|KFW04656.1|  LanC-like 1                                           50.8    3e-04   
ref|XP_004405425.1|  PREDICTED: lanC-like protein 1                   50.8    3e-04   
gb|EFZ09548.1|  hypothetical protein SINV_11015                       50.8    3e-04   
ref|XP_009442472.1|  PREDICTED: lanC-like protein 1 isoform X1        50.8    3e-04   
ref|XP_797679.2|  PREDICTED: lanC-like protein 2-like                 50.8    3e-04   
ref|XP_009917699.1|  PREDICTED: lanC-like protein 1                   50.8    3e-04   
ref|NP_001125139.1|  lanC-like protein 1                              50.8    3e-04   
gb|KFU92543.1|  LanC-like 2                                           50.8    3e-04   
ref|XP_008919586.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
gb|KFP67740.1|  LanC-like 2                                           50.8    3e-04   
ref|XP_009896607.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
ref|XP_011173045.1|  PREDICTED: lanC-like protein 1 isoform X3        50.8    3e-04   
gb|KFO98915.1|  LanC-like 2                                           50.8    3e-04   
gb|KFW78803.1|  LanC-like 2                                           50.4    3e-04   
ref|XP_005969890.1|  PREDICTED: lanC-like protein 1 isoform X1        50.8    3e-04   
ref|XP_009575790.1|  PREDICTED: lanC-like protein 1                   50.8    3e-04   
ref|XP_009643058.1|  PREDICTED: lanC-like protein 2                   50.8    3e-04   
gb|KFQ08664.1|  LanC-like 2                                           50.4    3e-04   
gb|KFM00768.1|  LanC-like 2                                           50.4    3e-04   
gb|KFQ32406.1|  LanC-like 2                                           50.4    3e-04   
ref|XP_009946789.1|  PREDICTED: lanC-like protein 2                   50.4    3e-04   
gb|KFZ55043.1|  LanC-like 2                                           50.4    4e-04   
ref|XP_009273304.1|  PREDICTED: lanC-like protein 2                   50.4    4e-04   
ref|XP_003470156.1|  PREDICTED: lanC-like protein 2                   50.8    4e-04   
ref|XP_007578903.1|  PREDICTED: lanC-like protein 2                   50.1    4e-04   
gb|EFA81797.1|  bacterial lantibiotic synthetase component C-like...  50.4    4e-04   
ref|XP_005506618.1|  PREDICTED: lanC-like protein 2                   50.4    4e-04   
ref|XP_008825772.1|  PREDICTED: lanC-like protein 2                   50.4    4e-04   
gb|KFO33010.1|  LanC-like protein 2                                   50.4    4e-04   
ref|XP_003406133.1|  PREDICTED: lanC-like protein 1 isoform X1        50.4    4e-04   
ref|XP_010162821.1|  PREDICTED: lanC-like protein 2                   50.4    4e-04   
ref|XP_010623360.1|  PREDICTED: lanC-like protein 2                   50.4    4e-04   
ref|XP_003504936.1|  PREDICTED: lanC-like protein 2 isoform X1        50.4    4e-04   
gb|AAH61705.1|  Lancl1 protein                                        50.4    4e-04   
gb|KFV92689.1|  LanC-like 2                                           50.4    4e-04   
ref|XP_010179314.1|  PREDICTED: lanC-like protein 2                   50.4    4e-04   
gb|EFX66197.1|  hypothetical protein DAPPUDRAFT_302906                50.4    4e-04   
ref|XP_003378436.1|  conserved hypothetical protein                   50.4    4e-04   
ref|XP_004767073.1|  PREDICTED: lanC-like protein 1 isoform X1        50.4    4e-04   
gb|KFV49458.1|  LanC-like 2                                           50.1    5e-04   
ref|XP_005235317.1|  PREDICTED: lanC-like protein 2                   50.4    5e-04   
ref|XP_010600494.1|  PREDICTED: lanC-like protein 1 isoform X2        50.1    5e-04   
ref|XP_010745166.1|  PREDICTED: lanC-like protein 2                   50.4    5e-04   
ref|NP_001009891.1|  lanC-like protein 1                              50.4    5e-04   
gb|KFQ04380.1|  LanC-like 1                                           50.1    5e-04   
ref|XP_004794591.1|  PREDICTED: lanC-like protein 1 isoform X1        50.4    5e-04   
ref|XP_006891993.1|  PREDICTED: lanC-like protein 1                   50.1    5e-04   
ref|XP_010148638.1|  PREDICTED: lanC-like protein 2                   50.1    5e-04   
ref|XP_008289518.1|  PREDICTED: lanC-like protein 2                   50.4    5e-04   
gb|ERE66398.1|  lanC-like protein 2                                   50.1    5e-04   
gb|KFQ88876.1|  LanC-like 2                                           50.1    5e-04   
gb|KFO81744.1|  LanC-like 2                                           50.1    5e-04   
ref|XP_009820748.1|  PREDICTED: lanC-like protein 2                   50.1    5e-04   
ref|XP_007633708.1|  PREDICTED: lanC-like protein 2 isoform X2        50.1    5e-04   
gb|KFV19785.1|  LanC-like 2                                           50.1    5e-04   
ref|XP_010711417.1|  PREDICTED: lanC-like protein 2                   50.1    5e-04   
ref|XP_005014987.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...  50.1    5e-04   
ref|XP_004427825.1|  PREDICTED: lanC-like protein 1                   50.1    5e-04   
ref|XP_009566764.1|  PREDICTED: lanC-like protein 2                   50.1    6e-04   
gb|EOB04765.1|  LanC-like protein 2                                   50.1    6e-04   
ref|XP_003474247.1|  PREDICTED: lanC-like protein 1                   50.1    6e-04   
ref|XP_010884003.1|  PREDICTED: lanC-like protein 2                   50.1    6e-04   
ref|XP_007932698.1|  PREDICTED: lanC-like protein 1                   50.1    6e-04   
ref|XP_007043561.1|  GCR2-like 2 isoform 3                            49.7    6e-04   
ref|XP_004674390.1|  PREDICTED: lanC-like protein 1                   50.1    6e-04   
ref|NP_001069695.1|  lanC-like protein 1                              49.7    6e-04   
ref|XP_009987546.1|  PREDICTED: lanC-like protein 2                   49.7    6e-04   
ref|XP_006636361.1|  PREDICTED: lanC-like protein 1-like              49.7    7e-04   
ref|XP_008578632.1|  PREDICTED: lanC-like protein 1                   49.7    7e-04   
ref|XP_011053545.1|  PREDICTED: lanC-like protein 2                   49.7    7e-04   
ref|XP_005941323.1|  PREDICTED: lanC-like protein 2-like isoform X1   49.7    7e-04   
ref|XP_004601384.1|  PREDICTED: lanC-like protein 1                   49.7    7e-04   
ref|XP_001488631.1|  PREDICTED: lanC-like protein 1 isoform X1        49.7    7e-04   
gb|KFZ50821.1|  LanC-like 1                                           49.7    7e-04   
ref|XP_004573726.1|  PREDICTED: lanC-like protein 2-like              49.7    7e-04   
ref|XP_010170999.1|  PREDICTED: lanC-like protein 1                   49.7    8e-04   
ref|XP_008844469.1|  PREDICTED: lanC-like protein 1                   49.3    0.001   
gb|KGL77828.1|  LanC-like 2                                           49.3    0.001   
gb|KFQ56523.1|  LanC-like 1                                           49.3    0.001   
ref|XP_006810162.1|  PREDICTED: lanC-like protein 2-like              48.9    0.001   



>ref|XP_009605819.1| PREDICTED: lanC-like protein GCL1 [Nicotiana tomentosiformis]
Length=430

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 164/205 (80%), Gaps = 9/205 (4%)
 Frame = +1

Query  52   MSSSIVHLASPESNGT----NHEDGN---DSGFRTVLDPTAPSFILPAETFLQAAVSLKD  210
            MSSS+V  AS E+N       HEDGN   DS       PTA +  LP+ETFLQAA+SLKD
Sbjct  1    MSSSVVQFASQENNSNSSNHQHEDGNERLDSDHHN--HPTAHNISLPSETFLQAAISLKD  58

Query  211  QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            QVVDMTWK  G SA    DPTVYTGLLGTA+TCLRS++ATG+R+DL LC++IVD CA  A
Sbjct  59   QVVDMTWKGNGRSAGGVTDPTVYTGLLGTAFTCLRSYEATGDRKDLELCSEIVDACAELA  118

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
                RH+TFLCGRGG+YALGAVAANYCGDQ KR  YL++FFEVAQE+ALPVGPE+GGFGM
Sbjct  119  RTVTRHVTFLCGRGGVYALGAVAANYCGDQHKRVLYLNHFFEVAQERALPVGPEDGGFGM  178

Query  571  SYDLLYGRAGFLWAALFIKQHLGSE  645
            SYDLLYGRAGFLWAALFI+++LG+E
Sbjct  179  SYDLLYGRAGFLWAALFIRKYLGAE  203



>emb|CDP01505.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 161/199 (81%), Gaps = 1/199 (1%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            MSSSIV  AS E+N T+ ++          D TAP+  LPAET LQAA+SLKD+VV +TW
Sbjct  1    MSSSIVKYASQETNSTHEDNKERIDLPHGSDLTAPNLSLPAETLLQAAISLKDKVVQVTW  60

Query  232  KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  411
            + +      + DPTVYTGLLGTA+TCLR+++ATG+ QDL LC +IVDTCAS A ++ RH+
Sbjct  61   RGQWND-YGNTDPTVYTGLLGTAFTCLRAYEATGSLQDLSLCTEIVDTCASIARSSTRHL  119

Query  412  TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  591
            TFLCGRGG+YALGAVAANYCGDQQKRD Y+D FFEVAQE+ALPVGPEEGGFGMSYDLLYG
Sbjct  120  TFLCGRGGVYALGAVAANYCGDQQKRDLYMDRFFEVAQERALPVGPEEGGFGMSYDLLYG  179

Query  592  RAGFLWAALFIKQHLGSEA  648
            RAGFLW ALFI +HLG+EA
Sbjct  180  RAGFLWTALFINKHLGAEA  198



>ref|XP_006353211.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=424

 Score =   273 bits (699),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 163/203 (80%), Gaps = 9/203 (4%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLD----PTAPSFILPAETFLQAAVSLKDQVV  219
            MSSS+V L + + N  N +DGN+   R   D    PTA +    +ETFLQAA+SLKDQVV
Sbjct  1    MSSSVVQLTASQKN--NSDDGNE---RVDSDQHHHPTAHNVSHTSETFLQAAISLKDQVV  55

Query  220  DMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPAT  399
            +MTWK  G SA +  DPT+YTGLLGTA+TCLRS++ATG+R+DL LC++IVD CA  A   
Sbjct  56   EMTWKENGRSAGSVTDPTMYTGLLGTAFTCLRSYEATGDRKDLELCSEIVDACADLARTV  115

Query  400  IRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYD  579
             RH+TFLCGRGG+YALGAVAANYCGDQ KRD YL++F EVAQE+ALPVGPE+GGFGMSYD
Sbjct  116  TRHVTFLCGRGGVYALGAVAANYCGDQHKRDLYLNHFLEVAQERALPVGPEDGGFGMSYD  175

Query  580  LLYGRAGFLWAALFIKQHLGSEA  648
            LLYGRAGFLWAALFI+++LG E+
Sbjct  176  LLYGRAGFLWAALFIRKYLGVES  198



>gb|AAF75794.1|AF272710_1 putative 7-transmembrane G-protein-coupled receptor [Solanum 
chacoense]
Length=424

 Score =   273 bits (697),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 162/203 (80%), Gaps = 9/203 (4%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLD----PTAPSFILPAETFLQAAVSLKDQVV  219
            M SS+V L + + N  N +DGN+   R   D    PTA S    +ETFLQAA+SLKDQVV
Sbjct  1    MYSSVVQLTASQKN--NSDDGNE---RVDTDQHHQPTAHSVSHTSETFLQAAISLKDQVV  55

Query  220  DMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPAT  399
            +MTWK  G SA +  DPT+YTGLLGTA+TCLRS++ATG+R+DL LC++IVD CA  A   
Sbjct  56   EMTWKENGRSAGSVTDPTMYTGLLGTAFTCLRSYEATGDRKDLELCSEIVDACADLARTV  115

Query  400  IRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYD  579
             RH+TFLCGRGG+YALGAVAANYCGDQ KRD YL++F EVAQE+ALPVGPE+GGFGMSYD
Sbjct  116  TRHVTFLCGRGGVYALGAVAANYCGDQHKRDLYLNHFLEVAQERALPVGPEDGGFGMSYD  175

Query  580  LLYGRAGFLWAALFIKQHLGSEA  648
            LLYGRAGFLWAALFI+++LG E+
Sbjct  176  LLYGRAGFLWAALFIRKYLGVES  198



>gb|EYU30985.1| hypothetical protein MIMGU_mgv1a006900mg [Erythranthe guttata]
Length=427

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/201 (67%), Positives = 160/201 (80%), Gaps = 7/201 (3%)
 Frame = +1

Query  52   MSSSI-VHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVD  222
            MSSS+ V  AS ESN   HED +      RT  DPTA +  LPA+ FL+AA+SLKDQVV+
Sbjct  1    MSSSLGVEYASEESN--RHEDVDQWLQLLRTSCDPTATNLSLPADAFLRAAISLKDQVVE  58

Query  223  MTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  402
            MTW+ RGG     +DPTVYTGL+GTA+TCLRS++ATG+ +DLRLCA+IVD CA+A   + 
Sbjct  59   MTWRRRGGKG--SLDPTVYTGLMGTAFTCLRSYEATGDHRDLRLCAEIVDACAAATHISN  116

Query  403  RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  582
            RH+TFLCGRGG+YALGA+ ANYCGDQ KRD YLD F E+A+EKALPVGPEEGGFGMSYDL
Sbjct  117  RHVTFLCGRGGVYALGAITANYCGDQTKRDFYLDRFLEMAREKALPVGPEEGGFGMSYDL  176

Query  583  LYGRAGFLWAALFIKQHLGSE  645
            LYGRAGFLWAA F+ +H G +
Sbjct  177  LYGRAGFLWAASFLNKHFGGQ  197



>ref|XP_009800854.1| PREDICTED: lanC-like protein GCL1 [Nicotiana sylvestris]
Length=432

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 160/205 (78%), Gaps = 7/205 (3%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTN---HEDGNDSGFRTVLD----PTAPSFILPAETFLQAAVSLKD  210
            MSSS+V  AS E++  +   H+   D   R   D    PTA +  LP+ETFLQAA+SLKD
Sbjct  1    MSSSVVQFASQENSSNSSSNHQHDQDGNERLDSDHHNHPTAHNVSLPSETFLQAAISLKD  60

Query  211  QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            QVV+MTWK  G SA    DPTVYTGLLGTA+TCLRS++ATG+ +DL LC++IVD CA  A
Sbjct  61   QVVEMTWKGNGRSAGGVTDPTVYTGLLGTAFTCLRSYEATGDPKDLELCSEIVDACAELA  120

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
                RH+TFLCGRGG+YALGAVAANYCGD  KRD YL++F EVAQE+ALPVGPE+GGFGM
Sbjct  121  RTVTRHVTFLCGRGGVYALGAVAANYCGDLYKRDLYLNHFLEVAQERALPVGPEDGGFGM  180

Query  571  SYDLLYGRAGFLWAALFIKQHLGSE  645
            SYDLLYGRAGFLWAALFI+++LG E
Sbjct  181  SYDLLYGRAGFLWAALFIRKYLGEE  205



>ref|XP_004250112.1| PREDICTED: lanC-like protein GCL1 [Solanum lycopersicum]
Length=424

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 160/200 (80%), Gaps = 3/200 (2%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDS-GFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMT  228
            MSSS+V   + + N  N +DGN+       L P   S    +ETFLQAA+SLKDQVV+MT
Sbjct  1    MSSSVVQFTASQQN--NSDDGNERLDSDQHLHPAVHSVPHTSETFLQAAISLKDQVVEMT  58

Query  229  WKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  408
            WK  G SA +  DPT+YTGLLGTA+TCLRS+++TG+R+DL LC++IVD+CA  A    RH
Sbjct  59   WKENGRSASSVTDPTMYTGLLGTAFTCLRSYESTGDRKDLELCSEIVDSCADLARTFTRH  118

Query  409  ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  588
            +TFLCGRGG+YALGAVAA+YCGDQ KRD YL++F EVAQE+ALPVGPE+GGFGMSYDLLY
Sbjct  119  VTFLCGRGGVYALGAVAASYCGDQHKRDLYLNHFLEVAQERALPVGPEDGGFGMSYDLLY  178

Query  589  GRAGFLWAALFIKQHLGSEA  648
            GRAGFLWAALFI+++LG E+
Sbjct  179  GRAGFLWAALFIRKYLGVES  198



>ref|XP_007207243.1| hypothetical protein PRUPE_ppa006265m1g, partial [Prunus persica]
 gb|EMJ08442.1| hypothetical protein PRUPE_ppa006265m1g, partial [Prunus persica]
Length=235

 Score =   254 bits (649),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 153/203 (75%), Gaps = 10/203 (5%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            MS  +   +SPE     HED N+     ++DPTAP++ LP+ETFL+AAVSLKDQVV  TW
Sbjct  1    MSFGVELTSSPE----GHEDANNERL-DLIDPTAPNWSLPSETFLRAAVSLKDQVVQATW  55

Query  232  KARGGSAV-----THMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPA  396
            +  G S         +DPTVYTGLLGTA+TCLRS++ATGNRQDL L  ++VD C +   A
Sbjct  56   EGGGDSGSGLRTGMVLDPTVYTGLLGTAFTCLRSYEATGNRQDLVLSTEVVDKCVTIERA  115

Query  397  TIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSY  576
            + RH+TFLCGRGG+YA+GAV AN  GD Q+RD YL+ F EVAQEKAL VGPEEGGFGMSY
Sbjct  116  STRHVTFLCGRGGVYAIGAVVANLIGDHQRRDLYLNLFLEVAQEKALSVGPEEGGFGMSY  175

Query  577  DLLYGRAGFLWAALFIKQHLGSE  645
            DLL+GRAGFLWAALFI ++LG E
Sbjct  176  DLLHGRAGFLWAALFINKYLGQE  198



>ref|XP_011100038.1| PREDICTED: lanC-like protein GCL1 [Sesamum indicum]
Length=427

 Score =   259 bits (663),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 157/203 (77%), Gaps = 8/203 (4%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTN---HEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQV  216
            MSS +V  A+ ESN TN   HEDG++     R   D T  S  LP + FL AAVSLKD+V
Sbjct  1    MSSWVVEYAAQESNKTNNSSHEDGDECFDLLRAGCDLTGSSLSLPVDAFLGAAVSLKDKV  60

Query  217  VDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPA  396
            V++TW  RG      +DPTVYTGL+GTA+TCLRS++ TGN +DL+LCA+IVD CA+AA  
Sbjct  61   VEVTWGRRGNKG--SLDPTVYTGLMGTAFTCLRSYEVTGNHRDLQLCAEIVDACAAAAH-  117

Query  397  TIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSY  576
            T RH+TFLCGRGG+YALGA+ ANYCGDQ+KRD ++D F E+AQE+ALP GPEEGGFGMSY
Sbjct  118  TNRHVTFLCGRGGVYALGAITANYCGDQKKRDFFVDRFLEMAQERALPAGPEEGGFGMSY  177

Query  577  DLLYGRAGFLWAALFIKQHLGSE  645
            DLLYGRAGFLWAAL + ++LG E
Sbjct  178  DLLYGRAGFLWAALLVNKYLGGE  200



>ref|XP_008235076.1| PREDICTED: lanC-like protein GCL1 [Prunus mume]
Length=425

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 154/203 (76%), Gaps = 10/203 (5%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            MS  +   +SPE     HED N+     ++DPTAP++ LP+ETFL+AAVSLKDQVV  TW
Sbjct  1    MSFGVELTSSPEG----HEDANNERL-DLIDPTAPNWSLPSETFLRAAVSLKDQVVQGTW  55

Query  232  KARGGSAV-----THMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPA  396
            +  G S         +DPTVYTGLLGTA+TCLRS++ATGNRQDL L +++VD C +   A
Sbjct  56   EGGGDSGSGPRTGMVLDPTVYTGLLGTAFTCLRSYEATGNRQDLVLSSEVVDKCVTVERA  115

Query  397  TIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSY  576
            + RH+TFLCGRGG+YA+GAV AN  GD Q+RD YL+ F EVAQEKAL VGPEEGGFGMSY
Sbjct  116  STRHVTFLCGRGGVYAIGAVVANLIGDHQRRDLYLNLFLEVAQEKALSVGPEEGGFGMSY  175

Query  577  DLLYGRAGFLWAALFIKQHLGSE  645
            DLL+GRAGFLWAALFI ++LG E
Sbjct  176  DLLHGRAGFLWAALFINKYLGQE  198



>ref|XP_007047870.1| GCR2-like 1 [Theobroma cacao]
 gb|EOX92027.1| GCR2-like 1 [Theobroma cacao]
Length=424

 Score =   254 bits (648),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 159/199 (80%), Gaps = 6/199 (3%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGNDSGFRTV-LDPT-APSFILPAETFLQAAVSLKDQVVDMTW  231
            SS+V LA+ + +   HE+GN+     + +DPT A +  L A+T L+AA++LKDQVV++TW
Sbjct  2    SSVVELAASKES---HEEGNNERLGMLNMDPTVANNLSLSADTLLKAAIALKDQVVEVTW  58

Query  232  KARGGS-AVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  408
            K  GGS A + MDPTV TGLLGTA+TCLRS++ TGN+QDL L A IVDTCAS A A+ RH
Sbjct  59   KEGGGSCAGSGMDPTVNTGLLGTAFTCLRSYEVTGNQQDLLLSAKIVDTCASVARASTRH  118

Query  409  ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  588
            +TFLCGRGG+Y+LGAV ANY GD Q+ + +L+ F EVAQE+ALPVGPEEGGFGMSYDLLY
Sbjct  119  VTFLCGRGGVYSLGAVVANYMGDPQRLNFFLNQFLEVAQERALPVGPEEGGFGMSYDLLY  178

Query  589  GRAGFLWAALFIKQHLGSE  645
            GRAGFLWAALF+ +HLG E
Sbjct  179  GRAGFLWAALFLNKHLGKE  197



>ref|XP_004288166.1| PREDICTED: lanC-like protein GCL1 [Fragaria vesca subsp. vesca]
Length=427

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/204 (64%), Positives = 150/204 (74%), Gaps = 11/204 (5%)
 Frame = +1

Query  52   MSSSIVHLAS-----PESNGTNHEDGNDSGFRTVL-DPTAPSFILPAETFLQAAVSLKDQ  213
            MSS + +LAS     PE     H+DGN+     V    T P   LP ETFL AAVSLKDQ
Sbjct  1    MSSVVGYLASSSSSSPEG----HDDGNNERLDFVRPTTTTPDLSLPGETFLHAAVSLKDQ  56

Query  214  VVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAP  393
            VV  TW+    S +  +DP VYTGL+GTA+TCLRS++ATGNRQDL LCA+I D CA+ A 
Sbjct  57   VVKATWEGEWSSGMG-LDPNVYTGLMGTAFTCLRSYEATGNRQDLLLCAEIADKCAAVAR  115

Query  394  ATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMS  573
             + RH+TFLCGRGG+YALGAV AN  GDQQ+RD YL+ F EVAQEKAL VGPEEGGFGMS
Sbjct  116  VSARHVTFLCGRGGVYALGAVVANLVGDQQRRDLYLNLFLEVAQEKALSVGPEEGGFGMS  175

Query  574  YDLLYGRAGFLWAALFIKQHLGSE  645
            YDLLYGRAGFLWAALFI +H G +
Sbjct  176  YDLLYGRAGFLWAALFINKHFGED  199



>ref|XP_011031065.1| PREDICTED: lanC-like protein GCL1 [Populus euphratica]
Length=421

 Score =   251 bits (640),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 143/166 (86%), Gaps = 1/166 (1%)
 Frame = +1

Query  142  DPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSF  321
            DPT+   +LP ET L+AA+SLK+QVV+MTW+ R G   T +DPTVYTGLLGTA+TCLRS+
Sbjct  28   DPTSTDMLLPHETLLRAAISLKNQVVEMTWE-RDGKTGTGIDPTVYTGLLGTAFTCLRSY  86

Query  322  QATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYL  501
            + TGN QDL LC++IVDTC+ +A  + RHITFLCGRGGLYALGAVAA+Y GD+++RD ++
Sbjct  87   EVTGNEQDLLLCSEIVDTCSVSARTSSRHITFLCGRGGLYALGAVAASYKGDRRRRDFFV  146

Query  502  DYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            + F EVAQE+ALPVGPEEGGFGMSY+L+YGRAGFLWAALFI +HLG
Sbjct  147  NLFLEVAQERALPVGPEEGGFGMSYELMYGRAGFLWAALFINKHLG  192



>ref|XP_002268951.3| PREDICTED: lanC-like protein GCL1 [Vitis vinifera]
Length=421

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 151/198 (76%), Gaps = 7/198 (4%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            SS V L S ES    H++ N+    F+   DPTA +  LP ETFL+AA+SLKDQVV+ TW
Sbjct  2    SSAVKLPSQES----HDESNEWLDSFQKP-DPTAANLSLPTETFLKAAMSLKDQVVEATW  56

Query  232  KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  411
            K  G      +DPTV+TGLLGTA+ CLRS+++TG +QDL LCA+IVD+CA  +    RH+
Sbjct  57   KRGGEGWRKGIDPTVHTGLLGTAFACLRSYESTGRQQDLLLCAEIVDSCAMTSREFTRHV  116

Query  412  TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  591
            TFLCG GG+YALGAV AN+ GD Q+RD YLD F EVAQE+ALPVGPEEGGFGMSYDLLYG
Sbjct  117  TFLCGSGGVYALGAVVANHIGDYQRRDMYLDLFLEVAQERALPVGPEEGGFGMSYDLLYG  176

Query  592  RAGFLWAALFIKQHLGSE  645
            RAGFLWAALFI +HLG +
Sbjct  177  RAGFLWAALFINKHLGEQ  194



>ref|XP_002262692.1| PREDICTED: lanC-like protein GCL1 isoform X2 [Vitis vinifera]
Length=421

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 151/198 (76%), Gaps = 7/198 (4%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            SS V L S ES    H++ N+    F+   DPTA +  LP ETFL+AA+SLKDQVV+ TW
Sbjct  2    SSAVKLPSQES----HDESNEWLDSFQKP-DPTAANLSLPTETFLKAAMSLKDQVVEATW  56

Query  232  KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  411
            K  G      +DPTV+TGLLGTA+ CLRS+++TG +QDL LCA+IVD+CA  +    RH+
Sbjct  57   KRGGEGWRKGIDPTVHTGLLGTAFACLRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHV  116

Query  412  TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  591
            TFLCG GG+YALGAV AN+ GD Q+RD YLD F EVAQE+ALPVGPEEGGFGMSYDLLYG
Sbjct  117  TFLCGSGGVYALGAVVANHIGDYQRRDMYLDLFLEVAQERALPVGPEEGGFGMSYDLLYG  176

Query  592  RAGFLWAALFIKQHLGSE  645
            RAGFLWAALFI +HLG +
Sbjct  177  RAGFLWAALFINKHLGEQ  194



>ref|XP_002306296.2| hypothetical protein POPTR_0005s07360g [Populus trichocarpa]
 gb|EEE93292.2| hypothetical protein POPTR_0005s07360g [Populus trichocarpa]
Length=421

 Score =   249 bits (635),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = +1

Query  139  LDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRS  318
            +DPT+   +LP ET L+AA+SLK+QVV++TW+ R G   T +DPTVYTGLLGTA+TCLRS
Sbjct  27   IDPTSTDMLLPHETLLRAAISLKNQVVEVTWE-RDGKTGTGIDPTVYTGLLGTAFTCLRS  85

Query  319  FQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSY  498
            ++ TGN QDL LC++IVDTC+ +A  + RHITFLCGRGGLYALGAVAA+Y GD+++RD +
Sbjct  86   YEVTGNEQDLLLCSEIVDTCSVSARTSSRHITFLCGRGGLYALGAVAASYKGDRRRRDFF  145

Query  499  LDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            ++ F EVAQE+ALPVGPEEGGFGMSY+L+YGRAGFLWAALFI +HLG
Sbjct  146  VNLFLEVAQERALPVGPEEGGFGMSYELMYGRAGFLWAALFINKHLG  192



>ref|XP_010267103.1| PREDICTED: lanC-like protein GCL1 [Nelumbo nucifera]
Length=421

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 152/197 (77%), Gaps = 5/197 (3%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRT-VLDPTAPSFILPAETFLQAAVSLKDQVVDMT  228
            MSSS+V +AS   +    E+GN+   +  + D    +  L  ETFLQAA+SLKD+V++ T
Sbjct  1    MSSSMVEMASQGGD----EEGNERLDKLHMTDLATTTLYLTRETFLQAAISLKDRVIEAT  56

Query  229  WKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  408
            WK RGG  +  MDPTVYTGLLGTA+TCLRS+QATG + DL+LCA+IVDTCA+ A ++ RH
Sbjct  57   WKERGGLQLQSMDPTVYTGLLGTAFTCLRSYQATGCQSDLQLCAEIVDTCAAVARSSKRH  116

Query  409  ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  588
            +TFLCG GG+YALGAV ANY  D Q+RD YLD F EVAQ++ALP GPEEGGFGM Y+L Y
Sbjct  117  LTFLCGSGGVYALGAVVANYKDDCQRRDLYLDLFLEVAQDRALPSGPEEGGFGMPYELHY  176

Query  589  GRAGFLWAALFIKQHLG  639
            GRAGFLWAALFI +HLG
Sbjct  177  GRAGFLWAALFINRHLG  193



>ref|XP_002309963.2| hypothetical protein POPTR_0007s05070g [Populus trichocarpa]
 gb|EEE90413.2| hypothetical protein POPTR_0007s05070g [Populus trichocarpa]
Length=423

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 151/198 (76%), Gaps = 9/198 (5%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGNDSGFRTV--LDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            SS V   S E    NHE+ ++     +  LDPTA   ++P E  L+AA+SLKDQVV+ TW
Sbjct  2    SSAVEATSQE----NHEESSNERLDLIHHLDPTATDMLIPNEVLLKAAISLKDQVVEATW  57

Query  232  KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH-  408
            K R  +    +DPTVYTGLLGTA+TCLRSF+ TGN QDL LC++IVDTC+ +A A+ R  
Sbjct  58   K-RDSNMGAGIDPTVYTGLLGTAFTCLRSFEVTGNEQDLLLCSNIVDTCSVSAHASSRQM  116

Query  409  -ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLL  585
             +TFLCG+GGLYALGAVAANY GD Q RD +L+ F EVAQE+ALPVGPEEGGFGMSY+L+
Sbjct  117  TLTFLCGKGGLYALGAVAANYKGDHQGRDFFLNLFLEVAQERALPVGPEEGGFGMSYELM  176

Query  586  YGRAGFLWAALFIKQHLG  639
            YGRAGFLWAALFI +HLG
Sbjct  177  YGRAGFLWAALFINKHLG  194



>emb|CAN83415.1| hypothetical protein VITISV_029722 [Vitis vinifera]
Length=421

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 150/198 (76%), Gaps = 7/198 (4%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            SS V L S ES    H++ N+    F+   DPTA +  LP ETFL+AA+SLKDQVV+ TW
Sbjct  2    SSAVKLPSQES----HDESNEWLDSFQKP-DPTAANLSLPTETFLKAAMSLKDQVVEATW  56

Query  232  KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  411
            K  G      +DPTV+TGLLGTA+ CLRS+++TG +QDL LCA+IVD+CA  +    RH+
Sbjct  57   KRGGEGWRKGIDPTVHTGLLGTAFACLRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHV  116

Query  412  TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  591
            TFLCG GG+YALGAV AN+  D Q+RD YLD F EVAQE+ALPVGPEEGGFGMSYDLLYG
Sbjct  117  TFLCGSGGVYALGAVVANHIXDYQRRDMYLDLFLEVAQERALPVGPEEGGFGMSYDLLYG  176

Query  592  RAGFLWAALFIKQHLGSE  645
            RAGFLWAALFI +HLG +
Sbjct  177  RAGFLWAALFINKHLGEQ  194



>ref|XP_004502406.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=412

 Score =   247 bits (630),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 146/181 (81%), Gaps = 5/181 (3%)
 Frame = +1

Query  103  HEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYT  282
            H++G       +++PTA +  +P+ETFL+AA+SLKD+VV+++W  R       +DPTVYT
Sbjct  10   HDEGKHESSDLIINPTAVNLSVPSETFLKAAISLKDEVVEVSWNRR-----EVVDPTVYT  64

Query  283  GLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAA  462
            GLLGTA+TCLRS++ TG  +DL LC++IVDTCA+ A A++RH+TFLCGRGG+YALGAV A
Sbjct  65   GLLGTAFTCLRSYEVTGCHKDLLLCSEIVDTCATLARASLRHVTFLCGRGGVYALGAVVA  124

Query  463  NYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
            NY GD  KRD +L  F EVA+E+ALP+GPEEGGFGMSYDLLYGRAGFLWAALF+ +HLG 
Sbjct  125  NYMGDLNKRDLFLGLFVEVAKERALPIGPEEGGFGMSYDLLYGRAGFLWAALFVNKHLGE  184

Query  643  E  645
            +
Sbjct  185  D  185



>ref|XP_010652678.1| PREDICTED: lanC-like protein GCL1 isoform X1 [Vitis vinifera]
Length=421

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 150/198 (76%), Gaps = 7/198 (4%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            SS V L S ES    H++ N+    F+   DPTA +  LP ETFL+AA+SLKDQVV+ TW
Sbjct  2    SSAVKLPSQES----HDESNEWLDSFQKP-DPTAANLSLPTETFLKAAMSLKDQVVEATW  56

Query  232  KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  411
            K  G      +DPTV+TGLLGTA+ CLRS+++TG +QDL LCA+IVD+CA  +    RH+
Sbjct  57   KRGGEGWRKGIDPTVHTGLLGTAFACLRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHV  116

Query  412  TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  591
            TFLCG GG+YALGAV AN+  D Q+RD YLD F EVAQE+ALPVGPEEGGFGMSYDLLYG
Sbjct  117  TFLCGSGGVYALGAVVANHIRDYQRRDMYLDLFLEVAQERALPVGPEEGGFGMSYDLLYG  176

Query  592  RAGFLWAALFIKQHLGSE  645
            RAGFLWAALFI +HLG +
Sbjct  177  RAGFLWAALFINKHLGEQ  194



>ref|XP_008387575.1| PREDICTED: lanC-like protein GCL1 [Malus domestica]
Length=423

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 148/201 (74%), Gaps = 8/201 (4%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            MS  +    SPE     H+D N+     V DP AP+    + TFL+AAV+LKDQVV  TW
Sbjct  1    MSFGVEFAPSPEE----HDDANNERLDLV-DPAAPNLSPSSGTFLRAAVTLKDQVVQATW  55

Query  232  KARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  402
            + R  S       +DPTVYTGLLGTA+TCLRS++A GNRQDL LCA+IVD C + A A+ 
Sbjct  56   EGRQDSGTPTGMVLDPTVYTGLLGTAFTCLRSYEAAGNRQDLVLCAEIVDKCRAVASAST  115

Query  403  RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  582
            RH+TFLCGRGG+YALGAV AN  GD ++R+ YL+ F EVAQEKAL VGPEEGGFGMSYDL
Sbjct  116  RHVTFLCGRGGVYALGAVVANLIGDHERRNLYLNLFLEVAQEKALSVGPEEGGFGMSYDL  175

Query  583  LYGRAGFLWAALFIKQHLGSE  645
            LYGRAGFLWAALFI ++LG E
Sbjct  176  LYGRAGFLWAALFINKYLGQE  196



>ref|XP_009339587.1| PREDICTED: lanC-like protein GCL1 [Pyrus x bretschneideri]
Length=423

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 148/201 (74%), Gaps = 8/201 (4%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            MS  +     PE    +HED N      V DPTAP+  LP+ TFL AAV+LKDQVV  TW
Sbjct  1    MSFGVEFALPPE----DHEDANKERVDLV-DPTAPNLSLPSGTFLIAAVALKDQVVQATW  55

Query  232  KARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  402
            +   GS       +DPTVYTGLLGTA+TCLRS++ATGNRQDL LCADIV  C + APA+ 
Sbjct  56   EGGHGSGTPTGMVLDPTVYTGLLGTAFTCLRSYEATGNRQDLLLCADIVHKCGAVAPASS  115

Query  403  RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  582
            RH+TFLCGRGG+YALGAV A+  GD ++   YL+ F E+AQEKAL VGPEEGGFGMSYDL
Sbjct  116  RHVTFLCGRGGVYALGAVVASLIGDHERCGLYLNLFLEMAQEKALSVGPEEGGFGMSYDL  175

Query  583  LYGRAGFLWAALFIKQHLGSE  645
            LYGRAGFLWAALFI ++LG +
Sbjct  176  LYGRAGFLWAALFINKYLGHD  196



>ref|XP_009365826.1| PREDICTED: lanC-like protein GCL1 [Pyrus x bretschneideri]
Length=423

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/201 (63%), Positives = 148/201 (74%), Gaps = 8/201 (4%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            MS  +     PE    +HED N      V DPTAP+  LP+ TFL AAV+LKDQVV  TW
Sbjct  1    MSFGVEFALPPE----DHEDANKERVDLV-DPTAPNLSLPSGTFLIAAVALKDQVVQATW  55

Query  232  KARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  402
            +   GS       +DPTVYTGLLGTA+TCLRS++ATGNRQDL LCADIV  C + APA+ 
Sbjct  56   EGGHGSGTPTGMVLDPTVYTGLLGTAFTCLRSYEATGNRQDLLLCADIVHKCGAVAPASS  115

Query  403  RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  582
            RH+TFLCGRGG+YALGAV A+  GD ++   YL+ F E+AQEKAL VGPEEGGFGMSYDL
Sbjct  116  RHVTFLCGRGGVYALGAVVASLIGDHERCGLYLNLFLEMAQEKALSVGPEEGGFGMSYDL  175

Query  583  LYGRAGFLWAALFIKQHLGSE  645
            LYGRAGFLWAALFI ++LG +
Sbjct  176  LYGRAGFLWAALFINKYLGHD  196



>gb|KHG19988.1| LanC-like protein 2 [Gossypium arboreum]
Length=432

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 157/207 (76%), Gaps = 13/207 (6%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRT--VLDPT-APSFILPAETFLQAAVSLKDQVVD  222
            MSS +   ASPES    H++G +       V+DPT + S  L A+TFL+AA++LK+QVV+
Sbjct  1    MSSVMELTASPES----HDEGKNELLDNFLVMDPTLSNSLSLSADTFLKAAMTLKNQVVE  56

Query  223  MTWKARGGSAVTH------MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCAS  384
            +TWK RG            +DPTVYTGLLGTA+TCLRS++ATGNRQDL L A+IVDTC S
Sbjct  57   VTWKGRGSGGGGGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLVLSAEIVDTCLS  116

Query  385  AAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGF  564
             A A+ RH+TFLCGRGG+Y+LGAV ANY GD Q+ + +L+ F EVAQEKALPVGPEEGGF
Sbjct  117  VARASPRHVTFLCGRGGVYSLGAVVANYMGDHQRLEFFLNLFIEVAQEKALPVGPEEGGF  176

Query  565  GMSYDLLYGRAGFLWAALFIKQHLGSE  645
            GMSYDLLYGRAGFLWAALF+ +HL  E
Sbjct  177  GMSYDLLYGRAGFLWAALFLNKHLQGE  203



>gb|ADU04157.1| hypothetical protein [Gossypium hirsutum]
Length=429

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 154/204 (75%), Gaps = 10/204 (5%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVL--DPT-APSFILPAETFLQAAVSLKDQVVD  222
            MSS +   AS ES    HE+G +      L  DPT + +  L A+TFL+AA++LK+QVV 
Sbjct  1    MSSVMELTASQES----HEEGKNERLDNFLNMDPTLSNTLSLSADTFLKAAMALKNQVVQ  56

Query  223  MTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAP  393
            +TWK RG         +DPTVYTGLLGTA+TCLRS++ATGNRQDL L A+IVDTC S A 
Sbjct  57   VTWKGRGSGGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLLLSAEIVDTCLSVAR  116

Query  394  ATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMS  573
            A+ RH+TFLCGRGG+Y+LGAV ANY GD Q+ + +L+ F EVAQEKALPVGPEEGGFGMS
Sbjct  117  ASPRHVTFLCGRGGVYSLGAVVANYMGDHQRLEFFLNLFIEVAQEKALPVGPEEGGFGMS  176

Query  574  YDLLYGRAGFLWAALFIKQHLGSE  645
            YDLLYGRAGFLWAALF+ +HL  E
Sbjct  177  YDLLYGRAGFLWAALFLNKHLQGE  200



>gb|KJB48857.1| hypothetical protein B456_008G090400 [Gossypium raimondii]
Length=429

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 154/204 (75%), Gaps = 10/204 (5%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVL--DPT-APSFILPAETFLQAAVSLKDQVVD  222
            MSS +   AS ES    HE+G +      L  DPT + +  L A+TFL+AA++LK+QVV+
Sbjct  1    MSSVMELTASQES----HEEGKNERLDNFLNMDPTLSNTLSLSADTFLKAAMALKNQVVE  56

Query  223  MTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAP  393
            +TWK RG         +DPTVYTGLLGTA+TCLRS++ATGNRQDL L A+IVDTC S A 
Sbjct  57   VTWKGRGSGGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLLLSAEIVDTCLSVAR  116

Query  394  ATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMS  573
            A+ RH+TFLCGRGG+Y+LGAV ANY GD Q  + +L+ F EVAQEKALPVGPEEGGFGMS
Sbjct  117  ASPRHVTFLCGRGGVYSLGAVVANYMGDHQSLEFFLNLFIEVAQEKALPVGPEEGGFGMS  176

Query  574  YDLLYGRAGFLWAALFIKQHLGSE  645
            YDLLYGRAGFLWAALF+ +HL  E
Sbjct  177  YDLLYGRAGFLWAALFLNKHLQGE  200



>ref|XP_003601927.1| G protein-coupled receptor-like protein [Medicago truncatula]
 gb|AES72178.1| G protein coupled receptor [Medicago truncatula]
Length=318

 Score =   238 bits (608),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 5/169 (3%)
 Frame = +1

Query  139  LDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRS  318
            ++PT  +  LP ETFL+AA+SLKD+VV++ W  R       +DPTVYTGLLGTA+TCLRS
Sbjct  25   MNPTVGNLSLPNETFLKAAISLKDEVVEVNWNRR-----EVIDPTVYTGLLGTAFTCLRS  79

Query  319  FQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSY  498
            ++ TG  +DL L ++I+DTCA+ A  ++RH+TFLCGRGGLYALGAV ANY GD QKRD +
Sbjct  80   YEVTGCHKDLVLSSEIIDTCATVARDSLRHVTFLCGRGGLYALGAVVANYMGDLQKRDLF  139

Query  499  LDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            L  F EVA E+ALPVGPEEGGFGMSYDLLYGRAGFLWAALF+ +HLG +
Sbjct  140  LGLFMEVANERALPVGPEEGGFGMSYDLLYGRAGFLWAALFLNKHLGED  188



>gb|ADU04150.1| hypothetical protein [Gossypium hirsutum]
Length=432

 Score =   241 bits (616),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 155/207 (75%), Gaps = 13/207 (6%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVL--DPT-APSFILPAETFLQAAVSLKDQVVD  222
            MSS +   AS ES    H++G +      L  DPT + S  L A+TFL+AA++LK+QVV+
Sbjct  1    MSSVMELTASQES----HDEGKNERLDNFLNMDPTLSNSLSLSADTFLKAAMTLKNQVVE  56

Query  223  MTWKARGGSAVTH------MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCAS  384
            +TWK RG            +DPTVYTGLLGTA+TCLRS++ATGNRQDL L A+IVDTC S
Sbjct  57   VTWKGRGSGGGGGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLVLSAEIVDTCLS  116

Query  385  AAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGF  564
             A A+ RH+TFLCGRGG+Y+LGAV ANY GD Q+ + +L+ F EVAQEKALPVGPEEGGF
Sbjct  117  VARASPRHVTFLCGRGGVYSLGAVVANYMGDHQRLEFFLNLFIEVAQEKALPVGPEEGGF  176

Query  565  GMSYDLLYGRAGFLWAALFIKQHLGSE  645
            GMSYDLLYGRAGFLWAALF+ +HL  E
Sbjct  177  GMSYDLLYGRAGFLWAALFLNKHLQGE  203



>ref|XP_006466262.1| PREDICTED: lanC-like protein GCL1-like [Citrus sinensis]
Length=431

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/204 (60%), Positives = 154/204 (75%), Gaps = 12/204 (6%)
 Frame = +1

Query  61   SIVHLASPESNGTNHEDGNDSGFR------TVLDPTAP-SFILPAETFLQAAVSLKDQVV  219
            S V  AS +S+   HED N+S         +++DPTA  +  LP ETFL+AAVSLKDQVV
Sbjct  2    SSVKFASQDSHA--HEDNNNSERHDLLHHDSIVDPTAAINMSLPCETFLKAAVSLKDQVV  59

Query  220  DMTWK---ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            ++TW+     GG     MDPT+YTGLLGTA+ CLRS++ TGN+Q+L L A+I+DTCAS  
Sbjct  60   EVTWRRLSGGGGEPGRGMDPTLYTGLLGTAFICLRSYELTGNQQELLLSAEIIDTCASVV  119

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
              + RH+TFLCGRGG+YA+GAV AN  GD+ +RD +L+ F E+AQE+ALP GPEEGGFGM
Sbjct  120  RDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFFLNLFLEIAQERALPAGPEEGGFGM  179

Query  571  SYDLLYGRAGFLWAALFIKQHLGS  642
            SYDLLYGRAGFLWAALF+ +HLG+
Sbjct  180  SYDLLYGRAGFLWAALFVNKHLGA  203



>ref|XP_011022825.1| PREDICTED: lanC-like protein GCL1 [Populus euphratica]
Length=423

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/198 (62%), Positives = 150/198 (76%), Gaps = 9/198 (5%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGNDSGFRTV--LDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            SS V  +S E    N E+ ++     +  LDPTA   ++P E  L+AA+SLKDQVV  TW
Sbjct  2    SSAVEASSQE----NREESSNERLDLIHHLDPTATDMLIPNEILLKAAISLKDQVVAATW  57

Query  232  KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  411
            K R  +    +DPTVYTGLLGTA+TCLRS++  GN QDL LC++IV+TC+ +A A+ R +
Sbjct  58   K-RDSNMGAGIDPTVYTGLLGTAFTCLRSYEVAGNEQDLLLCSNIVETCSVSALASSRQL  116

Query  412  T--FLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLL  585
            T  FLCGRGGLYALGAVAANY GDQQ RD +L+ F E+AQE+ALPVGPEEGGFGMSY+L+
Sbjct  117  TLTFLCGRGGLYALGAVAANYKGDQQGRDFFLNLFLELAQERALPVGPEEGGFGMSYELM  176

Query  586  YGRAGFLWAALFIKQHLG  639
            YGRAGFLWAALFI +HLG
Sbjct  177  YGRAGFLWAALFINKHLG  194



>gb|KDO60699.1| hypothetical protein CISIN_1g013959mg [Citrus sinensis]
Length=433

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 153/204 (75%), Gaps = 12/204 (6%)
 Frame = +1

Query  61   SIVHLASPESNGTNHEDGNDSGFR------TVLDPTAP-SFILPAETFLQAAVSLKDQVV  219
            S V  AS +S+   HED N+S         +++DPTA  +  LP ETFL+AAVSLKDQVV
Sbjct  2    SSVKFASQDSHA--HEDNNNSERHDLLHHDSIVDPTAAINMSLPCETFLKAAVSLKDQVV  59

Query  220  DMTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            ++TW+   G        MDPT+YTGLLGTA+ CLRS++ TGN+Q+L L A+I+DTCAS  
Sbjct  60   EVTWRRGSGGGGEPGRGMDPTLYTGLLGTAFICLRSYELTGNQQELLLSAEIIDTCASVV  119

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
              + RH+TFLCGRGG+YA+GAV AN  GD+ +RD +L+ F E+AQE+ALP GPEEGGFGM
Sbjct  120  RDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFFLNLFLEIAQERALPAGPEEGGFGM  179

Query  571  SYDLLYGRAGFLWAALFIKQHLGS  642
            SYDLLYGRAGFLWAALF+ +HLG+
Sbjct  180  SYDLLYGRAGFLWAALFVNKHLGA  203



>gb|KDO60700.1| hypothetical protein CISIN_1g013959mg [Citrus sinensis]
Length=431

 Score =   239 bits (611),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 153/204 (75%), Gaps = 12/204 (6%)
 Frame = +1

Query  61   SIVHLASPESNGTNHEDGNDSGFR------TVLDPTAP-SFILPAETFLQAAVSLKDQVV  219
            S V  AS +S+   HED N+S         +++DPTA  +  LP ETFL+AAVSLKDQVV
Sbjct  2    SSVKFASQDSHA--HEDNNNSERHDLLHHDSIVDPTAAINMSLPCETFLKAAVSLKDQVV  59

Query  220  DMTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            ++TW+   G        MDPT+YTGLLGTA+ CLRS++ TGN+Q+L L A+I+DTCAS  
Sbjct  60   EVTWRRGSGGGGEPGRGMDPTLYTGLLGTAFICLRSYELTGNQQELLLSAEIIDTCASVV  119

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
              + RH+TFLCGRGG+YA+GAV AN  GD+ +RD +L+ F E+AQE+ALP GPEEGGFGM
Sbjct  120  RDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFFLNLFLEIAQERALPAGPEEGGFGM  179

Query  571  SYDLLYGRAGFLWAALFIKQHLGS  642
            SYDLLYGRAGFLWAALF+ +HLG+
Sbjct  180  SYDLLYGRAGFLWAALFVNKHLGA  203



>gb|KHN44353.1| LanC-like protein 2 [Glycine soja]
Length=411

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 150/202 (74%), Gaps = 13/202 (6%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRT-VLDPTAPSFILPAET--FLQAAVSLKDQVVD  222
            M+SS+V     E     HE    S F T  ++  +P+  LP+ET  FL AA+SLKD+VV+
Sbjct  1    MTSSVVEGGRDEGK---HEP---SDFITETMNLPSPNLSLPSETETFLSAAISLKDKVVE  54

Query  223  MTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  402
             TW  R       +DPTVYTGLLGTA+TCLRS+Q TG R DL LC+DI+DTC +AA A++
Sbjct  55   ETWNRRD----QVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILCSDIIDTCVTAARASL  110

Query  403  RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  582
            RH+TFLCGRGG+YALGAV ANY  D  KRD +L  FFEVA+E+ALPVGPEEGGFGMSYDL
Sbjct  111  RHVTFLCGRGGVYALGAVVANYMEDLPKRDLFLGLFFEVAKERALPVGPEEGGFGMSYDL  170

Query  583  LYGRAGFLWAALFIKQHLGSEA  648
            LYGRAGFLW ALF+ +HLG +A
Sbjct  171  LYGRAGFLWGALFVNKHLGDDA  192



>ref|XP_003538606.1| PREDICTED: lanC-like protein 2-like isoform X1 [Glycine max]
Length=412

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 152/203 (75%), Gaps = 14/203 (7%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRT-VLDPTAPSF-ILPAET--FLQAAVSLKDQVV  219
            M+SS+V     E     HE    S F T  ++ T+P+  +LP+ET  FL AA+SLKD+VV
Sbjct  1    MTSSVVEGGRDEGK---HEP---SDFITETMNLTSPNLSLLPSETETFLSAAISLKDKVV  54

Query  220  DMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPAT  399
            + TW  R       +DPTVYTGLLGTA+TCLRS+Q TG R DL LC+DI+DTC +AA A+
Sbjct  55   EETWNRRD----QVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILCSDIIDTCVTAARAS  110

Query  400  IRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYD  579
            +RH+TFLCGRGG+YALGAV ANY  D  KRD +L  FFEVA+E+ALPVGPEEGGFGMSYD
Sbjct  111  LRHVTFLCGRGGVYALGAVVANYMEDLPKRDLFLGLFFEVAKERALPVGPEEGGFGMSYD  170

Query  580  LLYGRAGFLWAALFIKQHLGSEA  648
            LLYGRAGFLW ALF+ +HLG +A
Sbjct  171  LLYGRAGFLWGALFVNKHLGDDA  193



>ref|XP_003552029.2| PREDICTED: lanC-like protein GCL1-like [Glycine max]
Length=452

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 149/201 (74%), Gaps = 11/201 (5%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAET--FLQAAVSLKDQVVDM  225
            M+SS+V     E     HE  +       ++ TAP+  LP+ET  FL AA+SLKD+VV+ 
Sbjct  42   MTSSVVEGGRDEGK---HEPSDL--ITETMNLTAPNLSLPSETETFLSAAISLKDKVVEE  96

Query  226  TWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIR  405
            TW  R       +DPTVYTGLLGTA+TCLRS+Q TG R DL L ++I+DTC +AA A++R
Sbjct  97   TWNRRD----QVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILSSEIIDTCVTAARASLR  152

Query  406  HITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLL  585
            H+TFLCGRGG+YALGAV ANY GD QKRD +L  F EVA+E+ALPVGPEEGGFGMSYDLL
Sbjct  153  HVTFLCGRGGVYALGAVVANYMGDLQKRDLFLGLFIEVAKERALPVGPEEGGFGMSYDLL  212

Query  586  YGRAGFLWAALFIKQHLGSEA  648
            YGRAGFLW ALF+ +HLG +A
Sbjct  213  YGRAGFLWGALFVNKHLGEDA  233



>ref|XP_006426333.1| hypothetical protein CICLE_v10025657mg [Citrus clementina]
 gb|ESR39573.1| hypothetical protein CICLE_v10025657mg [Citrus clementina]
Length=431

 Score =   238 bits (608),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 155/205 (76%), Gaps = 14/205 (7%)
 Frame = +1

Query  61   SIVHLASPESNGTNHEDGNDSGFR-------TVLDPTAP-SFILPAETFLQAAVSLKDQV  216
            S V  AS +S+   HED N++G R       +++DPTA  +  LP ETFL+AAVSLKDQV
Sbjct  2    SSVKFASQDSHA--HED-NNNGERHDLLHHDSIVDPTAAINMSLPCETFLKAAVSLKDQV  58

Query  217  VDMTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASA  387
            V++TW+   G        MDPT+YTGLLGTA+ CLRS++ TGN+Q+L L A+I+DTCAS 
Sbjct  59   VEVTWRRGSGGGGEPGRGMDPTLYTGLLGTAFICLRSYELTGNQQELLLSAEIIDTCASV  118

Query  388  APATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFG  567
               + RH+TFLCGRGG+YA+GAV AN  GD+ +RD +L+ F E+AQE+ALP GPEEGGFG
Sbjct  119  VRDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFFLNLFLEIAQERALPAGPEEGGFG  178

Query  568  MSYDLLYGRAGFLWAALFIKQHLGS  642
            MSYDLLYGRAGFLWAALF+ +HLG+
Sbjct  179  MSYDLLYGRAGFLWAALFVNKHLGA  203



>ref|XP_003601926.1| G protein-coupled receptor-like protein [Medicago truncatula]
 gb|AES72177.1| G protein coupled receptor [Medicago truncatula]
Length=415

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 136/169 (80%), Gaps = 5/169 (3%)
 Frame = +1

Query  139  LDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRS  318
            ++PT  +  LP ETFL+AA+SLKD+VV++ W  R       +DPTVYTGLLGTA+TCLRS
Sbjct  25   MNPTVGNLSLPNETFLKAAISLKDEVVEVNWNRR-----EVIDPTVYTGLLGTAFTCLRS  79

Query  319  FQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSY  498
            ++ TG  +DL L ++I+DTCA+ A  ++RH+TFLCGRGGLYALGAV ANY GD QKRD +
Sbjct  80   YEVTGCHKDLVLSSEIIDTCATVARDSLRHVTFLCGRGGLYALGAVVANYMGDLQKRDLF  139

Query  499  LDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            L  F EVA E+ALPVGPEEGGFGMSYDLLYGRAGFLWAALF+ +HLG +
Sbjct  140  LGLFMEVANERALPVGPEEGGFGMSYDLLYGRAGFLWAALFLNKHLGED  188



>gb|KDP29724.1| hypothetical protein JCGZ_18659 [Jatropha curcas]
Length=422

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 155/204 (76%), Gaps = 13/204 (6%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGN----DSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDM  225
            SS +   S +S+  +HED N    D      + P+A +  LP ETFL+AA+SLK++VV+M
Sbjct  2    SSAIEYTSQDSH--SHEDNNNERLDLNLILQMKPSASNLWLPKETFLRAAISLKNKVVEM  59

Query  226  TWKARGGSAVTH----MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAP  393
            TW    GS  T     +D TVY+GLLGTA+TCLRS++ TGN+QDL  C++IVDTCA+AA 
Sbjct  60   TWN---GSCSTDRSAVVDSTVYSGLLGTAFTCLRSYEFTGNQQDLLSCSEIVDTCAAAAR  116

Query  394  ATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMS  573
            A+ RH+TFLCGRGG+YALGAV ANY GDQ  RDSYLD F EVA E+ALP+GPEEGGFGMS
Sbjct  117  ASSRHVTFLCGRGGIYALGAVVANYKGDQHGRDSYLDLFLEVAHERALPIGPEEGGFGMS  176

Query  574  YDLLYGRAGFLWAALFIKQHLGSE  645
            Y+L+YGRAGFLWAALFI ++LG +
Sbjct  177  YELMYGRAGFLWAALFINKYLGEQ  200



>ref|XP_010025417.1| PREDICTED: lanC-like protein GCL1 [Eucalyptus grandis]
Length=430

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 137/169 (81%), Gaps = 5/169 (3%)
 Frame = +1

Query  139  LDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRS  318
            +DP AP   LP ETFL+AA+SLKDQVV  TW+  GG+A    DPT YTGLLGTA+ CLRS
Sbjct  40   VDPGAPDLSLPRETFLRAALSLKDQVVQATWR-EGGAA----DPTAYTGLLGTAFLCLRS  94

Query  319  FQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSY  498
            + ATG+R DL L A+IVD CASAA A+ RH+TFLCG+GG++A+GAV AN  GD  KRD +
Sbjct  95   YAATGDRGDLLLSAEIVDACASAARASTRHVTFLCGKGGVFAVGAVVANLLGDHHKRDFF  154

Query  499  LDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            L+ F EVAQE+ALPVGPEEGGFGMSYDLLYGRAGFLWAALF+ ++LG E
Sbjct  155  LNLFLEVAQERALPVGPEEGGFGMSYDLLYGRAGFLWAALFLNKNLGEE  203



>ref|XP_008453808.1| PREDICTED: lanC-like protein GCL1 [Cucumis melo]
Length=419

 Score =   236 bits (601),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 147/196 (75%), Gaps = 5/196 (3%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKA  237
            SS++ LAS + +     +G   G    + P   + +LP++TFL AAVSLK+QVV++TWK 
Sbjct  2    SSLLELASSQED----REGGGGGGGIQIPPNCNTILLPSQTFLSAAVSLKNQVVELTWKK  57

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG + +  +DPTVY GLLGTA TCLRS++ TGN QDL LC+DIVD C  AA A+ RH+TF
Sbjct  58   RGNADIG-VDPTVYNGLLGTAVTCLRSYEVTGNHQDLVLCSDIVDKCTVAARASHRHLTF  116

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCGRGG+YALGAV ++Y  D QK D + + F + A+EKALP GPEEGGFGMSYDLLYGRA
Sbjct  117  LCGRGGVYALGAVVSHYMRDPQKLDFFFNLFLQAAEEKALPSGPEEGGFGMSYDLLYGRA  176

Query  598  GFLWAALFIKQHLGSE  645
            GFLWAALFI +HLG +
Sbjct  177  GFLWAALFINKHLGEQ  192



>ref|XP_004146876.1| PREDICTED: lanC-like protein 2-like [Cucumis sativus]
 ref|XP_004168242.1| PREDICTED: lanC-like protein 2-like [Cucumis sativus]
 gb|KGN53211.1| hypothetical protein Csa_4G026880 [Cucumis sativus]
Length=419

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 148/198 (75%), Gaps = 9/198 (5%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGNDSGFRTVLDPTAP--SFILPAETFLQAAVSLKDQVVDMTW  231
            SS++HLAS +      ED  + G    +    P  + +LP++TFL AAVS K+QVV++TW
Sbjct  2    SSLLHLASSQ------EDREEGGGGGGIIQIIPPNTILLPSQTFLSAAVSFKNQVVELTW  55

Query  232  KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  411
            K RG + +  +DPTVY GLLGTA TCLRS++ATGN QDL LC+DIVD C   A A+ RH+
Sbjct  56   KQRGNADIG-VDPTVYNGLLGTAVTCLRSYEATGNHQDLVLCSDIVDKCTVLARASHRHL  114

Query  412  TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  591
            TFLCGRGG+YALGAV ++Y  D QK D + + F + A+EKALP+GPEEGGFGMSYDLLYG
Sbjct  115  TFLCGRGGVYALGAVVSHYMRDPQKLDFFFNLFLKAAEEKALPIGPEEGGFGMSYDLLYG  174

Query  592  RAGFLWAALFIKQHLGSE  645
            RAGFLWAALFI +HLG +
Sbjct  175  RAGFLWAALFINKHLGEQ  192



>ref|XP_010519354.1| PREDICTED: lanC-like protein GCL1 [Tarenaya hassleriana]
Length=428

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = +1

Query  142  DPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSA-VTHMDPTVYTGLLGTAYTCLRS  318
            DPTA +   P ETFL+AA+ LKDQVV+ TWK  G  +    +DPT YTGLLGTA+TCLRS
Sbjct  38   DPTAQTISFPTETFLRAALLLKDQVVEATWKGGGSGSGAVVLDPTAYTGLLGTAFTCLRS  97

Query  319  FQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSY  498
            ++ T NRQDL  CA+IVDTCA+ A A+ RH+TFLCGRGG+YALGAV  N+ GD  KRD +
Sbjct  98   YEVTRNRQDLLTCAEIVDTCATVARASTRHVTFLCGRGGVYALGAVVYNHIGDHHKRDFF  157

Query  499  LDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            L  F E+A+E+ALP GPEEGGFGMSYDLLYGRAGFLWAALF+  HLG
Sbjct  158  LGLFLELAEERALPAGPEEGGFGMSYDLLYGRAGFLWAALFLNHHLG  204



>ref|XP_010463250.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=435

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 149/208 (72%), Gaps = 12/208 (6%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVL-----DPTAPSFILPAETFLQAAVSLKDQV  216
            MSSS V   + +    +  +G ++  +  L     +P+AP+  +P E+FL+AA  LK+QV
Sbjct  1    MSSSAVEFMAEQRRCNDDGNGGETVKKDELGHFLSEPSAPTISIPTESFLRAATLLKNQV  60

Query  217  VDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTC  378
            V+ TWK      A GGS    +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+D C
Sbjct  61   VEATWKGGVEALAPGGSGPV-LDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCAEIIDRC  119

Query  379  ASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEG  558
            A+ A AT RH+TFLCGRGG+YALGA+ ANY GDQ KRD YL  F E+A+E+ LP GPEEG
Sbjct  120  ANVARATTRHVTFLCGRGGVYALGAIVANYRGDQSKRDHYLGLFLELAEERELPAGPEEG  179

Query  559  GFGMSYDLLYGRAGFLWAALFIKQHLGS  642
            GFGMSYDLLYGRAGFLW ALF+ ++LG 
Sbjct  180  GFGMSYDLLYGRAGFLWGALFLNRYLGE  207



>ref|XP_006591491.1| PREDICTED: lanC-like protein 2-like isoform X2 [Glycine max]
 ref|XP_006591492.1| PREDICTED: lanC-like protein 2-like isoform X3 [Glycine max]
Length=413

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/204 (61%), Positives = 152/204 (75%), Gaps = 15/204 (7%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRT-VLDPTAPSF-ILPAET--FLQAAVSLKDQVV  219
            M+SS+V     E     HE    S F T  ++ T+P+  +LP+ET  FL AA+SLKD+VV
Sbjct  1    MTSSVVEGGRDEGK---HEP---SDFITETMNLTSPNLSLLPSETETFLSAAISLKDKVV  54

Query  220  DMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPAT  399
            + TW  R       +DPTVYTGLLGTA+TCLRS+Q TG R DL LC+DI+DTC +AA A+
Sbjct  55   EETWNRRD----QVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILCSDIIDTCVTAARAS  110

Query  400  I-RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSY  576
            + RH+TFLCGRGG+YALGAV ANY  D  KRD +L  FFEVA+E+ALPVGPEEGGFGMSY
Sbjct  111  LSRHVTFLCGRGGVYALGAVVANYMEDLPKRDLFLGLFFEVAKERALPVGPEEGGFGMSY  170

Query  577  DLLYGRAGFLWAALFIKQHLGSEA  648
            DLLYGRAGFLW ALF+ +HLG +A
Sbjct  171  DLLYGRAGFLWGALFVNKHLGDDA  194



>ref|XP_008358138.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL1 [Malus 
domestica]
Length=423

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 145/201 (72%), Gaps = 8/201 (4%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            MS  +     PE    +HED N      V DP A +  LP+ TFL+AAV+LKDQVV  TW
Sbjct  1    MSFGVEFALPPE----DHEDANKERLDLV-DPAAKNLSLPSGTFLRAAVALKDQVVQDTW  55

Query  232  KARGGSAV-THM--DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI  402
            +   GS   T M  DPTVYTGLLGTA+TCLRS++ATGNRQDL LCADIVD C +  PA+ 
Sbjct  56   EGGXGSGTPTXMVXDPTVYTGLLGTAFTCLRSYEATGNRQDLLLCADIVDKCGAVXPASS  115

Query  403  RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  582
            RH+TFLCGRGG+YALGAV A   GD ++   Y + F EVAQEKAL VGPEEGGFGMSYDL
Sbjct  116  RHVTFLCGRGGVYALGAVVACLMGDHERCGLYFNLFLEVAQEKALSVGPEEGGFGMSYDL  175

Query  583  LYGRAGFLWAALFIKQHLGSE  645
            LYGRAG LWAALFI ++LG +
Sbjct  176  LYGRAGXLWAALFINKYLGQD  196



>ref|XP_002531667.1| catalytic, putative [Ricinus communis]
 gb|EEF30711.1| catalytic, putative [Ricinus communis]
Length=432

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 148/184 (80%), Gaps = 4/184 (2%)
 Frame = +1

Query  100  NHEDGNDSGFRTV--LDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGS--AVTHMD  267
            +H+D N+     +  +DPT  +  LP ETFL AA+SLKDQVV+MTWK  G +   +T +D
Sbjct  22   SHDDTNNERLDLIRQIDPTVKTLSLPNETFLGAAISLKDQVVEMTWKVCGSTDTGITVVD  81

Query  268  PTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYAL  447
            PTVY+G LGTA+ CLRS++ TG+ QD+ LC+ IVD+CASAA A+ RH+TFLCGRGG+YAL
Sbjct  82   PTVYSGSLGTAFVCLRSYEVTGDDQDILLCSKIVDSCASAARASSRHVTFLCGRGGVYAL  141

Query  448  GAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIK  627
            GAV AN  GDQ++RD +L+ F EVAQE+ALPVGPEEGGFGMSY+L+YGRAGFLWAALFI 
Sbjct  142  GAVVANCQGDQRRRDFFLNLFLEVAQERALPVGPEEGGFGMSYELMYGRAGFLWAALFIN  201

Query  628  QHLG  639
            +HLG
Sbjct  202  KHLG  205



>ref|XP_010484384.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=434

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/208 (56%), Positives = 149/208 (72%), Gaps = 12/208 (6%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLD-----PTAPSFILPAETFLQAAVSLKDQV  216
            MSSS V   + +    +  +G ++  +  LD     P+AP+  +P E+FL+AA  LK+QV
Sbjct  1    MSSSAVEFVAEQRRCNDDGNGGETVKKDELDHLLSKPSAPTISIPTESFLRAATLLKNQV  60

Query  217  VDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTC  378
            V+ TWK      A  GS    +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+D C
Sbjct  61   VEATWKGGVEALAPAGSGPV-LDPTVYTGLLGTAFTCLKSYEVTMNHQDLLTCAEIIDRC  119

Query  379  ASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEG  558
            A+ A AT RH+TFLCGRGG+YALGA+ ANY G+Q KRD +L  F E+A+E+ALP GPEEG
Sbjct  120  ANVARATTRHVTFLCGRGGVYALGAIVANYRGNQSKRDYFLGLFLELAEERALPAGPEEG  179

Query  559  GFGMSYDLLYGRAGFLWAALFIKQHLGS  642
            GFGMSYDLLYGRAGFLW ALF+ ++LG 
Sbjct  180  GFGMSYDLLYGRAGFLWGALFLNRYLGE  207



>ref|XP_007163665.1| hypothetical protein PHAVU_001G253500g [Phaseolus vulgaris]
 gb|ESW35659.1| hypothetical protein PHAVU_001G253500g [Phaseolus vulgaris]
Length=409

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 143/200 (72%), Gaps = 11/200 (6%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGF-RTVLDPTAPSFILPAETFLQAAVSLKDQVVDMT  228
            M+SS+V        G+       S F    ++ TA +  L  ETF +AA SLKD+VV+ T
Sbjct  1    MTSSVVE------GGSEKPKRQPSDFIAETMNLTAENLSLTTETFFRAASSLKDKVVEET  54

Query  229  WKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  408
            W  R       +DPTVY+GLLGTA+TCLRS+Q TG R DL LC DIVDTC +AA A++RH
Sbjct  55   WNRRD----QVVDPTVYSGLLGTAFTCLRSYQVTGCRNDLLLCRDIVDTCVTAARASLRH  110

Query  409  ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  588
            +TFLCG GG+Y+LGAV ANY GD  KRD +L  F EVA+EKALPVGPEEGGFGMSYDLLY
Sbjct  111  VTFLCGSGGVYSLGAVVANYMGDLGKRDLFLALFIEVAKEKALPVGPEEGGFGMSYDLLY  170

Query  589  GRAGFLWAALFIKQHLGSEA  648
            GRAGFLW ALF+ +HLG E+
Sbjct  171  GRAGFLWGALFLNKHLGEES  190



>ref|XP_002866662.1| hypothetical protein ARALYDRAFT_358729 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42921.1| hypothetical protein ARALYDRAFT_358729 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/208 (57%), Positives = 147/208 (71%), Gaps = 14/208 (7%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDG------NDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQ  213
            MSSS V   + +   +N  DG      N      + +P+AP+  LP E+FL+AA  LK+Q
Sbjct  1    MSSSAVESVAEQRIRSNDGDGAGEKIENGELHHLLSEPSAPTIYLPTESFLRAATLLKNQ  60

Query  214  VVDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDT  375
            VV+  WK      A G S V  +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+DT
Sbjct  61   VVEAMWKGVVDVLAPGSSPV--LDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCAEIIDT  118

Query  376  CASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEE  555
            CA+ A AT RH+TFLCGRGG+Y LGA+ ANY GDQ KRD +L  F E+A+ + LP GPEE
Sbjct  119  CANVARATTRHVTFLCGRGGVYTLGAIVANYRGDQSKRDFFLGLFLELAEARELPAGPEE  178

Query  556  GGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            GGFGMSYDLLYGRAGFLWAALF+ ++LG
Sbjct  179  GGFGMSYDLLYGRAGFLWAALFLNRYLG  206



>ref|XP_006280490.1| hypothetical protein CARUB_v10026430mg [Capsella rubella]
 gb|EOA13388.1| hypothetical protein CARUB_v10026430mg [Capsella rubella]
Length=435

 Score =   231 bits (590),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 151/211 (72%), Gaps = 19/211 (9%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTV---------LDPTAPSFILPAETFLQAAVSL  204
            MSSS V   + +   ++  DG++ G  TV         ++P+APS  LP E+FL+AA  L
Sbjct  1    MSSSAVEFVAEQRRCSD--DGSNVG-ETVKTGELDHLHMEPSAPSISLPTESFLRAATLL  57

Query  205  KDQVVDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  366
            K+QVV+ TWK      + GGS    +DP+VYTGLLGTA+TCL+S+  T N QDL  CA+I
Sbjct  58   KNQVVEATWKGGVESLSPGGSGAV-LDPSVYTGLLGTAFTCLKSYGVTRNHQDLLTCAEI  116

Query  367  VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  546
            +DTC + A AT RH+TFLCGRGG+YALGA+ ANY GD  KRD +L  F E+A+E+ LP G
Sbjct  117  IDTCVNVARATTRHVTFLCGRGGVYALGAIVANYRGDLSKRDHFLGLFLELAEERELPAG  176

Query  547  PEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            PEEGGFGMSYDLLYGRAGFLWAALF+ ++LG
Sbjct  177  PEEGGFGMSYDLLYGRAGFLWAALFLNRYLG  207



>ref|XP_010444546.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=433

 Score =   229 bits (584),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 147/208 (71%), Gaps = 13/208 (6%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLD-----PTAPSFILPAETFLQAAVSLKDQV  216
            M SS V   + +    +  +G ++  +  LD     P+AP+  +P E+FL+AA  LK+QV
Sbjct  1    MLSSAVEFVAEQRRCNDDGNGGETVKKDELDHLLSEPSAPTISIPTESFLRAATLLKNQV  60

Query  217  VDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTC  378
            V+ TWK      A G   V  +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+D C
Sbjct  61   VEATWKGGVEALAPGSGLV--LDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCAEIIDRC  118

Query  379  ASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEG  558
            A+ A AT RH+TFLCGRGG+YALGA+ ANY G+Q KRD +L  F E+A+E+ LP GPEEG
Sbjct  119  ANVARATTRHVTFLCGRGGVYALGAIVANYRGNQSKRDHFLGLFLELAEERELPAGPEEG  178

Query  559  GFGMSYDLLYGRAGFLWAALFIKQHLGS  642
            GFGMSYDLLYGRAGFLW ALF+ ++LG 
Sbjct  179  GFGMSYDLLYGRAGFLWGALFLNRYLGE  206



>gb|AAK96841.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
 gb|AAM91135.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
Length=433

 Score =   228 bits (582),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 148/210 (70%), Gaps = 19/210 (9%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRT--------VLDPTAPSFILPAETFLQAAVSLK  207
            MSSS+  +      G   +DGN +G           + +P+AP+  LP E+FL+AA  LK
Sbjct  1    MSSSVDFV---REQGRCGDDGNGAGETVKNGEIDHLLSEPSAPTISLPTESFLRAATLLK  57

Query  208  DQVVDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  369
            +QVV+ TWK      A G   V  +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+
Sbjct  58   NQVVEATWKGGVEALASGSGPV--LDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCAEII  115

Query  370  DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  549
            DTCA+ A AT RH+TFLCGRGG+  LGA+ ANY GDQ KRD +L  F E+A+E+ LP GP
Sbjct  116  DTCANVARATTRHVTFLCGRGGVCTLGAIVANYRGDQSKRDFFLGLFLELAEERELPAGP  175

Query  550  EEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            EEGGFGMSYDLLYGRAGFLWAALF+ ++LG
Sbjct  176  EEGGFGMSYDLLYGRAGFLWAALFLNRYLG  205



>ref|NP_201331.1| protein GCR2-like 1 [Arabidopsis thaliana]
 sp|Q9FJN7.1|GCL1_ARATH RecName: Full=LanC-like protein GCL1; AltName: Full=G protein-coupled 
receptor 2-like protein 1; Short=Protein GCR2-like 
1 [Arabidopsis thaliana]
 dbj|BAB11664.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
 gb|AAL24184.1| AT5g65280/MQN23_23 [Arabidopsis thaliana]
 gb|AED98033.1| protein GCR2-like 1 [Arabidopsis thaliana]
Length=433

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 148/210 (70%), Gaps = 19/210 (9%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRT--------VLDPTAPSFILPAETFLQAAVSLK  207
            MSSS+  +      G   +DGN +G           + +P+AP+  LP E+FL+AA  LK
Sbjct  1    MSSSVDFVTE---QGRCGDDGNGAGETVKNGEIDHLLSEPSAPTISLPTESFLRAATLLK  57

Query  208  DQVVDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  369
            +QVV+ TWK      A G   V  +DPTVYTGLLGTA+TCL+S++ T N QDL  CA+I+
Sbjct  58   NQVVEATWKGGVEALASGSGPV--LDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCAEII  115

Query  370  DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  549
            DTCA+ A AT RH+TFLCGRGG+  LGA+ ANY GDQ KRD +L  F E+A+E+ LP GP
Sbjct  116  DTCANVARATTRHVTFLCGRGGVCTLGAIVANYRGDQSKRDFFLGLFLELAEERELPAGP  175

Query  550  EEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            EEGGFGMSYDLLYGRAGFLWAALF+ ++LG
Sbjct  176  EEGGFGMSYDLLYGRAGFLWAALFLNRYLG  205



>gb|KFK28210.1| hypothetical protein AALP_AA8G486800 [Arabis alpina]
Length=425

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 140/182 (77%), Gaps = 6/182 (3%)
 Frame = +1

Query  106  EDGNDSGFRTVL---DPTAPSFI-LPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPT  273
            +DGND    TV+   +P+AP+   L  ETFL+AA  LKDQVV+ TWKAR   +   +DPT
Sbjct  18   DDGNDG--ETVVNGTEPSAPTISSLTTETFLKAATLLKDQVVEATWKARVPDSGLVLDPT  75

Query  274  VYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGA  453
            VYTGLLGTA+TCL+S++ T N QDL  CA+I+DTCA+ A AT RH+TFLCGRGG+YALGA
Sbjct  76   VYTGLLGTAFTCLKSYEITKNHQDLLTCAEIIDTCANVARATTRHVTFLCGRGGVYALGA  135

Query  454  VAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQH  633
            + ANY  DQ K D +L  F E+A+E+ LP G EEGGFGMSYDLLYGRAGFLWAALF+ ++
Sbjct  136  IVANYTRDQPKLDFFLGLFLELAEERELPAGAEEGGFGMSYDLLYGRAGFLWAALFLNRY  195

Query  634  LG  639
            LG
Sbjct  196  LG  197



>emb|CBI33140.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/244 (52%), Positives = 151/244 (62%), Gaps = 53/244 (22%)
 Frame = +1

Query  58   SSIVHLASPESNGTNHEDGND--SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            SS V L S ES    H++ N+    F+   DPTA +  LP ETFL+AA+SLKDQVV+ TW
Sbjct  2    SSAVKLPSQES----HDESNEWLDSFQKP-DPTAANLSLPTETFLKAAMSLKDQVVEATW  56

Query  232  KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  411
            K  G      +DPTV+TGLLGTA+ CLRS+++TG +QDL LCA+IVD+CA  +    RH+
Sbjct  57   KRGGEGWRKGIDPTVHTGLLGTAFACLRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHV  116

Query  412  TFL----------------------------------------------CGRGGLYALGA  453
            TFL                                              CG GG+YALGA
Sbjct  117  TFLCGSGGVYALGAVVANHIRDYQRRDMYLDLFLEGCPYPFGITHVTFLCGSGGVYALGA  176

Query  454  VAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQH  633
            V AN+ GD Q+RD YLD F EVAQE+ALPVGPEEGGFGMSYDLLYGRAGFLWAALFI +H
Sbjct  177  VVANHIGDYQRRDMYLDLFLEVAQERALPVGPEEGGFGMSYDLLYGRAGFLWAALFINKH  236

Query  634  LGSE  645
            LG +
Sbjct  237  LGEQ  240



>emb|CDY08803.1| BnaA06g24210D [Brassica napus]
Length=430

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 140/187 (75%), Gaps = 4/187 (2%)
 Frame = +1

Query  88   SNGTNHEDGNDSGF--RTVLDPTAPSF-ILPAETFLQAAVSLKDQVVDMTWKARGGSAVT  258
            ++G  +++G+   F  RT  +P  P+   L  +TFL+AA  LKDQVV+ TWK  G     
Sbjct  20   NSGETNKNGDLDHFILRTSSEPKVPTTSFLSTDTFLRAATLLKDQVVEATWKG-GPDPGL  78

Query  259  HMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGL  438
             +DPTVYTGLLGTA+TCL+S++ T N QDL  CADI+DTCA  A AT RH+TFLCGRGG+
Sbjct  79   VLDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCADIIDTCADVARATTRHVTFLCGRGGV  138

Query  439  YALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAAL  618
            YALGA+ A+Y GDQ K D +L  F E+A+E+ LP GPEEGGFGMSYDLLYGRAGFLWAAL
Sbjct  139  YALGAIVASYSGDQSKLDLFLGLFLELAEERELPAGPEEGGFGMSYDLLYGRAGFLWAAL  198

Query  619  FIKQHLG  639
            F+ ++LG
Sbjct  199  FLNRYLG  205



>ref|XP_009150615.1| PREDICTED: lanC-like protein GCL1 [Brassica rapa]
Length=433

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/205 (56%), Positives = 144/205 (70%), Gaps = 4/205 (2%)
 Frame = +1

Query  34   ISKERKMSSSIVHLASPESNGTNHEDGNDSGF--RTVLDPTAPSF-ILPAETFLQAAVSL  204
            +S   + S+         + G  +++G+   F  RT  +P  P+   L  +TFL+AA  L
Sbjct  2    LSSALEFSAEQARCGEDGNGGETNKNGDLDHFILRTSSEPKVPTTSFLSTDTFLRAATLL  61

Query  205  KDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCAS  384
            KDQVV+ TWK  G      +DPTVYTGLLGTA+TCL+S++ T N QDL  CADI+DTCA 
Sbjct  62   KDQVVEATWKG-GPDPGLVLDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCADIIDTCAD  120

Query  385  AAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGF  564
             A AT RH+TFLCGRGG+YALGA+ A+Y GDQ K D +L  F E+A+E+ LP GPEEGGF
Sbjct  121  VARATTRHVTFLCGRGGVYALGAIVASYSGDQSKLDLFLGLFLELAEERELPAGPEEGGF  180

Query  565  GMSYDLLYGRAGFLWAALFIKQHLG  639
            GMSYDLLYGRAGFLWAALF+ ++LG
Sbjct  181  GMSYDLLYGRAGFLWAALFLNRYLG  205



>ref|XP_006394052.1| hypothetical protein EUTSA_v10004256mg [Eutrema salsugineum]
 gb|ESQ31338.1| hypothetical protein EUTSA_v10004256mg [Eutrema salsugineum]
Length=433

 Score =   223 bits (569),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 147/206 (71%), Gaps = 9/206 (4%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSG---------FRTVLDPTAPSFILPAETFLQAAVSL  204
            MSSS V     +    + ++G ++           RT  +PTAP+  L  ETFL+AA  L
Sbjct  1    MSSSAVEFVGEQRRCGDDDNGGETVENGALDHFLLRTSSEPTAPTISLSTETFLRAATLL  60

Query  205  KDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCAS  384
            KD+VV+ TWK         +DPTVYTGLLGTA+TCL+S++ T NRQDL  CA+I++TCA+
Sbjct  61   KDKVVEATWKGGVPGPSLVLDPTVYTGLLGTAFTCLKSYEVTRNRQDLLTCAEIIETCAN  120

Query  385  AAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGF  564
             A AT RH+TFLCGRGG+YALGA+ ANY GDQ KRD +L  F E+A+E+ LP GPEEGGF
Sbjct  121  VARATTRHVTFLCGRGGVYALGAIVANYRGDQSKRDLFLALFLELAEERELPAGPEEGGF  180

Query  565  GMSYDLLYGRAGFLWAALFIKQHLGS  642
            GMSYDLLYGRAGFLWAALF+ ++LG 
Sbjct  181  GMSYDLLYGRAGFLWAALFLNRYLGE  206



>ref|XP_010680997.1| PREDICTED: lanC-like protein GCL1 [Beta vulgaris subsp. vulgaris]
Length=433

 Score =   211 bits (537),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 118/206 (57%), Positives = 144/206 (70%), Gaps = 10/206 (5%)
 Frame = +1

Query  55   SSSIVHLASPESNG--TNHEDGND--SGFRTV---LDPTAPSFILP-AETFLQAAVSLKD  210
            SSSIV +     +G    HE+ N   + F  V      T  S ++P  +TFLQAAV+LK+
Sbjct  3    SSSIVGVGRTSDDGDRNQHEERNQRLNSFVAVDQTQTATNLSQLVPDHQTFLQAAVTLKN  62

Query  211  QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            QVV+MTWK +       +DPTVYTGL+GTA+TC  S+Q T   QDL +CADIV TCA+ A
Sbjct  63   QVVEMTWKEKDKERQA-IDPTVYTGLMGTAFTCFNSYQLTRCHQDLLMCADIVRTCAALA  121

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
              T R++TFL GRGG+YALGAV  N+  D Q    +LD F +VAQE+ALPVGPE+GGFGM
Sbjct  122  -HTSRYVTFLSGRGGIYALGAVIMNHMEDHQSCSHFLDMFMKVAQEEALPVGPEDGGFGM  180

Query  571  SYDLLYGRAGFLWAALFIKQHLGSEA  648
            SYDLL GRAGFLWAALFIK+HLG EA
Sbjct  181  SYDLLCGRAGFLWAALFIKRHLGEEA  206



>gb|KHN31391.1| LanC-like protein 2 [Glycine soja]
Length=419

 Score =   210 bits (535),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 137/199 (69%), Gaps = 23/199 (12%)
 Frame = +1

Query  106  EDGNDSG-------FRTVLDPTAPSFILPAET--FLQAAVSLKDQVVDMTWKARGGSAVT  258
            E G D G           ++ TAP+  LP+ET  FL AA+SLKD+VV+ TW  R      
Sbjct  7    EGGRDEGKHEPSDLITETMNLTAPNLSLPSETETFLSAAISLKDKVVEETWNRRD----Q  62

Query  259  HMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI---------RHI  411
             +DPTVYTGLLGTA+TCLRS+Q TG R DL L ++I+DTC +AA A++         +H+
Sbjct  63   VVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILSSEIIDTCVTAARASLSRKVSLKTKKHL  122

Query  412  TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  591
                 RG +YALGAV ANY GD QKRD +L  F EVA+E+ALPVGPEEGGFGMSYDLLYG
Sbjct  123  IHSSSRG-VYALGAVVANYMGDLQKRDLFLGLFIEVAKERALPVGPEEGGFGMSYDLLYG  181

Query  592  RAGFLWAALFIKQHLGSEA  648
            RAGFLW ALF+ +HLG +A
Sbjct  182  RAGFLWGALFVNKHLGEDA  200



>ref|XP_010937380.1| PREDICTED: lanC-like protein GCL1 [Elaeis guineensis]
Length=414

 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 126/160 (79%), Gaps = 3/160 (2%)
 Frame = +1

Query  163  ILPA-ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNR  339
            +LP+ E FL+AA+SLKDQV++ TWK  GG     +DPT Y GLLGTA TCLR+++ TG+ 
Sbjct  28   LLPSSEAFLKAAISLKDQVLEATWKGSGGGRC--IDPTAYVGLLGTAITCLRAYEVTGSP  85

Query  340  QDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEV  519
             DLRL A+IVDTC +AA +  R +TFLCGR G+Y LGAVAANY  D Q+R  +LD F EV
Sbjct  86   ADLRLAAEIVDTCTAAARSYRRRVTFLCGRAGVYVLGAVAANYGEDTQRRKLFLDLFLEV  145

Query  520  AQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            AQE+ALP+GPEEGG GM Y+LL+GRAGFL+AALFI +HLG
Sbjct  146  AQERALPIGPEEGGLGMPYELLHGRAGFLYAALFINKHLG  185



>gb|ABK24484.1| unknown [Picea sitchensis]
 gb|ACN40165.1| unknown [Picea sitchensis]
Length=427

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 129/190 (68%), Gaps = 3/190 (2%)
 Frame = +1

Query  76   ASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAV  255
            A  E+     E  + SG   + +P    +    + FL+ A++LKD+VV  TW  RG    
Sbjct  15   AEAETEKGQSERKDYSGTAILAEPFRELYFPAGDVFLKTALNLKDEVVQSTWTQRGFRC-  73

Query  256  THMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGG  435
               DPTVY GL GTA+ C RS Q TGN +DL LC++I+D+CA+ A +   H+TFLCG  G
Sbjct  74   --RDPTVYKGLSGTAFMCFRSHQITGNNEDLALCSEIIDSCAAVARSLRHHVTFLCGEAG  131

Query  436  LYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAA  615
            +YALGAV A Y GD Q++D +L+ F EVAQE+AL VGPE+GGFGM Y+L+YGRAGFLWAA
Sbjct  132  IYALGAVVAKYKGDNQRKDFFLNLFCEVAQERALSVGPEDGGFGMPYELMYGRAGFLWAA  191

Query  616  LFIKQHLGSE  645
            LF+ +HLG E
Sbjct  192  LFVNKHLGGE  201



>ref|XP_006829929.1| hypothetical protein AMTR_s00073p00158570 [Amborella trichopoda]
 gb|ERM97345.1| hypothetical protein AMTR_s00073p00158570 [Amborella trichopoda]
Length=248

 Score =   178 bits (452),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 113/152 (74%), Gaps = 5/152 (3%)
 Frame = +1

Query  187  QAAVSLKDQVVDMTW-KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCAD  363
            +AAV +K++VV+ TW K+ GG+     DPT+YTGLLGTA+TCL S +ATGN +DL++ +D
Sbjct  35   KAAVGMKEEVVENTWRKSEGGTE----DPTLYTGLLGTAFTCLLSHRATGNGEDLQIASD  90

Query  364  IVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPV  543
            IVDTC      T R + FLCGR G+Y LGA+ ANY  DQ +R+ +L+ F EV +E+ALP 
Sbjct  91   IVDTCTVVVRTTKRRVAFLCGRAGVYVLGAMVANYRDDQYRRELFLNLFCEVVEERALPA  150

Query  544  GPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            GP EG  GM Y+LL+G AGFLW+ALFI +HLG
Sbjct  151  GPGEGVLGMPYELLFGWAGFLWSALFINKHLG  182



>gb|KJB48858.1| hypothetical protein B456_008G090400 [Gossypium raimondii]
Length=391

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 118/169 (70%), Gaps = 10/169 (6%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVL--DPT-APSFILPAETFLQAAVSLKDQVVD  222
            MSS +   AS ES    HE+G +      L  DPT + +  L A+TFL+AA++LK+QVV+
Sbjct  1    MSSVMELTASQES----HEEGKNERLDNFLNMDPTLSNTLSLSADTFLKAAMALKNQVVE  56

Query  223  MTWKARGGSAVTH---MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAP  393
            +TWK RG         +DPTVYTGLLGTA+TCLRS++ATGNRQDL L A+IVDTC S A 
Sbjct  57   VTWKGRGSGGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLLLSAEIVDTCLSVAR  116

Query  394  ATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALP  540
            A+ RH+TFLCGRGG+Y+LGAV ANY GD Q  + +L+ F E  Q + +P
Sbjct  117  ASPRHVTFLCGRGGVYSLGAVVANYMGDHQSLEFFLNLFIEHLQGEVVP  165



>ref|XP_002966453.1| hypothetical protein SELMODRAFT_86123 [Selaginella moellendorffii]
 gb|EFJ32480.1| hypothetical protein SELMODRAFT_86123 [Selaginella moellendorffii]
Length=421

 Score =   165 bits (418),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 81/157 (52%), Positives = 112/157 (71%), Gaps = 14/157 (9%)
 Frame = +1

Query  175  ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  354
            E  L++A++LKD++V +TW  RGG+ V   DP  YTG+LGTAY CL+SF+ T  ++DL L
Sbjct  55   EKLLKSALALKDEIVQVTW-GRGGTRVK--DPIFYTGVLGTAYLCLKSFEVTQKKEDLAL  111

Query  355  CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  534
            C++I+D CA+AA +  +++TF+CG+ G+YALG VAA   GDQQ+ D YL+ F EV     
Sbjct  112  CSEIIDHCAAAAQSMKQYVTFICGQPGIYALGMVAAKSRGDQQRVDFYLNLFEEVY----  167

Query  535  LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                   GG GM Y+LLYGRAGFLWA+LF+  H+G+E
Sbjct  168  -------GGLGMPYELLYGRAGFLWASLFVNMHIGNE  197



>ref|XP_001776967.1| predicted protein [Physcomitrella patens]
 gb|EDQ58216.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 108/159 (68%), Gaps = 16/159 (10%)
 Frame = +1

Query  163  ILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQ  342
            ++  +T L+ A+S+KD+V+  TW  R G  V+  DP +YTG+LGTA+ C +++Q TG+++
Sbjct  26   VMDPDTLLEVAMSIKDEVIQATW-IRKGRRVS--DPILYTGVLGTAFLCFKAYQITGSKE  82

Query  343  DLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVA  522
            DL LC++IVD+C  AA +  +++TFLCG+ G+YALGA AA   GD+Q    YL  F    
Sbjct  83   DLTLCSEIVDSCTVAAKSLHKYVTFLCGQPGIYALGAAAAKSSGDEQSLHRYLQLF----  138

Query  523  QEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
                      +GG GM Y+LLYGRAGFLWAALF+ +H+G
Sbjct  139  ---------HKGGMGMPYELLYGRAGFLWAALFVNKHVG  168



>ref|XP_001758715.1| predicted protein [Physcomitrella patens]
 gb|EDQ76693.1| predicted protein [Physcomitrella patens]
Length=407

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 109/163 (67%), Gaps = 17/163 (10%)
 Frame = +1

Query  157  SFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGN  336
            SF  P+   L+AA++L+D+V++ TW  R G  V+  DPT+Y G+LGTA+ C +  Q TG+
Sbjct  37   SFSEPS-VVLKAAIALRDEVLEATW-IRHGPRVS--DPTMYVGMLGTAFLCFKVHQTTGS  92

Query  337  RQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFE  516
             +DL +C +IVD+CA AA +  +++TFLCG+ G+YALGA AA   GDQ++ D YL  F  
Sbjct  93   IEDLDICCNIVDSCAVAAESMKQYVTFLCGQSGIYALGAAAAKCKGDQKRLDWYLSLF--  150

Query  517  VAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                         GG GM Y+L+YGRAGFLWAALF+ +++G E
Sbjct  151  -----------NAGGLGMPYELMYGRAGFLWAALFVNKYVGEE  182



>ref|XP_010462143.1| PREDICTED: lanC-like protein GCR2 [Camelina sativa]
Length=412

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 99/159 (62%), Gaps = 14/159 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++   + A+SLKD VV  TW+ R G  V   D ++YTG+LGTA+   +S+Q T N  DL+
Sbjct  45   SKKLQRLALSLKDTVVSETWE-RSGKRVR--DYSLYTGVLGTAHLLFKSYQVTRNEDDLK  101

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC +IVD C  A+  + R +TF+CG  G+ ALGAVAA + GD Q RD YL  F E+    
Sbjct  102  LCLEIVDACYVASRDSERVVTFICGHVGVCALGAVAAKHLGDDQLRDRYLARFNEIRLPC  161

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEA  648
             LP           Y+LLYGRAG+LW+ LF+ +H+G E+
Sbjct  162  DLP-----------YELLYGRAGYLWSCLFLNKHIGQES  189



>emb|CDY53809.1| BnaA06g01740D [Brassica napus]
Length=386

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 104/183 (57%), Gaps = 19/183 (10%)
 Frame = +1

Query  112  GNDSGFRTVLDPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVY  279
            G +  F T  D       LP  +F +     A+SLKD +V  TW  R G  V   D  +Y
Sbjct  19   GEEETFSTHKDSLTKLLSLPYRSFSKKLQRYALSLKDTIVFETWD-RSGKRVR--DFNLY  75

Query  280  TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  459
            TG+LGTAY   +S+Q   N  DL+LC +IV+ C +A+  + R +TF+CGR G+ ALGAVA
Sbjct  76   TGVLGTAYLLFQSYQVARNENDLKLCLEIVEACYTASKDSDR-VTFICGRAGVCALGAVA  134

Query  460  ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            A   GD Q +D YL  F E+     LP           Y+LLYGRAG+LWA LF+ +H+G
Sbjct  135  AKLTGDSQLQDRYLARFHEIRLPGDLP-----------YELLYGRAGYLWACLFLNKHIG  183

Query  640  SEA  648
             ++
Sbjct  184  KDS  186



>gb|EYU26400.1| hypothetical protein MIMGU_mgv1a007259mg [Erythranthe guttata]
Length=413

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 103/157 (66%), Gaps = 14/157 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            +E   ++A+ LKD VV  TW  +G       D ++YTG LGTA+   +S+Q TG++ +L 
Sbjct  47   SERLKKSALDLKDTVVKETWVCKGKRVGG--DYSLYTGALGTAFLLFKSYQITGDKNNLS  104

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC+DI+  C SA+ ++ R +TF+CG+GG+YALGAVAA++ GD+Q R+ Y+  F E+   K
Sbjct  105  LCSDIIKACDSASQSSQR-VTFVCGQGGVYALGAVAAHHNGDEQLRNRYITRFKEIKLSK  163

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
             LP            +LLYGRAGFLWA+ F+ +++G+
Sbjct  164  DLPD-----------ELLYGRAGFLWASSFMNKNIGA  189



>ref|XP_010500915.1| PREDICTED: lanC-like protein GCR2 [Camelina sativa]
Length=411

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/191 (42%), Positives = 111/191 (58%), Gaps = 21/191 (11%)
 Frame = +1

Query  82   PESNGTNHED---GNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSA  252
            PE +  + E    G DS  R +  P   SF   ++   + A+SLKD VV  TW+ R G  
Sbjct  15   PEESAGDEETVAGGKDSLTRLLSLPYK-SF---SKKLQRLALSLKDTVVLETWE-RSGKR  69

Query  253  VTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRG  432
            V   D ++YTG+LGTA+   +S+Q T N  DL+LC +IV+ C  A+  + R +TF+CG  
Sbjct  70   VR--DYSLYTGVLGTAHLLFKSYQVTKNEDDLKLCLEIVEACYVASIDSKRVVTFICGHA  127

Query  433  GLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWA  612
            G+ ALGAVAA + GD+Q  D YL  F E+     LP           Y+LLYGRAG+LW+
Sbjct  128  GVCALGAVAAKHLGDEQLCDRYLARFSEIRIPSDLP-----------YELLYGRAGYLWS  176

Query  613  ALFIKQHLGSE  645
             LF+ +H+G E
Sbjct  177  CLFMNKHIGQE  187



>ref|XP_006303704.1| hypothetical protein CARUB_v10011802mg [Capsella rubella]
 gb|EOA36602.1| hypothetical protein CARUB_v10011802mg [Capsella rubella]
Length=410

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 79/203 (39%), Positives = 111/203 (55%), Gaps = 19/203 (9%)
 Frame = +1

Query  43   ERKMSSSIVHLASPESNGTNHE-DGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVV  219
            ER   + +      ES G      G       +L     SF   ++   + A+SLKD  V
Sbjct  3    ERFFRNEMPEFVPEESTGDEEAVSGGKDSLTKLLSLPYKSF---SKKLHRLALSLKDTAV  59

Query  220  DMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPAT  399
              TW+ R G  V   D ++YTG+LGTAY   +S+Q T N+ DL+LC +IV+ C  A+  +
Sbjct  60   LETWE-RSGKRVR--DYSLYTGVLGTAYLMFKSYQVTRNKDDLKLCLEIVEACDVASRDS  116

Query  400  IRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYD  579
             R +TF+CG  G+ ALGAVAA + GD Q RD YL  F E+     LP           Y+
Sbjct  117  ER-VTFICGHAGVCALGAVAAKHLGDDQLRDRYLACFSEIRLPSDLP-----------YE  164

Query  580  LLYGRAGFLWAALFIKQHLGSEA  648
            LLYGR+G+LW+ LF+ +H+G E+
Sbjct  165  LLYGRSGYLWSCLFLNKHIGQES  187



>emb|CDY26028.1| BnaC06g05960D [Brassica napus]
Length=386

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 104/183 (57%), Gaps = 19/183 (10%)
 Frame = +1

Query  112  GNDSGFRTVLDPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVY  279
            G +    T  D       LP  +F +     A+SLKD +V  TW+ R G  V   D  +Y
Sbjct  19   GEEETVSTHKDSLTKLLSLPYRSFSKKLQRYALSLKDTIVFETWE-RSGKRVR--DFNLY  75

Query  280  TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  459
            TG+LGTAY   +S Q T N+ DL+LC +IV+ C +A+  + R +TF+CGR G+ ALGAVA
Sbjct  76   TGVLGTAYLLFKSCQVTRNKNDLKLCLEIVEACYTASKDSDR-VTFICGRAGVCALGAVA  134

Query  460  ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            A   GD Q +D YL  F E+     LP           Y+LLYGRAG+LWA LF+ +H+ 
Sbjct  135  AKLTGDSQLQDRYLARFHEIRLPSDLP-----------YELLYGRAGYLWACLFLNKHIE  183

Query  640  SEA  648
             ++
Sbjct  184  KDS  186



>gb|KDP27026.1| hypothetical protein JCGZ_20961 [Jatropha curcas]
Length=408

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 95/157 (61%), Gaps = 15/157 (10%)
 Frame = +1

Query  175  ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  354
            E   ++A+ +KD VV  TW   G S     D T+YTG+LGTAY   +++Q T N  DL+L
Sbjct  43   ERLKRSALDIKDTVVRETW---GLSGKRVQDYTIYTGMLGTAYLLFKAYQVTKNYNDLKL  99

Query  355  CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  534
            C+DIV  C SA+  + R +TF+CGR G+ ALGAV A + GD++  D YL  F E+     
Sbjct  100  CSDIVMACDSASRGSGR-VTFICGRAGVCALGAVTAKHAGDERLLDLYLTQFKEIKLPSD  158

Query  535  LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            LP           Y+LLYGRAGFLW+  F+ +H+G E
Sbjct  159  LP-----------YELLYGRAGFLWSCSFLNKHIGKE  184



>ref|XP_009147647.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCR2 [Brassica 
rapa]
Length=409

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 103/183 (56%), Gaps = 19/183 (10%)
 Frame = +1

Query  112  GNDSGFRTVLDPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVY  279
            G +    T  D       LP  +F +     A+SLKD +V  TW  R G  V   D  +Y
Sbjct  19   GEEETVSTHKDSLTKLLSLPYRSFSKKLQRYALSLKDTIVFETWD-RSGKRVR--DFNLY  75

Query  280  TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  459
            TG+LGTAY   +S+Q   N  DL+LC +IV+ C +A+  + R +TF+CGR G+ ALGAVA
Sbjct  76   TGVLGTAYLLFQSYQVARNENDLKLCLEIVEACYTASKDSDR-VTFICGRAGVCALGAVA  134

Query  460  ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            A   GD Q +D YL  F E+     LP           Y+LLYGRAG+LWA LF+ +H+G
Sbjct  135  AKLTGDSQLQDRYLARFHEIRLPGDLP-----------YELLYGRAGYLWACLFLNKHIG  183

Query  640  SEA  648
             ++
Sbjct  184  KDS  186



>ref|XP_010051804.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Eucalyptus 
grandis]
Length=419

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 97/163 (60%), Gaps = 15/163 (9%)
 Frame = +1

Query  151  APSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQAT  330
            A  + + +E+F +AA+ LK+ +V  TW   G +     D T+Y G LGTA+   RS+Q T
Sbjct  44   AKPYPVLSESFKRAALDLKETIVVQTW---GATRQRVRDFTLYCGSLGTAFLLFRSYQIT  100

Query  331  GNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYF  510
             N  DL LC+ I+  C SA+ A  R +TF+CGR G+ ALGAV A Y GD      YL++F
Sbjct  101  SNSNDLALCSQIIRACDSAS-AKSRDVTFICGRAGVCALGAVVAKYAGDTHSLTHYLNHF  159

Query  511  FEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
             E+   K++P            +LLYGRAGFLWA LF+ +H+G
Sbjct  160  KEIKLSKSIPD-----------ELLYGRAGFLWACLFLNKHIG  191



>ref|XP_006392852.1| hypothetical protein EUTSA_v10011533mg [Eutrema salsugineum]
 gb|ESQ30138.1| hypothetical protein EUTSA_v10011533mg [Eutrema salsugineum]
Length=409

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 98/158 (62%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            +E   + A+SLKD VV  TW+ R G  V   D ++YTG+LGTAY   +S+Q T N  DL+
Sbjct  43   SEKLQRYALSLKDTVVRETWE-RSGKRVG--DYSLYTGVLGTAYLLFKSYQITRNEDDLK  99

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC +IV+ C  A+  + R +TF+CGR G+ ALGAV A + GD Q +D YL  F E+    
Sbjct  100  LCLEIVEACDVASRDSER-LTFICGRAGVCALGAVVAKHLGDDQLQDRYLADFREIRLPS  158

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             LP           ++LLYGRAG+LWA LF+ +H+G +
Sbjct  159  GLP-----------HELLYGRAGYLWACLFLNKHIGKD  185



>ref|XP_002517941.1| catalytic, putative [Ricinus communis]
 gb|EEF44459.1| catalytic, putative [Ricinus communis]
Length=410

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 95/156 (61%), Gaps = 15/156 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ F +A + LK+ +V  TW   G S     D T+Y+G LG+A+   +S+Q T N+ DL 
Sbjct  43   SQRFQRAGLDLKETIVMETWGLSGQSV---QDFTLYSGTLGSAFLIFKSYQVTNNKNDLF  99

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC  IV  C SA+PA+ R +TFLCGR G+ ALGAVAA Y  DQ  ++ YL+ F EV   K
Sbjct  100  LCLQIVKACDSASPAS-RDVTFLCGRAGVCALGAVAAKYANDQDLQNYYLNQFGEVKLSK  158

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
              P            +LLYGR+G+LWA LFI +H+G
Sbjct  159  NHPD-----------ELLYGRSGYLWACLFINKHIG  183



>ref|XP_010062888.1| PREDICTED: lanC-like protein GCR2 [Eucalyptus grandis]
 gb|KCW70029.1| hypothetical protein EUGRSUZ_F03336 [Eucalyptus grandis]
Length=409

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 101/172 (59%), Gaps = 19/172 (11%)
 Frame = +1

Query  142  DPTAPSFILP----AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  309
            DP +    LP    +E   +AA+ LKD V   TW A GG  +   D T+YTG LGTAY  
Sbjct  29   DPLSKLLYLPHAALSEKLKKAALDLKDTVARETW-AVGGKRLQ--DYTLYTGALGTAYLV  85

Query  310  LRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKR  489
             ++FQ T N  DLRLC++I+  C +A+  + R +TF+CG+ G+ ALGAV A + GD++  
Sbjct  86   FKAFQVTKNESDLRLCSEIIRACDAASRDSGR-VTFICGQAGVCALGAVVAKHSGDERLL  144

Query  490  DSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            D YL  F E+   + LP            +LLYGRAGFLWA  F+ +H+G E
Sbjct  145  DHYLTRFKEIQLPRDLP-----------NELLYGRAGFLWAGSFLNKHIGKE  185



>ref|XP_002894411.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70670.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 105/183 (57%), Gaps = 19/183 (10%)
 Frame = +1

Query  112  GNDSGFRTVLDPTAPSFILPAETF---LQA-AVSLKDQVVDMTWKARGGSAVTHMDPTVY  279
            G D       D       LP ++F   LQ+ A+SLKD+VV  TW+ R G  V   D  +Y
Sbjct  20   GEDETVTAGKDSLTKLLSLPYKSFSEKLQSYALSLKDKVVWETWE-RSGKRVR--DYKLY  76

Query  280  TGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVA  459
            TG+LGTAY   +S+Q T N  DL+LC +IV+ C  A+  + R +TF+CG  G+ ALGAVA
Sbjct  77   TGVLGTAYLLFKSYQVTRNEDDLKLCLEIVEACDVASRDSER-VTFICGHAGVCALGAVA  135

Query  460  ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            A + GD Q  D YL  F  +     LP           Y+LLYGRAG+LWA LF+ +H+G
Sbjct  136  AKHLGDNQLLDRYLARFRGIRLPSYLP-----------YELLYGRAGYLWACLFLNKHIG  184

Query  640  SEA  648
             ++
Sbjct  185  KDS  187



>ref|XP_010099009.1| hypothetical protein L484_025669 [Morus notabilis]
 gb|EXB76311.1| hypothetical protein L484_025669 [Morus notabilis]
Length=409

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 96/172 (56%), Gaps = 19/172 (11%)
 Frame = +1

Query  139  LDPTAPSFILPAETF----LQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYT  306
            +DP      LP +TF      +A+ LKD VV  TW   G       D TVYTG LGTAY 
Sbjct  28   VDPLTKLLSLPYKTFSDSLRSSALELKDTVVRETWVLSGKRV---QDYTVYTGALGTAYL  84

Query  307  CLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQK  486
              +++Q T N  DL+LC +IV  C SA+  + R +TFLCGR  + ALGAVAA + GD++ 
Sbjct  85   AFKAYQVTKNANDLKLCLEIVKACDSASRDSSR-VTFLCGRASVCALGAVAAKHAGDERL  143

Query  487  RDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
               Y+  F E+     LP            +LLYGRAGFLWA+ FI  H+G+
Sbjct  144  LGHYITQFKEIKLSSDLP-----------NELLYGRAGFLWASSFINHHIGN  184



>gb|KJB84324.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=407

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 93/152 (61%), Gaps = 15/152 (10%)
 Frame = +1

Query  190  AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  369
            AA++LK+ VV  TW   G S     D T+YTG LGTAY   +++Q T N  DL+LC+DIV
Sbjct  47   AALALKETVVRETW---GLSGKRVQDYTLYTGALGTAYLVFKAYQVTKNDNDLKLCSDIV  103

Query  370  DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  549
              C SA+  + R +TF+CGR G+YALGAV A + GD   +  YL+ F E+     LP   
Sbjct  104  KACDSASKDSGR-VTFICGRAGVYALGAVIAKHSGDTSLQQRYLEKFKEIRFPSDLP---  159

Query  550  EEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                    ++LLYGRAGFLWA  F+ +H+G +
Sbjct  160  --------HELLYGRAGFLWACSFLNKHIGKD  183



>ref|XP_007021343.1| G protein coupled receptor [Theobroma cacao]
 gb|EOY12868.1| G protein coupled receptor [Theobroma cacao]
Length=406

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 98/175 (56%), Gaps = 19/175 (11%)
 Frame = +1

Query  133  TVLDPTAPSFILPAETF----LQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTA  300
            T  D       LP +TF      +A+ LK+ VV  TW+  G       D T+YTG LGTA
Sbjct  23   TTRDSLTKLLSLPYKTFSDKLKTSALDLKETVVRETWRLSGKRV---QDYTLYTGALGTA  79

Query  301  YTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQ  480
            Y    ++Q T N  DL+LC+DIV  C SA+  + R +TF+CGR G+ ALGAV A + GD+
Sbjct  80   YLVFNAYQVTKNENDLKLCSDIVKACDSASKDSGR-VTFICGRAGVCALGAVIAKHSGDE  138

Query  481  QKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            + +D YL  F E+     LP            +LLYGRAGFLWA  F+ +H+G +
Sbjct  139  RLQDRYLRKFKEIRFPSDLP-----------NELLYGRAGFLWACSFLNKHIGKD  182



>ref|XP_004141231.1| PREDICTED: lanC-like protein 2-like [Cucumis sativus]
 gb|KGN55144.1| hypothetical protein Csa_4G638330 [Cucumis sativus]
Length=412

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 91/151 (60%), Gaps = 15/151 (10%)
 Frame = +1

Query  187  QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  366
            QAA++LK+ VV  TW   G       D T+YTG LGTA+  L+SF  + N  DL+LC++I
Sbjct  51   QAALNLKETVVRETWTLSGRHP---QDNTLYTGALGTAFLALKSFFVSKNENDLKLCSEI  107

Query  367  VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  546
            V  C S +  T RH+TF+CGR G+ ALGAVAA +  D +  D YL  F ++     LP  
Sbjct  108  VTACESLS-KTSRHVTFICGRAGVCALGAVAAKFANDGRLVDHYLAKFKDIKLPSDLP--  164

Query  547  PEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
                      +LLYGRAGFLWA LF+ +H+G
Sbjct  165  ---------NELLYGRAGFLWACLFLNKHIG  186



>ref|XP_008348578.1| PREDICTED: lanC-like protein GCL1 [Malus domestica]
Length=116

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 74/105 (70%), Gaps = 4/105 (4%)
 Frame = +1

Query  100  NHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH---MDP  270
            +HED N      V DP A +  LP+ TFL+AAV+LKDQVV  TW+   GS       +DP
Sbjct  13   DHEDANKERLDLV-DPAAKNLSLPSGTFLRAAVALKDQVVQDTWEGGHGSGTPTDMVLDP  71

Query  271  TVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIR  405
            TVYTGLLGTA+TCLRS++ATGNRQDL LCADIVD C +  PA+ R
Sbjct  72   TVYTGLLGTAFTCLRSYEATGNRQDLLLCADIVDKCGAVXPASSR  116



>ref|XP_010245303.1| PREDICTED: lanC-like protein GCL2 [Nelumbo nucifera]
Length=420

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 111/208 (53%), Gaps = 22/208 (11%)
 Frame = +1

Query  31   NISKERKMSSSIVHLASP----ESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAV  198
            NI ++R+M+        P    E+      +G     R +L    P+    AE F + A+
Sbjct  6    NIKRKREMADRFFPNEMPDFVAETTEETAPEGVGDSLRKLLSLPYPTV---AEKFKRTAL  62

Query  199  SLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTC  378
             LK+ +V  TW   G S     D T+YTG LGTA+   +++Q T N+ DL LC++IV  C
Sbjct  63   DLKETIVTNTW---GFSRRRLSDFTLYTGALGTAFLLFKAYQVTKNKNDLNLCSEIVKAC  119

Query  379  ASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEG  558
             SA+  + +++TF+CGR G+ ALGAV A + GD++    YL  F E+     +P      
Sbjct  120  DSASSGS-KYVTFICGRAGVCALGAVIAKHAGDERLLSYYLTQFKEIKLPNDVP------  172

Query  559  GFGMSYDLLYGRAGFLWAALFIKQHLGS  642
                  +LLYGRAGFLWA  F+ +H+G 
Sbjct  173  -----NELLYGRAGFLWACSFLNKHIGE  195



>ref|XP_009617548.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nicotiana tomentosiformis]
Length=410

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 99/173 (57%), Gaps = 19/173 (11%)
 Frame = +1

Query  142  DPTAPSFILPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  309
            DP      LP  T  Q    AA+ LK+ +V  TW ++GG      D T+YTG LGTA+  
Sbjct  29   DPLLKLLHLPYRTVCQKLQRAALDLKETIVKETWVSKGGRV---SDYTLYTGALGTAFLL  85

Query  310  LRSFQATGNRQDLRLCADIVDTCASAAPAT-IRHITFLCGRGGLYALGAVAANYCGDQQK  486
             +++Q T +  DL LC+ I+  C SA+  +  R +TF+CG+ G+YALGAV A + GD+Q 
Sbjct  86   FKAYQVTSDNNDLALCSHIIKACDSASRGSGCRRVTFICGQAGVYALGAVVAKHSGDEQL  145

Query  487  RDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             D YL  F E+   K LP            +LLYGRAGFLWA  F+ +++G +
Sbjct  146  CDYYLTKFKEIELPKDLP-----------NELLYGRAGFLWACSFLNKNIGRD  187



>ref|XP_008676974.1| PREDICTED: LOC100282928 isoform X1 [Zea mays]
 tpg|DAA49460.1| TPA: hypothetical protein ZEAMMB73_373795 [Zea mays]
Length=451

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 108/188 (57%), Gaps = 18/188 (10%)
 Frame = +1

Query  85   ESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHM  264
            E+  ++ E    +G R +L   +  +   ++ F++AA  LKD+VV+ TW  + G  VT  
Sbjct  57   EAEASDGEGHRPAGHRGLL---SLPYTRLSDHFVRAARRLKDKVVEETW-VKAGRKVT--  110

Query  265  DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH-ITFLCGRGGLY  441
            D T+YTG LGTA    +SFQ TG+R DL L ADIV  C  A+    R  +TF+CGR G+ 
Sbjct  111  DYTLYTGSLGTALLLFKSFQVTGDRGDLALAADIVRACDDASRGLPRRFLTFICGRAGVC  170

Query  442  ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  621
            ALGAV A +C DQ +   YL  F E+   + +P            +LLYGRAG+LWA LF
Sbjct  171  ALGAVIAKHCDDQLRVTQYLSSFDEITITEKVP-----------NELLYGRAGYLWACLF  219

Query  622  IKQHLGSE  645
            + +HL  +
Sbjct  220  LNKHLSEK  227



>ref|XP_011042485.1| PREDICTED: lanC-like protein GCR2 [Populus euphratica]
 ref|XP_011013677.1| PREDICTED: lanC-like protein GCR2 [Populus euphratica]
Length=412

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 108/199 (54%), Gaps = 18/199 (9%)
 Frame = +1

Query  49   KMSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMT  228
            +M   I    +   + T  E  N      +L  + P  IL ++    +A+ +KD VV  T
Sbjct  9    EMPDYIPETTTTAVDETVTERNNKDSLTKLL--SLPYNIL-SQRLKASALDVKDTVVRET  65

Query  229  WKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  408
            W   G S     D ++YTG LGTAY  L+++Q T N+ DL LC+DI+  C S +  + R 
Sbjct  66   W---GMSGKRVKDYSLYTGALGTAYLLLKAYQVTKNQNDLNLCSDIIKACDSVSRDSGR-  121

Query  409  ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  588
            +TF+CGR G+ ALGAVAA + GD +  D YL  F E+     LP           Y+LLY
Sbjct  122  VTFICGRAGVCALGAVAAKHAGDGRLLDHYLAQFKEIKLPSDLP-----------YELLY  170

Query  589  GRAGFLWAALFIKQHLGSE  645
            GRAGFLWA  F+ +H+G E
Sbjct  171  GRAGFLWACSFLNKHIGKE  189



>ref|XP_010241998.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nelumbo nucifera]
Length=409

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 104/182 (57%), Gaps = 14/182 (8%)
 Frame = +1

Query  97   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  276
            TN E G +    ++L   +  +   A    + A+ LK+ +V  TW   G S     D T+
Sbjct  17   TNDETGAEGIEDSLLKLLSLPYPTLAAKLKRTALDLKETIVTNTW---GFSGRCVSDFTL  73

Query  277  YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAV  456
            YTG LGTA+   +++QAT N+ DL LCA+IV  C SA+  +   +TF+CGR G+ +LGA+
Sbjct  74   YTGSLGTAFLLFKAYQATKNKNDLNLCAEIVKACDSASSGSGSDVTFICGRAGVCSLGAI  133

Query  457  AANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHL  636
            AA + G++Q  + YL  F E+   K +P            +LLYGRAGFLWA LFI +H+
Sbjct  134  AAKHAGNEQLLNHYLTQFKEIKLPKNVP-----------NELLYGRAGFLWACLFINKHI  182

Query  637  GS  642
            G 
Sbjct  183  GK  184



>ref|XP_006370294.1| hypothetical protein POPTR_0001s41360g [Populus trichocarpa]
 gb|ERP66863.1| hypothetical protein POPTR_0001s41360g [Populus trichocarpa]
Length=412

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/206 (38%), Positives = 110/206 (53%), Gaps = 18/206 (9%)
 Frame = +1

Query  28   GNISKERKMSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLK  207
            G+ S   +M   I    +   + T  E  N      +L  + P  IL ++    +A+ +K
Sbjct  2    GDRSFPNEMPDYIPETTTTAVDETVTERNNKDSLTNLL--SLPYNIL-SQRLKASALDVK  58

Query  208  DQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASA  387
            D VV  TW   G S     D ++YTG LGTAY   +++Q T N+ DL LC+DI+  C S 
Sbjct  59   DTVVRETW---GMSGKRVKDYSLYTGALGTAYLLFKAYQVTKNQNDLNLCSDIIKACDSV  115

Query  388  APATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFG  567
            +  + R +TF+CGR G+ ALGAVAA + GD +  D YL  F E+     LP         
Sbjct  116  SRDSGR-VTFICGRAGVCALGAVAAKHAGDGRLLDHYLAQFKEIKLPSDLP---------  165

Query  568  MSYDLLYGRAGFLWAALFIKQHLGSE  645
              Y+LLYGRAGFLWA  F+ +H+G E
Sbjct  166  --YELLYGRAGFLWACSFLNKHIGKE  189



>ref|XP_009617549.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nicotiana tomentosiformis]
Length=408

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 99/172 (58%), Gaps = 19/172 (11%)
 Frame = +1

Query  142  DPTAPSFILPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  309
            DP      LP  T  Q    AA+ LK+ +V  TW ++GG      D T+YTG LGTA+  
Sbjct  29   DPLLKLLHLPYRTVCQKLQRAALDLKETIVKETWVSKGGRV---SDYTLYTGALGTAFLL  85

Query  310  LRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKR  489
             +++Q T +  DL LC+ I+  C SA+  + R +TF+CG+ G+YALGAV A + GD+Q  
Sbjct  86   FKAYQVTSDNNDLALCSHIIKACDSASRGSGR-VTFICGQAGVYALGAVVAKHSGDEQLC  144

Query  490  DSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            D YL  F E+   K LP            +LLYGRAGFLWA  F+ +++G +
Sbjct  145  DYYLTKFKEIELPKDLP-----------NELLYGRAGFLWACSFLNKNIGRD  185



>gb|ACN31611.1| unknown [Zea mays]
Length=408

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 108/187 (58%), Gaps = 18/187 (10%)
 Frame = +1

Query  85   ESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHM  264
            E+  ++ E    +G R +L   +  +   ++ F++AA  LKD+VV+ TW  + G  VT  
Sbjct  16   EAEASDGEGHRPAGHRGLL---SLPYTRLSDHFVRAARRLKDKVVEETW-VKAGRKVT--  69

Query  265  DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  444
            D T+YTG LGTA    +SFQ TG+R DL L ADIV  C  A+   +  +TF+CGR G+ A
Sbjct  70   DYTLYTGSLGTALLLFKSFQVTGDRGDLTLAADIVRACDDASRG-LPFLTFICGRAGVCA  128

Query  445  LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  624
            LGAV A +C DQ +   YL  F E+   + +P            +LLYGRAG+LWA LF+
Sbjct  129  LGAVIAKHCDDQLRVTQYLSSFDEITITEKVP-----------NELLYGRAGYLWACLFL  177

Query  625  KQHLGSE  645
             +HL  +
Sbjct  178  NKHLSEK  184



>ref|XP_009767465.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 98/173 (57%), Gaps = 19/173 (11%)
 Frame = +1

Query  142  DPTAPSFILPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  309
            DP +    LP  T  Q    AA  LK+ +V  TW  +GG      D T+YTG LGTA+  
Sbjct  29   DPLSKLLHLPYRTVCQKLKSAAQDLKETIVKETWVCKGGRVS---DYTLYTGALGTAFLL  85

Query  310  LRSFQATGNRQDLRLCADIVDTCASAAPAT-IRHITFLCGRGGLYALGAVAANYCGDQQK  486
             +++Q T +  DL LC+ I+  C SA+  +  R +TF+CG+ G+YALGAV A + GD+Q 
Sbjct  86   FKAYQVTRDNNDLALCSHIIKACDSASHGSGCRRVTFICGQAGVYALGAVVAKHSGDEQL  145

Query  487  RDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             D YL  F E+   K LP            +LLYGRAGFLWA  F+ +++G +
Sbjct  146  CDHYLTKFKEIELPKDLP-----------NELLYGRAGFLWACSFLNKNIGRD  187



>gb|ABB47830.2| Lanthionine synthetase C-like protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG93541.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   124 bits (312),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 93/158 (59%), Gaps = 15/158 (9%)
 Frame = +1

Query  175  ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  354
            E  L+AA+ +KD+V++ TW  R    VT  D T+YTG LGTA    +SFQ TGNR DL L
Sbjct  34   ERLLRAALRIKDKVMEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGNRADLAL  90

Query  355  CADIVDTCASAAPATIRH-ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
              DIV  C +A+    R  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   +
Sbjct  91   AGDIVKECDAASRGLPRRFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTE  150

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             +P            +LLYGRAG+LWA LF+  HLG +
Sbjct  151  KVP-----------NELLYGRAGYLWACLFLNTHLGEK  177



>ref|NP_001064963.1| Os10g0497900 [Oryza sativa Japonica Group]
 dbj|BAF26877.1| Os10g0497900, partial [Oryza sativa Japonica Group]
Length=447

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 93/158 (59%), Gaps = 15/158 (9%)
 Frame = +1

Query  175  ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  354
            E  L+AA+ +KD+V++ TW  R    VT  D T+YTG LGTA    +SFQ TGNR DL L
Sbjct  80   ERLLRAALRIKDKVMEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGNRADLAL  136

Query  355  CADIVDTCASAAPATIRH-ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
              DIV  C +A+    R  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   +
Sbjct  137  AGDIVKECDAASRGLPRRFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTE  196

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             +P            +LLYGRAG+LWA LF+  HLG +
Sbjct  197  KVP-----------NELLYGRAGYLWACLFLNTHLGEK  223



>ref|XP_010241999.1| PREDICTED: lanC-like protein GCL2 isoform X3 [Nelumbo nucifera]
Length=408

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 104/182 (57%), Gaps = 15/182 (8%)
 Frame = +1

Query  97   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  276
            TN E G +    ++L   +  +   A    + A+ LK+ +V  TW   G S     D T+
Sbjct  17   TNDETGAEGIEDSLLKLLSLPYPTLAAKLKRTALDLKETIVTNTW---GFSGRCVSDFTL  73

Query  277  YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAV  456
            YTG LGTA+   +++QAT N+ DL LCA+IV  C SA+  +   +TF+CGR G+ +LGA+
Sbjct  74   YTGSLGTAFLLFKAYQATKNKNDLNLCAEIVKACDSASSGS-GDVTFICGRAGVCSLGAI  132

Query  457  AANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHL  636
            AA + G++Q  + YL  F E+   K +P            +LLYGRAGFLWA LFI +H+
Sbjct  133  AAKHAGNEQLLNHYLTQFKEIKLPKNVP-----------NELLYGRAGFLWACLFINKHI  181

Query  637  GS  642
            G 
Sbjct  182  GK  183



>tpg|DAA49459.1| TPA: hypothetical protein ZEAMMB73_373795 [Zea mays]
Length=449

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 108/187 (58%), Gaps = 18/187 (10%)
 Frame = +1

Query  85   ESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHM  264
            E+  ++ E    +G R +L   +  +   ++ F++AA  LKD+VV+ TW  + G  VT  
Sbjct  57   EAEASDGEGHRPAGHRGLL---SLPYTRLSDHFVRAARRLKDKVVEETW-VKAGRKVT--  110

Query  265  DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  444
            D T+YTG LGTA    +SFQ TG+R DL L ADIV  C  A+   +  +TF+CGR G+ A
Sbjct  111  DYTLYTGSLGTALLLFKSFQVTGDRGDLALAADIVRACDDASRG-LPFLTFICGRAGVCA  169

Query  445  LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  624
            LGAV A +C DQ +   YL  F E+   + +P            +LLYGRAG+LWA LF+
Sbjct  170  LGAVIAKHCDDQLRVTQYLSSFDEITITEKVP-----------NELLYGRAGYLWACLFL  218

Query  625  KQHLGSE  645
             +HL  +
Sbjct  219  NKHLSEK  225



>ref|XP_011085355.1| PREDICTED: lanC-like protein GCL2 [Sesamum indicum]
Length=422

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++   +AA+ LK+ +V  TW A G       D T+YTG LGTA+   +SFQ  GN+ DL 
Sbjct  55   SQKLQRAALDLKETIVVETWGATGQRV---EDFTLYTGTLGTAFILFKSFQVAGNKNDLS  111

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC +IV  C S++ A+ R +TF+CGR G+ ALGAV A Y GD      YL  F E+   K
Sbjct  112  LCLEIVKACDSSS-ASSRDVTFICGRAGVCALGAVVAKYIGDDNLLQHYLAQFKEIRLSK  170

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
              P            +LLYGRAG+LW  LF+ +HLG E
Sbjct  171  DHPD-----------ELLYGRAGYLWTCLFLNKHLGKE  197



>ref|XP_004982728.1| PREDICTED: lanC-like protein 2-like [Setaria italica]
Length=446

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 96/158 (61%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ FL+AA  LKD+VV+ TW  + G  VT  D T+YTG LGTA    +SF+ TG+R DL 
Sbjct  80   SDRFLRAARRLKDKVVEETW-VKAGRQVT--DYTLYTGALGTALLLFKSFRVTGDRGDLA  136

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            L ADIV  C  A+   +  +TF+CGR G+ ALGAV A +C DQ +   YL  F E+   +
Sbjct  137  LAADIVHACDDASRG-LPFLTFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITITE  195

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             +P            +LLYGRAG+LWA LF+ +HL  +
Sbjct  196  KVP-----------NELLYGRAGYLWACLFLNKHLSEK  222



>tpg|DAA49457.1| TPA: LOW QUALITY PROTEIN: lanC-like protein 2 [Zea mays]
Length=400

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 96/158 (61%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ F++AA  LKD+VV+ TW  + G  VT  D T+YTG LGTA    +SFQ TG+R DL 
Sbjct  34   SDHFVRAARRLKDKVVEETW-VKAGRKVT--DYTLYTGSLGTALLLFKSFQVTGDRGDLA  90

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            L ADIV  C  A+   +  +TF+CGR G+ ALGAV A +C DQ +   YL  F E+   +
Sbjct  91   LAADIVRACDDASRG-LPFLTFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITITE  149

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             +P            +LLYGRAG+LWA LF+ +HL  +
Sbjct  150  KVP-----------NELLYGRAGYLWACLFLNKHLSEK  176



>ref|NP_001149305.1| LOC100282928 [Zea mays]
 gb|ACG34942.1| lanC-like protein 2 [Zea mays]
Length=401

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 96/158 (61%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ F++AA  LKD+VV+ TW  + G  VT  D T+YTG LGTA    +SFQ TG+R DL 
Sbjct  35   SDHFVRAARRLKDKVVEETW-VKAGRKVT--DYTLYTGSLGTALLLFKSFQVTGDRGDLA  91

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            L ADIV  C  A+   +  +TF+CGR G+ ALGAV A +C DQ +   YL  F E+   +
Sbjct  92   LAADIVRACDDASRG-LPFLTFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITITE  150

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             +P            +LLYGRAG+LWA LF+ +HL  +
Sbjct  151  KVP-----------NELLYGRAGYLWACLFLNKHLSEK  177



>gb|ABB47829.2| Lanthionine synthetase C-like protein, expressed [Oryza sativa 
Japonica Group]
Length=399

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 92/157 (59%), Gaps = 15/157 (10%)
 Frame = +1

Query  175  ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  354
            E  L+AA+ +KD+V++ TW  R    VT  D T+YTG LGTA    +SFQ TGNR DL L
Sbjct  34   ERLLRAALRIKDKVMEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGNRADLAL  90

Query  355  CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  534
              DIV  C  AA   +  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   + 
Sbjct  91   AGDIVKEC-DAASRGLPFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEK  149

Query  535  LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            +P            +LLYGRAG+LWA LF+  HLG +
Sbjct  150  VP-----------NELLYGRAGYLWACLFLNTHLGEK  175



>gb|AAL58268.1|AC068923_10 putative lanthionine synthetase [Oryza sativa Japonica Group]
Length=446

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 92/157 (59%), Gaps = 15/157 (10%)
 Frame = +1

Query  175  ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  354
            E  L+AA+ +KD+V++ TW  R    VT  D T+YTG LGTA    +SFQ TGNR DL L
Sbjct  81   ERLLRAALRIKDKVMEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGNRADLAL  137

Query  355  CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  534
              DIV  C  AA   +  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   + 
Sbjct  138  AGDIVKEC-DAASRGLPFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEK  196

Query  535  LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            +P            +LLYGRAG+LWA LF+  HLG +
Sbjct  197  VP-----------NELLYGRAGYLWACLFLNTHLGEK  222



>ref|XP_009767466.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nicotiana sylvestris]
Length=408

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 98/172 (57%), Gaps = 19/172 (11%)
 Frame = +1

Query  142  DPTAPSFILPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  309
            DP +    LP  T  Q    AA  LK+ +V  TW  +GG      D T+YTG LGTA+  
Sbjct  29   DPLSKLLHLPYRTVCQKLKSAAQDLKETIVKETWVCKGGRVS---DYTLYTGALGTAFLL  85

Query  310  LRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKR  489
             +++Q T +  DL LC+ I+  C SA+  + R +TF+CG+ G+YALGAV A + GD+Q  
Sbjct  86   FKAYQVTRDNNDLALCSHIIKACDSASHGSGR-VTFICGQAGVYALGAVVAKHSGDEQLC  144

Query  490  DSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            D YL  F E+   K LP            +LLYGRAGFLWA  F+ +++G +
Sbjct  145  DHYLTKFKEIELPKDLP-----------NELLYGRAGFLWACSFLNKNIGRD  185



>ref|XP_002284781.1| PREDICTED: lanC-like protein GCR2 [Vitis vinifera]
 emb|CBI20338.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 108/187 (58%), Gaps = 19/187 (10%)
 Frame = +1

Query  85   ESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHM  264
            E+  T+ ++  DS  + +  P    +   ++ F +AA+ +KD VV  TW A  G  V   
Sbjct  16   EAEETSAQNSGDSLIKLLSFP----YETLSQQFERAALDVKDAVVRETW-ALAGKRVQ--  68

Query  265  DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  444
            D  +YTG LGTA+   +++Q T NR DL +C++IV  C SA+ AT   +TF+CG+ G+YA
Sbjct  69   DYALYTGALGTAFLLFKAYQITNNRDDLNVCSEIVKACDSAS-ATSGRVTFICGQAGVYA  127

Query  445  LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  624
            +GAVAA + GD++    YL  F E+   K LP            +LLYGR GFLWA  F+
Sbjct  128  IGAVAAKHAGDERLLGRYLTQFKEIKLPKDLP-----------NELLYGRGGFLWACSFL  176

Query  625  KQHLGSE  645
             +H+G +
Sbjct  177  NKHIGKD  183



>gb|KDO74126.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=320

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 93/158 (59%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++T   +A++LK  VV+ TW   G       D T+YTG LGTAY   +++Q T N  +L+
Sbjct  41   SDTLKNSALALKQTVVNETWGVSGKRV---QDYTLYTGALGTAYLLFKAYQVTKNDNELK  97

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC DIV+ C SA+  + R +TF+CGR G+ ALGAV A + GD++  D YL  F E+    
Sbjct  98   LCCDIVEACDSASRDSGR-VTFICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPS  156

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             LP            +LLYGR GFLWA  F+ +H+G +
Sbjct  157  DLP-----------NELLYGRVGFLWACSFLNKHMGKD  183



>gb|KHG14999.1| LanC-like protein 2 [Gossypium arboreum]
Length=407

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 90/152 (59%), Gaps = 15/152 (10%)
 Frame = +1

Query  190  AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  369
            AA++LK+ VV  TW   G S     D T+YTG LGTAY   +++Q T N  DL+LC+DIV
Sbjct  47   AALALKETVVRETW---GLSGKRVQDYTLYTGALGTAYLVFKAYQVTKNDNDLKLCSDIV  103

Query  370  DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  549
              C SA+  + R +TF+CGR G+YALGAV A   GD      YL  F E+     LP   
Sbjct  104  KACDSASKDSGR-VTFICGRAGVYALGAVIAKQSGDTSLEQRYLAKFNEIRFPSDLP---  159

Query  550  EEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                    ++LLYGRAGFLWA  F+ +H+G +
Sbjct  160  --------HELLYGRAGFLWACSFLNKHIGKD  183



>ref|XP_008452476.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Cucumis melo]
Length=412

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 89/151 (59%), Gaps = 15/151 (10%)
 Frame = +1

Query  187  QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  366
            Q A++LK+ VV  TW   G       D T+YTG LGTA+  L+SF    N  DL+LC++I
Sbjct  51   QTALNLKETVVRETWTLSGRHP---QDYTLYTGALGTAFLALKSFLVFKNENDLKLCSEI  107

Query  367  VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  546
            V  C S +  + RH+TF+CGR G+ ALGAVAA +  D    D YL+ F ++     LP  
Sbjct  108  VAACESLSKKS-RHVTFICGRAGVCALGAVAAKFANDGMLVDHYLEKFKDIKLPSDLP--  164

Query  547  PEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
                      +LLYGRAGFLWA LF+ +H+G
Sbjct  165  ---------NELLYGRAGFLWACLFLNKHIG  186



>ref|XP_008452475.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Cucumis melo]
Length=415

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 89/151 (59%), Gaps = 15/151 (10%)
 Frame = +1

Query  187  QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  366
            Q A++LK+ VV  TW   G       D T+YTG LGTA+  L+SF    N  DL+LC++I
Sbjct  51   QTALNLKETVVRETWTLSGRHP---QDYTLYTGALGTAFLALKSFLVFKNENDLKLCSEI  107

Query  367  VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  546
            V  C S +  + RH+TF+CGR G+ ALGAVAA +  D    D YL+ F ++     LP  
Sbjct  108  VAACESLSKKS-RHVTFICGRAGVCALGAVAAKFANDGMLVDHYLEKFKDIKLPSDLP--  164

Query  547  PEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
                      +LLYGRAGFLWA LF+ +H+G
Sbjct  165  ---------NELLYGRAGFLWACLFLNKHIG  186



>ref|XP_010542278.1| PREDICTED: lanC-like protein GCR2 [Tarenaya hassleriana]
Length=408

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 100/188 (53%), Gaps = 18/188 (10%)
 Frame = +1

Query  82   PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  261
            PE+ G   E G       +L     SF   ++   + A+ LKD V   TW     S    
Sbjct  15   PEAGGEEIEAGTKDSLEKLLCLPYRSF---SDRLRRYALDLKDTVARQTWIL---SEKRV  68

Query  262  MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  441
             D T+YTG LGTA+   +++QAT N  DLRLC+DI+  C SA+  +   +TF+CGR G+ 
Sbjct  69   QDYTLYTGSLGTAFLLFKAYQATKNENDLRLCSDIIKACDSASRNS-GPVTFICGRAGVC  127

Query  442  ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  621
            ALGAV A + GD +  D YL  F E+     LP            +LLYGRAG LWA LF
Sbjct  128  ALGAVVAKHIGDDRLLDHYLTRFDEIRLPSDLPC-----------ELLYGRAGCLWACLF  176

Query  622  IKQHLGSE  645
            + +H+G E
Sbjct  177  LNKHIGEE  184



>ref|XP_002534246.1| catalytic, putative [Ricinus communis]
 gb|EEF28136.1| catalytic, putative [Ricinus communis]
Length=419

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 91/157 (58%), Gaps = 15/157 (10%)
 Frame = +1

Query  175  ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  354
            +T  ++A  L+D VV  TW   G S     D TVYTG+LGTAY   +++Q T N  DL L
Sbjct  54   DTLKRSAFELRDMVVKETW---GLSGKRVQDYTVYTGVLGTAYLLFKAYQVTKNENDLNL  110

Query  355  CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  534
             + IV  C SA+  + R +TF+CGR G+YALGAV A + GD++  D YL  F E+     
Sbjct  111  SSQIVKACDSASIDSGR-VTFICGRAGVYALGAVIAKHAGDERLLDHYLTRFKEIKFPSD  169

Query  535  LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            LP            +LLYGRAGFLWA  F+ +H+  E
Sbjct  170  LP-----------NELLYGRAGFLWACSFLNKHIDKE  195



>ref|XP_002467007.1| hypothetical protein SORBIDRAFT_01g018190 [Sorghum bicolor]
 gb|EER94005.1| hypothetical protein SORBIDRAFT_01g018190 [Sorghum bicolor]
Length=451

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 107/191 (56%), Gaps = 18/191 (9%)
 Frame = +1

Query  73   LASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSA  252
            +A  E++  + E    +G R +L+     +    +  L+AA  LKD+VV+ TW  + G  
Sbjct  55   VAEAEASDGDGEGHRPAGLRGLLEL---PYTRLCDRLLRAARRLKDKVVEETW-LKAGRK  110

Query  253  VTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRG  432
            VT  D T+YTG LGTA    +SFQ TG+R DL L ADIV  C  A+   +  +TF+CGR 
Sbjct  111  VT--DYTLYTGSLGTALLLFKSFQVTGDRGDLALAADIVRACDEASRG-LPFLTFICGRA  167

Query  433  GLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWA  612
            G+ ALGAV A +C DQ +   YL  F E+   + +P            +LLYGR G+LWA
Sbjct  168  GVCALGAVIAKHCDDQLRVTQYLSSFDEITVTEKVP-----------NELLYGRVGYLWA  216

Query  613  ALFIKQHLGSE  645
             LF+ +HL  +
Sbjct  217  CLFLNKHLSEK  227



>ref|XP_008381258.1| PREDICTED: lanC-like protein GCL2 [Malus domestica]
Length=414

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 99/187 (53%), Gaps = 16/187 (9%)
 Frame = +1

Query  79   SPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVT  258
            +P  +    E GNDS    +L    PS    +     AA  LK  ++  TW     +   
Sbjct  17   APTPSPPQAEHGNDS-LMNLLSTPCPSL---SHLLKXAASDLKQTILTETWAGAAAAQSL  72

Query  259  HMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGL  438
            H D T+Y+G LGTA+   +S+Q TG+  D+ L A IV  C SA+  +   +TF+CGR G+
Sbjct  73   H-DFTLYSGALGTAFLLFKSYQVTGDANDITLXAQIVKACDSASLGSRDVVTFMCGRAGV  131

Query  439  YALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAAL  618
             ALGAVAA +CGD      YL  F E+   ++LP            +LLYG+ GFLWA L
Sbjct  132  CALGAVAAKHCGDSASLSYYLAQFREIKLSRSLPD-----------ELLYGKVGFLWACL  180

Query  619  FIKQHLG  639
            F+ +HLG
Sbjct  181  FLNKHLG  187



>ref|XP_010234867.1| PREDICTED: lanC-like protein GCR2 isoform X1 [Brachypodium distachyon]
Length=477

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 91/159 (57%), Gaps = 15/159 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++  L+AA+ LKD+VV+ TW   GG      D T+YTG LGTA    +SFQ  G+R+DL 
Sbjct  107  SDRLLRAALRLKDKVVEETWTKAGGHVT---DYTLYTGALGTALLLFKSFQVNGDRRDLT  163

Query  352  LCADIVDTCASAAPATIRH-ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQE  528
            L  +IV  C  A+    R  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   
Sbjct  164  LAGEIVQACDLASNGLPRRFLTFICGRAGVCALGAVIAKHCNDQLMVTHYLSSFDEITVT  223

Query  529  KALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
              +P            +LLYGRAG+LWA LF+ +HL  +
Sbjct  224  DKVP-----------NELLYGRAGYLWACLFLNEHLSEK  251



>ref|XP_007043560.1| GCR2-like 2 isoform 2, partial [Theobroma cacao]
 gb|EOX99391.1| GCR2-like 2 isoform 2, partial [Theobroma cacao]
Length=308

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 91/156 (58%), Gaps = 15/156 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ F +AA+ LK+ V   TW   G       D T+Y G LGTA+   +S+Q   N  DL 
Sbjct  40   SQHFKRAALDLKETVTLDTWGLTGQKVS---DFTLYCGTLGTAFLLFKSYQLANNTNDLS  96

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC  IVD C SA+ ++ R +TFLCGR G+ ALGAVAA + G+Q+  D YL  F E+    
Sbjct  97   LCLAIVDACNSASFSS-RDVTFLCGRAGVCALGAVAAKHAGNQELLDYYLSQFKEIKLSS  155

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
             LP            +LLYGRAGFLWA +F+ +HLG
Sbjct  156  NLP-----------DELLYGRAGFLWACVFLNKHLG  180



>dbj|BAJ96048.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 98/175 (56%), Gaps = 18/175 (10%)
 Frame = +1

Query  121  SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTA  300
            +G R +L    P     ++  L+AA+ LKD+VV  TW   GG      D T+YTG LGTA
Sbjct  26   AGLRGLLSLPYPRL---SDRLLRAALRLKDKVVQETWTRTGGQVT---DYTLYTGALGTA  79

Query  301  YTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQ  480
                ++FQ TG+R+DL L +DIV  C   A   +  +TF+ GR G+ ALGAV A +C DQ
Sbjct  80   LLLFKAFQVTGDRRDLNLASDIVQAC-DVASLGLPFLTFISGRAGVCALGAVIAKHCNDQ  138

Query  481  QKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                ++L  F E+   + +P            +LLYGRAG+LWA LF+ +HL  +
Sbjct  139  LMVTNFLSSFDEIIITEKVP-----------NELLYGRAGYLWACLFLNEHLSDK  182



>gb|KDO74125.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=407

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 93/158 (59%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++T   +A++LK  VV+ TW   G       D T+YTG LGTAY   +++Q T N  +L+
Sbjct  41   SDTLKNSALALKQTVVNETWGVSGKRV---QDYTLYTGALGTAYLLFKAYQVTKNDNELK  97

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC DIV+ C SA+  + R +TF+CGR G+ ALGAV A + GD++  D YL  F E+    
Sbjct  98   LCCDIVEACDSASRDSGR-VTFICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPS  156

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             LP            +LLYGR GFLWA  F+ +H+G +
Sbjct  157  DLP-----------NELLYGRVGFLWACSFLNKHMGKD  183



>ref|XP_006464716.1| PREDICTED: lanC-like protein GCR2-like [Citrus sinensis]
Length=407

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 93/158 (59%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++T   +A++LK  VV+ TW   G       D T+YTG LGTAY   +++Q T N  +L+
Sbjct  41   SDTLKNSALALKQTVVNETWGVSGKRV---QDYTLYTGALGTAYLLFKAYQVTKNDNELK  97

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC DIV+ C SA+  + R +TF+CGR G+ ALGAV A + GD++  D YL  F E+    
Sbjct  98   LCCDIVEACDSASRDSGR-VTFICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPS  156

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             LP            +LLYGR GFLWA  F+ +H+G +
Sbjct  157  DLP-----------NELLYGRVGFLWACSFLNKHMGKD  183



>ref|NP_175700.2| G-protein coupled receptor 2 [Arabidopsis thaliana]
 sp|F4IEM5.1|GCR2_ARATH RecName: Full=LanC-like protein GCR2; AltName: Full=G-protein 
coupled receptor 2 [Arabidopsis thaliana]
 gb|AEE32868.1| G-protein coupled receptor 2 [Arabidopsis thaliana]
Length=410

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 95/159 (60%), Gaps = 15/159 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            +E   + A+S+KD+VV  TW+ R G  V   D  +YTG+LGTAY   +S+Q T N  DL+
Sbjct  44   SEKLHRYALSIKDKVVWETWE-RSGKRVR--DYNLYTGVLGTAYLLFKSYQVTRNEDDLK  100

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC + V+ C  A+  + R +TF+CG  G+ ALGAVAA   GD Q  D YL  F  +    
Sbjct  101  LCLENVEACDVASRDSER-VTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPS  159

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEA  648
             LP           Y+LLYGRAG+LWA LF+ +H+G E+
Sbjct  160  DLP-----------YELLYGRAGYLWACLFLNKHIGQES  187



>pdb|3T33|A Chain A, Crystal Structure Of Arabidopsis Gcr2
Length=415

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 95/159 (60%), Gaps = 15/159 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            +E   + A+S+KD+VV  TW+ R G  V   D  +YTG+LGTAY   +S+Q T N  DL+
Sbjct  49   SEKLHRYALSIKDKVVWETWE-RSGKRVR--DYNLYTGVLGTAYLLFKSYQVTRNEDDLK  105

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC + V+ C  A+  + R +TF+CG  G+ ALGAVAA   GD Q  D YL  F  +    
Sbjct  106  LCLENVEACDVASRDSER-VTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPS  164

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEA  648
             LP           Y+LLYGRAG+LWA LF+ +H+G E+
Sbjct  165  DLP-----------YELLYGRAGYLWACLFLNKHIGQES  192



>gb|AAG52264.1|AC019018_1 putative G protein-coupled receptor; 80093-78432 [Arabidopsis 
thaliana]
Length=401

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 95/159 (60%), Gaps = 15/159 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            +E   + A+S+KD+VV  TW+ R G  V   D  +YTG+LGTAY   +S+Q T N  DL+
Sbjct  35   SEKLHRYALSIKDKVVWETWE-RSGKRVR--DYNLYTGVLGTAYLLFKSYQVTRNEDDLK  91

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC + V+ C  A+  + R +TF+CG  G+ ALGAVAA   GD Q  D YL  F  +    
Sbjct  92   LCLENVEACDVASRDSER-VTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPS  150

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEA  648
             LP           Y+LLYGRAG+LWA LF+ +H+G E+
Sbjct  151  DLP-----------YELLYGRAGYLWACLFLNKHIGQES  178



>ref|XP_008226665.1| PREDICTED: lanC-like protein GCR2 [Prunus mume]
Length=409

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 94/163 (58%), Gaps = 19/163 (12%)
 Frame = +1

Query  166  LPAETF----LQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  333
            LP ET       +A+ LK+ VV  TW   G S     D T+YTG+LGTA+   +++Q T 
Sbjct  37   LPYETLSDMLKSSALDLKETVVRQTW---GLSGKRVEDYTLYTGVLGTAFLAFKAYQVTK  93

Query  334  NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  513
            N  DL+LC++IV  C SA+  + R ++F CGR G+ ALGAV A + GDQ   D YL  F 
Sbjct  94   NENDLKLCSEIVKACDSASRGSGR-VSFTCGRAGVCALGAVVAKHAGDQMLLDRYLSQFK  152

Query  514  EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
            E+     LP            +LLYGRAGFLWA  F+ +H+G+
Sbjct  153  EIKLPSDLP-----------NELLYGRAGFLWACSFLNKHIGN  184



>ref|XP_003539910.1| PREDICTED: lanC-like protein GCL2-like [Glycine max]
 gb|KHN31966.1| LanC-like protein 2 [Glycine soja]
Length=414

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 98/174 (56%), Gaps = 19/174 (11%)
 Frame = +1

Query  118  DSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGT  297
            DS  + +  P AP      E   +AA+ LK+ +V  TW   G S     D T+Y G+LGT
Sbjct  33   DSLPKLLAMPHAPLL----ERLKRAALDLKETIVIETW---GLSGQQVRDFTLYCGVLGT  85

Query  298  AYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGD  477
            A+   +S++ TGN  DL LC++IV  C  AA A  R +TF+CGR G+ +LGAVAA + GD
Sbjct  86   AFLLFKSYRVTGNGNDLSLCSEIVKAC-DAASARSRDVTFICGRAGVCSLGAVAAKHAGD  144

Query  478  QQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
             +    YL  F ++   K LP            +LLYGR GFLWA LF+ +HLG
Sbjct  145  DESLKYYLAQFKKIKLSKDLPD-----------ELLYGRVGFLWACLFLNKHLG  187



>ref|XP_008229171.1| PREDICTED: lanC-like protein GCL2 [Prunus mume]
Length=413

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 95/173 (55%), Gaps = 18/173 (10%)
 Frame = +1

Query  121  SGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTA  300
            S    +L    PS    +E F + A+ LK+ ++  TW A G       D T+Y+G LGTA
Sbjct  32   SSLMKLLSMPYPSL---SERFKRTALDLKETILTETWGATGQRV---HDFTLYSGALGTA  85

Query  301  YTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQ  480
                +S+Q T N  DL LC+ I+  C SA+  + R +TF+CGR G+ ALGAVAA + GD 
Sbjct  86   LLLFKSYQVTSNTNDLSLCSQIIKACDSASLGS-RDVTFICGRAGICALGAVAAKHLGDS  144

Query  481  QKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
               D YL  F E+   + LP            +LLYG+ GFLWA LF+ +HLG
Sbjct  145  ASLDYYLAQFREIKLSRNLPD-----------ELLYGKVGFLWACLFLNKHLG  186



>ref|XP_003574129.2| PREDICTED: lanC-like protein GCR2 isoform X2 [Brachypodium distachyon]
Length=475

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++  L+AA+ LKD+VV+ TW   GG      D T+YTG LGTA    +SFQ  G+R+DL 
Sbjct  107  SDRLLRAALRLKDKVVEETWTKAGGHVT---DYTLYTGALGTALLLFKSFQVNGDRRDLT  163

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            L  +IV  C  A+   +  +TF+CGR G+ ALGAV A +C DQ     YL  F E+    
Sbjct  164  LAGEIVQACDLASNG-LPFLTFICGRAGVCALGAVIAKHCNDQLMVTHYLSSFDEITVTD  222

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             +P            +LLYGRAG+LWA LF+ +HL  +
Sbjct  223  KVP-----------NELLYGRAGYLWACLFLNEHLSEK  249



>ref|XP_007043559.1| GCR2-like 2 isoform 1 [Theobroma cacao]
 gb|EOX99390.1| GCR2-like 2 isoform 1 [Theobroma cacao]
Length=408

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 91/157 (58%), Gaps = 15/157 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ F +AA+ LK+ V   TW   G       D T+Y G LGTA+   +S+Q   N  DL 
Sbjct  40   SQHFKRAALDLKETVTLDTWGLTGQKVS---DFTLYCGTLGTAFLLFKSYQLANNTNDLS  96

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC  IVD C SA+ ++ R +TFLCGR G+ ALGAVAA + G+Q+  D YL  F E+    
Sbjct  97   LCLAIVDACNSASFSS-RDVTFLCGRAGVCALGAVAAKHAGNQELLDYYLSQFKEIKLSS  155

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
             LP            +LLYGRAGFLWA +F+ +HLG 
Sbjct  156  NLPD-----------ELLYGRAGFLWACVFLNKHLGE  181



>gb|KFK35758.1| hypothetical protein AALP_AA4G032600 [Arabis alpina]
Length=403

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/199 (39%), Positives = 102/199 (51%), Gaps = 19/199 (10%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            M         PES    +  G DS    +L     SF   +E   + A+SLKD VV  TW
Sbjct  1    MGERFFRYELPESVPEKYA-GEDS-MTKLLSLPYKSF---SEKLQKYALSLKDTVVLETW  55

Query  232  KARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHI  411
            + R G  V   D  +YTG+LGTAY   +S+  T N  DL+LC +IV  C   A      +
Sbjct  56   E-RCGKRVR--DYNMYTGVLGTAYLLFKSYLVTSNEDDLKLCLEIVQACDVVASRDSERV  112

Query  412  TFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYG  591
            TFLCG  G+ +LGAV A   GD Q +D YL  F E+     LP           Y+LLYG
Sbjct  113  TFLCGYAGVCSLGAVVAKCIGDDQLQDRYLTRFREIRLPSDLP-----------YELLYG  161

Query  592  RAGFLWAALFIKQHLGSEA  648
            R G+LWA LF+ +++G ++
Sbjct  162  RVGYLWACLFLNKYIGKDS  180



>gb|AGV54697.1| lanC-like protein 2 [Phaseolus vulgaris]
Length=405

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 91/156 (58%), Gaps = 15/156 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            +E F  +A  LK  VV  TW +RG       D T+YTG LGTAY   +++Q T +  DL 
Sbjct  39   SEKFQASAFHLKQSVVRETWGSRGKRV---KDYTLYTGALGTAYLLFKAYQVTKDGNDLN  95

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC++IV+ C SA+  + R +TFLCGR G+ ALGAV A + GD +  D YL  F E+   +
Sbjct  96   LCSEIVEACHSASADSGR-VTFLCGRAGVCALGAVVAKHTGDDRLLDYYLRQFKEIVIPR  154

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
              P           Y+LLYGR G+LWA  F+ +H+G
Sbjct  155  DSP-----------YELLYGRTGYLWACSFLNKHIG  179



>gb|KJB84326.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=409

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 87/145 (60%), Gaps = 15/145 (10%)
 Frame = +1

Query  211  QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            QVV  TW   G S     D T+YTG LGTAY   +++Q T N  DL+LC+DIV  C SA+
Sbjct  56   QVVRETW---GLSGKRVQDYTLYTGALGTAYLVFKAYQVTKNDNDLKLCSDIVKACDSAS  112

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
              + R +TF+CGR G+YALGAV A + GD   +  YL+ F E+     LP          
Sbjct  113  KDSGR-VTFICGRAGVYALGAVIAKHSGDTSLQQRYLEKFKEIRFPSDLP----------  161

Query  571  SYDLLYGRAGFLWAALFIKQHLGSE  645
             ++LLYGRAGFLWA  F+ +H+G +
Sbjct  162  -HELLYGRAGFLWACSFLNKHIGKD  185



>gb|KDP24150.1| hypothetical protein JCGZ_25807 [Jatropha curcas]
Length=414

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 106/181 (59%), Gaps = 18/181 (10%)
 Frame = +1

Query  97   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  276
            +  E+ +      +L    PS    ++ F +AA+ LK+ +V  TW   G +A +  D T+
Sbjct  25   SEKEETSGDSLMKLLSMPYPSL---SQRFQRAALDLKETIVMETW---GVNAQSVQDFTL  78

Query  277  YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAV  456
            Y+G LGTA+  L+++Q + N+ DL LC  IV  C SA+ A+ R +TF+CGR G+ A+GAV
Sbjct  79   YSGSLGTAFFLLKTYQVSNNKNDLSLCLQIVKACDSASLAS-RDLTFICGRAGVCAIGAV  137

Query  457  AANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHL  636
            AA +  D+  ++ YL+ F EV   +  P            +LLYGR+G+LWA LF+ +H+
Sbjct  138  AAKHANDEALKNYYLNQFGEVKLSRDHPD-----------ELLYGRSGYLWACLFLNKHI  186

Query  637  G  639
            G
Sbjct  187  G  187



>gb|KJB79968.1| hypothetical protein B456_013G075200 [Gossypium raimondii]
Length=409

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 103/186 (55%), Gaps = 19/186 (10%)
 Frame = +1

Query  82   PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  261
            PE+     ++  D+  + +  P +      ++ F + A+ LK+ V   TW   G ++   
Sbjct  15   PETTQHEQQEIGDTLIKLLSMPYSSL----SQHFKRTALDLKETVTLETW---GITSQKV  67

Query  262  MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  441
             D T+Y G LGTA+   +S+Q T N  DL LC  IVD C SA+ ++ R  TFLCGR G+ 
Sbjct  68   SDFTLYCGSLGTAFLLFKSYQLTNNTNDLSLCLAIVDACNSASLSS-RDATFLCGRAGVC  126

Query  442  ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  621
            ALGAVAA Y G+Q+  + YL  F E+   + LP            +LLYGRAGFLWA  F
Sbjct  127  ALGAVAAKYSGNQESLNHYLTPFREIKLSRDLPD-----------ELLYGRAGFLWACFF  175

Query  622  IKQHLG  639
            + +HLG
Sbjct  176  LNKHLG  181



>ref|XP_006348234.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=408

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 92/157 (59%), Gaps = 15/157 (10%)
 Frame = +1

Query  175  ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  354
            E   + A  LK+ +V  TW  + G      D TVYTG LGTA+   +++Q T ++ DL L
Sbjct  44   EKLKRVAFDLKETIVKETWVCKRGRV---SDYTVYTGALGTAFLLFKAYQVTLDKNDLVL  100

Query  355  CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  534
            C+DI+  C SA+  +  H+TF+CG+ G+Y+LGAV A +  D+Q  D YL  F E+   K 
Sbjct  101  CSDIIKACDSASRGS-GHVTFICGQAGVYSLGAVVAKHNEDEQLCDHYLTKFKEIELPKD  159

Query  535  LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            LP            +LLYGRAGFLWA  F+ +++G E
Sbjct  160  LP-----------NELLYGRAGFLWACSFLNKNIGRE  185



>emb|CAN64758.1| hypothetical protein VITISV_008093 [Vitis vinifera]
Length=412

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 103/187 (55%), Gaps = 19/187 (10%)
 Frame = +1

Query  82   PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  261
            P    T  + G DS  + +  P    F   ++   + A+ LK+  V  TW   G      
Sbjct  19   PTQEETPPQGGEDSLIKLLSMP----FSALSQRLKRTALDLKETAVIETWGLTGQHV---  71

Query  262  MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  441
             D T+Y+G+LGTAY   R++  T N+ DL LC++IV  C SA+  + R +TF+CGR G+ 
Sbjct  72   RDFTLYSGVLGTAYLLFRAYLVTANKTDLGLCSEIVKACDSASLGS-RDVTFICGRAGVC  130

Query  442  ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  621
            ALGAVAA + GD++  + YL  F E+   ++LP            +LLYGR GFLWA LF
Sbjct  131  ALGAVAAKHNGDERLMNYYLTQFNEIKLPRSLPD-----------ELLYGRVGFLWACLF  179

Query  622  IKQHLGS  642
            + +H+G 
Sbjct  180  LNKHIGQ  186



>ref|XP_002263345.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 ref|XP_010657174.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 ref|XP_010657175.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 emb|CBI28768.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 103/187 (55%), Gaps = 19/187 (10%)
 Frame = +1

Query  82   PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  261
            P    T  + G DS  + +  P    F   ++   + A+ LK+  V  TW   G      
Sbjct  19   PTQEETPPQGGEDSLIKLLSMP----FSALSQRLKRTALDLKETAVIETWGLTGQHV---  71

Query  262  MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  441
             D T+Y+G+LGTAY   R++  T N+ DL LC++IV  C SA+  + R +TF+CGR G+ 
Sbjct  72   RDFTLYSGVLGTAYLLFRAYLVTANKTDLGLCSEIVKACDSASLGS-RDVTFICGRAGVC  130

Query  442  ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  621
            ALGAVAA + GD++  + YL  F E+   ++LP            +LLYGR GFLWA LF
Sbjct  131  ALGAVAAKHNGDERLMNYYLTQFNEIKLPRSLPD-----------ELLYGRVGFLWACLF  179

Query  622  IKQHLGS  642
            + +H+G 
Sbjct  180  LNKHIGQ  186



>ref|XP_006827807.1| hypothetical protein AMTR_s00009p00267750 [Amborella trichopoda]
 gb|ERM95223.1| hypothetical protein AMTR_s00009p00267750 [Amborella trichopoda]
Length=374

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 91/159 (57%), Gaps = 11/159 (7%)
 Frame = +1

Query  163  ILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQ  342
            +L    + +  +  + ++V  TW   GG      D T+YTG LGTAY   +++Q T N+ 
Sbjct  1    MLSLLVYQELPIDSEKEIVKETWVNCGGRV---KDTTLYTGALGTAYLLFKAYQVTNNKD  57

Query  343  DLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVA  522
            DL LC +I+ +C  ++      +TF+CG+ G+YALGAVAA   GDQ   D YL  F    
Sbjct  58   DLSLCTEIIASCDVSSRGMREDVTFICGQAGIYALGAVAAKCIGDQSLLDRYLSLF----  113

Query  523  QEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
              + +P   E   + + Y+LLYGR+GFLWA  F+ QH+G
Sbjct  114  --RKIPKRIES--YDIPYELLYGRSGFLWACAFLNQHIG  148



>ref|XP_008366750.1| PREDICTED: lanC-like protein GCL2 [Malus domestica]
Length=409

 Score =   119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 91/151 (60%), Gaps = 15/151 (10%)
 Frame = +1

Query  190  AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  369
            +A+ LK+ VV  TW   GG  V   D ++YTG LGTA+   +++Q T N  DL+LC++IV
Sbjct  49   SALDLKETVVRQTW-GLGGKRVE--DYSLYTGALGTAFLAFKAYQVTKNESDLKLCSEIV  105

Query  370  DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  549
              C SA+  + R ++F+CGR G+ ALGAV A + GD+   D YL  F E+     LP   
Sbjct  106  KACDSASTGS-RRVSFICGRAGVCALGAVVAKHTGDEMLLDLYLSKFKEIKLSSDLP---  161

Query  550  EEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
                     +LLYGRAGFLWA  F+ +H+G+
Sbjct  162  --------NELLYGRAGFLWACSFLNKHIGN  184



>ref|XP_010327070.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Solanum lycopersicum]
Length=340

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 104/189 (55%), Gaps = 19/189 (10%)
 Frame = +1

Query  76   ASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAV  255
            A  E    N +  N+S  + +   + P  IL ++ F +AA+ LK+ +V  TW   G +  
Sbjct  19   AIEEEQHPNPQGTNESLLKLL---STPYHIL-SKKFKRAALDLKETIVAETW---GLTRQ  71

Query  256  THMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGG  435
               D T+Y G LGTA+   +++Q T N  DL +C+ IV  C SA+  + R +TFLCGR G
Sbjct  72   QVPDFTLYCGTLGTAFLLFKAYQVTKNTNDLAVCSQIVKDCDSASRHS-RDVTFLCGRAG  130

Query  436  LYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAA  615
            + ALGAV A Y GD Q    Y+  F E+   K LP            +LLYGRAG+LWA 
Sbjct  131  VCALGAVVAKYMGDDQLVFYYVSQFKEIKLTKDLPD-----------ELLYGRAGYLWAF  179

Query  616  LFIKQHLGS  642
            LFI +H+G 
Sbjct  180  LFINKHIGQ  188



>gb|KHG20582.1| LanC-like protein 2 [Gossypium arboreum]
Length=409

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 103/187 (55%), Gaps = 19/187 (10%)
 Frame = +1

Query  82   PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  261
            PE+     ++  D+  + +  P +      ++ F + A+ LK+ V   TW   G ++   
Sbjct  15   PETTQHEQQEIGDTLIKLLSMPYSSL----SQHFKRTALDLKETVTLETW---GITSQKV  67

Query  262  MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  441
             D T+Y G LGTA+   +S+  T N  DL LC  IVD C SA+ ++ R  TFLCGR G+ 
Sbjct  68   SDFTLYCGTLGTAFLLFKSYLLTNNTNDLSLCLAIVDACNSASLSS-RDATFLCGRAGVC  126

Query  442  ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  621
            ALGAVAA Y G+Q+  + YL  F E+   + LP            +LLYGRAGFLWA LF
Sbjct  127  ALGAVAAKYAGNQESLNHYLTPFREIKLSRDLPD-----------ELLYGRAGFLWACLF  175

Query  622  IKQHLGS  642
            + +HLG 
Sbjct  176  LNKHLGE  182



>gb|KEH24852.1| G protein coupled receptor [Medicago truncatula]
Length=343

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 103/195 (53%), Gaps = 28/195 (14%)
 Frame = +1

Query  82   PESNGTNHED---------GNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWK  234
            PES  +  ++         G DS    +  P AP     ++   +AA+ LK+ +V  TW 
Sbjct  39   PESTPSTQQELQEAVTVTTGGDSLLNLLAMPHAPL----SQRLKRAALDLKETIVMETWG  94

Query  235  ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHIT  414
              G       D T+Y GLLGTA+  L+S+  T N  DL LC+ IV +C  AA  + R +T
Sbjct  95   LTGQRV---GDFTLYCGLLGTAFLLLKSYHVTCNTNDLALCSQIVKSC-DAASLSSRDVT  150

Query  415  FLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGR  594
            F+CGR G+ ALGAVAA + GD +    YL  F ++   K LP            +LLYG+
Sbjct  151  FICGRAGVCALGAVAAKHAGDDESLRYYLAQFQQIKLPKDLP-----------DELLYGK  199

Query  595  AGFLWAALFIKQHLG  639
             GFLWA LF+ +HLG
Sbjct  200  GGFLWACLFLNKHLG  214



>ref|XP_004244211.1| PREDICTED: lanC-like protein GCL2 [Solanum lycopersicum]
Length=408

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 91/153 (59%), Gaps = 15/153 (10%)
 Frame = +1

Query  187  QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  366
            + A  LK+ +V  TW  + G      D T+YTG LGTA+   +++Q T ++ DL LC+DI
Sbjct  48   RVAFDLKETIVKETWVCKRGRV---SDYTIYTGALGTAFLLFKAYQVTLDKNDLALCSDI  104

Query  367  VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  546
            +  C SA+  + R +TF+CG+ G+Y+LGAV A   GD+Q  D YL  F E+   K LP  
Sbjct  105  IKACDSASRGSGR-VTFICGQAGVYSLGAVVAKQSGDEQLCDHYLTKFKEIELPKDLP--  161

Query  547  PEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                      +LLYGRAGFLWA  F+ +++G E
Sbjct  162  ---------NELLYGRAGFLWACSFLNKNIGRE  185



>ref|XP_009357824.1| PREDICTED: lanC-like protein GCL2 [Pyrus x bretschneideri]
Length=414

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 98/186 (53%), Gaps = 16/186 (9%)
 Frame = +1

Query  79   SPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVT  258
            +P  +    E GNDS    +L    PS    +    +AA  L   ++  TW     +   
Sbjct  17   APTPSPPQAEHGNDS-LMNLLSTPCPSL---SHLLKRAASDLIQIILTETWAGATAAQSL  72

Query  259  HMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGL  438
            H D T+Y+G LGTA+   +S+Q TG+  D+ +CA IV  C SA+  +   +TF+CGR G+
Sbjct  73   H-DFTLYSGALGTAFLLFKSYQVTGDANDVTICAQIVKACDSASLGSRDVVTFMCGRAGV  131

Query  439  YALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAAL  618
             ALGAVAA +CGD      YL  F E+   + LP            +LLYG+ GFLWA L
Sbjct  132  CALGAVAAKHCGDSASVSYYLAQFREIKLSRNLPD-----------ELLYGKVGFLWACL  180

Query  619  FIKQHL  636
            F+ +HL
Sbjct  181  FLNKHL  186



>ref|XP_007212308.1| hypothetical protein PRUPE_ppa006721mg [Prunus persica]
 gb|EMJ13507.1| hypothetical protein PRUPE_ppa006721mg [Prunus persica]
Length=398

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 89/151 (59%), Gaps = 15/151 (10%)
 Frame = +1

Query  190  AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIV  369
            +A+ LK+ VV  TW   G S     D T+YTG+LGTA+   +++Q T N  DL+LC +IV
Sbjct  38   SALDLKETVVRQTW---GLSGKRVEDYTLYTGVLGTAFLAFKAYQVTKNENDLKLCCEIV  94

Query  370  DTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGP  549
              C SA+  + R ++F CGR G+ ALGAV A + GDQ   D YL  F E+     LP   
Sbjct  95   KACDSASRGSGR-VSFTCGRAGVCALGAVVAKHAGDQMLLDRYLSQFKEIKLPSDLP---  150

Query  550  EEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
                     +LLYGRAGFLWA  F+ +H+G+
Sbjct  151  --------NELLYGRAGFLWACSFLNKHIGN  173



>ref|XP_009400288.1| PREDICTED: lanC-like protein GCL2 [Musa acuminata subsp. malaccensis]
Length=403

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 90/156 (58%), Gaps = 16/156 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            A+ FL+AA+ LK++VV  TW  R G  V   D T+YTG LGTA+   +++Q T N  DL 
Sbjct  38   ADKFLRAALDLKEKVVKETW-LRNGRRVK--DFTLYTGALGTAFLLFKAYQVTNNLSDLS  94

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC +I+  C S +  + RH+TF+CGR G+ ALGAV A   GD    + YL  F E+    
Sbjct  95   LCGEIIRACDSVSAGS-RHVTFICGRAGVCALGAVVAKQAGDNVLLNHYLSSFREIKMRD  153

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
                 P E        LLYG+ G+LWA  F+ +H+G
Sbjct  154  V----PNE--------LLYGKVGYLWACSFLNKHIG  177



>gb|AES74528.2| G protein coupled receptor [Medicago truncatula]
Length=441

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 103/195 (53%), Gaps = 28/195 (14%)
 Frame = +1

Query  82   PESNGTNHED---------GNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWK  234
            PES  +  ++         G DS    +  P AP     ++   +AA+ LK+ +V  TW 
Sbjct  39   PESTPSTQQELQEAVTVTTGGDSLLNLLAMPHAPL----SQRLKRAALDLKETIVMETWG  94

Query  235  ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHIT  414
              G       D T+Y GLLGTA+  L+S+  T N  DL LC+ IV +C  AA  + R +T
Sbjct  95   LTGQRV---GDFTLYCGLLGTAFLLLKSYHVTCNTNDLALCSQIVKSC-DAASLSSRDVT  150

Query  415  FLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGR  594
            F+CGR G+ ALGAVAA + GD +    YL  F ++   K LP            +LLYG+
Sbjct  151  FICGRAGVCALGAVAAKHAGDDESLRYYLAQFQQIKLPKDLPD-----------ELLYGK  199

Query  595  AGFLWAALFIKQHLG  639
             GFLWA LF+ +HLG
Sbjct  200  GGFLWACLFLNKHLG  214



>emb|CDP05888.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 96/164 (59%), Gaps = 19/164 (12%)
 Frame = +1

Query  166  LPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  333
            LP +T  +     A+ LK  VV  TW ARG       D T+YTG LGTA+   +++Q T 
Sbjct  38   LPCKTLFERLKNEALDLKKTVVKETWGARGKRLT---DYTLYTGTLGTAFLLFKAYQITK  94

Query  334  NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  513
            +++DL L ++I+  C SAA  + R +TF+CG+ G+YALGAV A + GD +    +L  F 
Sbjct  95   DKKDLLLSSEIIKACDSAASGSGR-VTFICGQAGVYALGAVVAKHSGDDRLSGYFLTKFR  153

Query  514  EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            E+   K LP            +LLYGRAGFLWA+ F+ ++LG +
Sbjct  154  EIKLPKELP-----------NELLYGRAGFLWASTFLNRNLGKD  186



>ref|XP_004487685.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=416

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 92/164 (56%), Gaps = 19/164 (12%)
 Frame = +1

Query  166  LPAETF----LQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  333
            LP +T      QAA+  K  VV  TW + G       D T+YTG LGTAY   +++Q T 
Sbjct  44   LPYQTLSTNLQQAALHFKQSVVSETWGSSGNRV---KDYTLYTGALGTAYLLFKAYQVTK  100

Query  334  NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  513
            N  DL LC+ IV  C SA+  + R +TF+CGR G+ ALGAV A + GD +  D YL  F 
Sbjct  101  NVDDLNLCSKIVKACDSASKNSSR-VTFICGRAGVCALGAVIAKHAGDGRLLDYYLRQFK  159

Query  514  EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            E+     LP           Y++LYG+AG+LWA  F+ +H+G +
Sbjct  160  EIELPHDLP-----------YEVLYGKAGYLWACSFLNKHIGKD  192



>ref|XP_004248157.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Solanum lycopersicum]
Length=413

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 104/189 (55%), Gaps = 19/189 (10%)
 Frame = +1

Query  76   ASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAV  255
            A  E    N +  N+S  + +   + P  IL ++ F +AA+ LK+ +V  TW   G +  
Sbjct  19   AIEEEQHPNPQGTNESLLKLL---STPYHIL-SKKFKRAALDLKETIVAETW---GLTRQ  71

Query  256  THMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGG  435
               D T+Y G LGTA+   +++Q T N  DL +C+ IV  C SA+  + R +TFLCGR G
Sbjct  72   QVPDFTLYCGTLGTAFLLFKAYQVTKNTNDLAVCSQIVKDCDSASRHS-RDVTFLCGRAG  130

Query  436  LYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAA  615
            + ALGAV A Y GD Q    Y+  F E+   K LP            +LLYGRAG+LWA 
Sbjct  131  VCALGAVVAKYMGDDQLVFYYVSQFKEIKLTKDLPD-----------ELLYGRAGYLWAF  179

Query  616  LFIKQHLGS  642
            LFI +H+G 
Sbjct  180  LFINKHIGQ  188



>ref|XP_011098332.1| PREDICTED: lanC-like protein GCR2 [Sesamum indicum]
Length=403

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 96/158 (61%), Gaps = 20/158 (13%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            +E   +AA+ LKD VV               D T+YTG LGTA+   +++Q TG++ DL 
Sbjct  43   SEGLKKAALDLKDTVVK--------EXXXXGDYTLYTGALGTAFLLFKAYQITGDKNDLA  94

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC+DI++ C SA+  + R +TF+CGR G+YALGAVAA++ GD++    YL  F E+   K
Sbjct  95   LCSDIIEACDSASRGSGR-VTFICGRAGVYALGAVAAHHKGDKELCHQYLAQFKEIKLSK  153

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             LP            +LLYGRAGFLWA+ F+ +++G +
Sbjct  154  DLPD-----------ELLYGRAGFLWASSFLNKNIGKD  180



>gb|KEH38770.1| G protein coupled receptor [Medicago truncatula]
Length=417

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/165 (44%), Positives = 95/165 (58%), Gaps = 21/165 (13%)
 Frame = +1

Query  166  LPAETF---LQA-AVSLKDQVVDMTWKARGGSAVTHM-DPTVYTGLLGTAYTCLRSFQAT  330
            LP +T    LQA A+  K  VV  TW    GS V  + D T+YTG+LGTAY   +S+Q +
Sbjct  45   LPYQTLTSKLQATALHFKQSVVSETW----GSGVNRVKDYTLYTGVLGTAYLVFKSYQVS  100

Query  331  GNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYF  510
             N  DL LC  IV  C SA+  + R +TF+CGR G+ ALGAV A + GD++  D YL  F
Sbjct  101  KNVDDLNLCLKIVKACDSASANSSR-VTFICGRAGVCALGAVIAKHAGDERLLDYYLRQF  159

Query  511  FEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             E+     LP           Y+LLYGR G+LWA  F+ +H+G +
Sbjct  160  KEIELPCDLP-----------YELLYGRTGYLWACSFLNKHVGKD  193



>ref|XP_009588409.1| PREDICTED: lanC-like protein GCL2 [Nicotiana tomentosiformis]
Length=423

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 91/157 (58%), Gaps = 15/157 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            +E F +AA+ LK+ ++  TW   G +     D T+Y G LGTA+   +S+Q T N  DL 
Sbjct  47   SEKFKRAALDLKETILVETW---GLTRQQVPDFTLYNGTLGTAFLMFKSYQVTNNTNDLA  103

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            +C+ IV  C  A+  + R +TFLCGR G+ ALGAV A Y GD Q    Y+  F E+   K
Sbjct  104  VCSQIVKDCDFASRNS-RDVTFLCGRAGVCALGAVVAKYMGDDQLVLYYVTQFKEIKLTK  162

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
             LP            +LLYGRAGFLWA+LF+ +H+G 
Sbjct  163  DLPD-----------ELLYGRAGFLWASLFMNKHIGK  188



>ref|XP_006451926.1| hypothetical protein CICLE_v10008488mg [Citrus clementina]
 gb|ESR65166.1| hypothetical protein CICLE_v10008488mg [Citrus clementina]
Length=407

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 91/158 (58%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++T   +A++LK  VV+ TW   G       D T+YTG LGTAY   +++Q T N  +L+
Sbjct  41   SDTLKNSALALKQTVVNETWGVSGKRV---QDYTLYTGALGTAYLLFKAYQVTKNDNELK  97

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC DIV  C SA+  +   +TF+CGR G+ ALGAV A + GD++  D YL  F E+    
Sbjct  98   LCCDIVKACDSASRDS-GCVTFICGRAGVCALGAVLAKHAGDERLLDLYLTKFKEIKLPS  156

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             LP            +LLYGR GFLWA  F+ +H+G +
Sbjct  157  DLP-----------NELLYGRVGFLWACSFLNKHIGKD  183



>ref|XP_003540453.1| PREDICTED: lanC-like protein GCR2-like [Glycine max]
Length=405

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 95/163 (58%), Gaps = 19/163 (12%)
 Frame = +1

Query  166  LPAET----FLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  333
            LP +T    F  +A  LK  VV  TW +RG       D ++YTG LGTAY   +++Q T 
Sbjct  33   LPYQTLSTKFQASAFHLKQSVVRDTWGSRGKRV---KDYSLYTGALGTAYLLFKAYQVTK  89

Query  334  NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  513
            +  +L LC++IV  C SA+ A    +TF+CGR G+ ALGAV A + GD++  D YL  F 
Sbjct  90   DGNELNLCSEIVKACDSAS-ADSGKVTFICGRAGVCALGAVIAKHTGDERLLDYYLRQFK  148

Query  514  EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
            E+A  +  P           Y+LLYGRAG+LWA  F+ +H+G+
Sbjct  149  EIAIPRESP-----------YELLYGRAGYLWACSFLNKHIGN  180



>ref|XP_008809400.1| PREDICTED: lanC-like protein GCL2 [Phoenix dactylifera]
Length=404

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 90/157 (57%), Gaps = 15/157 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            A+  L+AA+ LK++VV  TW   G  A    D T+YTG LGTA+   +++Q T NR DL 
Sbjct  38   ADKLLRAALDLKEKVVKETWVRFGRRA---KDFTLYTGALGTAFLLFKAYQVTNNRGDLS  94

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC++I+  C   +     H+TF+CGR G+ ALGAV A + GD+   + YL  F E+    
Sbjct  95   LCSEIIRACDVGSQGD-PHVTFICGRAGVCALGAVVAKHAGDEALLNHYLSSFREIRMPG  153

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
             +P            +LLYGR G+LWA  F+ +H+G 
Sbjct  154  KVP-----------NELLYGRVGYLWACAFLNKHIGE  179



>gb|KHN28043.1| LanC-like protein 2 [Glycine soja]
Length=405

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 95/163 (58%), Gaps = 19/163 (12%)
 Frame = +1

Query  166  LPAET----FLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  333
            LP +T    F  +A  LK  VV  TW +RG       D ++YTG LGTAY   +++Q T 
Sbjct  33   LPYQTLSTKFQASAFHLKQSVVRDTWGSRGKRV---KDYSLYTGALGTAYLLFKAYQVTK  89

Query  334  NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  513
            +  +L LC++IV  C SA+ A    +TF+CGR G+ ALGAV A + GD++  D YL  F 
Sbjct  90   DGNELNLCSEIVKACDSAS-ADSGKVTFICGRAGVCALGAVIAKHTGDERLLDYYLRQFK  148

Query  514  EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
            E+A  +  P           Y+LLYGRAG+LWA  F+ +H+G+
Sbjct  149  EIAIPRESP-----------YELLYGRAGYLWACSFLNKHIGN  180



>ref|XP_009766748.1| PREDICTED: lanC-like protein GCL2 [Nicotiana sylvestris]
Length=420

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 90/157 (57%), Gaps = 15/157 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            +E F + A+ LK+ +V  +W   G +     D T+Y G LGTA+   +S+Q T N  DL 
Sbjct  47   SEKFKRTALDLKETIVVESW---GLTRQQVPDFTLYCGTLGTAFLLFKSYQVTNNTNDLA  103

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            +C+ IV  C SA+  + R +TFLCGR G+ ALGAV A Y GD Q    Y+  F E+   K
Sbjct  104  VCSQIVKDCDSASRNS-RDVTFLCGRAGVCALGAVVAKYMGDDQLVLYYVTQFKEIKLTK  162

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
             LP            +LLYGRAGFLWA LF+ +H+G 
Sbjct  163  DLPD-----------ELLYGRAGFLWACLFMNKHIGK  188



>ref|XP_007149603.1| hypothetical protein PHAVU_005G083500g [Phaseolus vulgaris]
 gb|ESW21597.1| hypothetical protein PHAVU_005G083500g [Phaseolus vulgaris]
Length=427

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 94/168 (56%), Gaps = 16/168 (10%)
 Frame = +1

Query  139  LDPTAP-SFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLR  315
            L  + P +FIL          S+  QVV  TW +RG       D T+YTG LGTAY   +
Sbjct  49   LKQSVPKNFILNLWVSFNWLSSILVQVVRETWGSRGKRV---KDYTLYTGALGTAYLLFK  105

Query  316  SFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDS  495
            ++Q T +  DL LC++IV+ C SA+  + R +TFLCGR G+ ALGAV A + GD +  D 
Sbjct  106  AYQVTKDGNDLNLCSEIVEACHSASADSGR-VTFLCGRAGVCALGAVVAKHTGDDRLLDY  164

Query  496  YLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            YL  F E+   +  P           Y+LLYGR G+LWA  F+ +H+G
Sbjct  165  YLRQFKEIVIPRDSP-----------YELLYGRTGYLWACSFLNKHIG  201



>ref|XP_010918434.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Elaeis guineensis]
Length=404

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 90/157 (57%), Gaps = 15/157 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            A+  L+AA+ LK++VV  TW    G A    D T+YTG LGTA+   +++Q T NR DL 
Sbjct  38   ADKLLRAALDLKEKVVKETWVRLRGRA---KDFTLYTGALGTAFLLFKAYQVTNNRGDLS  94

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC++I+  C  A+     H+TF+CGR G+ ALGAV A + GD+   + YL  F  +    
Sbjct  95   LCSEIIRACDVASQGD-PHVTFICGRAGVCALGAVVAKHAGDEALLNHYLSSFRGIRMRG  153

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
             +P            +LLYGR G+LWA  F+ +H+G 
Sbjct  154  KVP-----------NELLYGRVGYLWACCFLNKHIGE  179



>ref|XP_009400289.1| PREDICTED: lanC-like protein GCL2 [Musa acuminata subsp. malaccensis]
Length=404

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 88/157 (56%), Gaps = 15/157 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            A+  L+AA+ LKD+VV  TW   G  A    D T+YTG  GTA+   +S+Q T NR DL 
Sbjct  38   ADKLLKAALDLKDKVVKETWVRSGRRA---KDYTLYTGAFGTAFLLFKSYQVTSNRSDLG  94

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC +IV  C  A+  +   +TF+CGR G+ ALGAV A   GD+     YL  F E+    
Sbjct  95   LCNEIVRACDQASQGS-PFVTFICGRAGVCALGAVVAKEAGDEDLLRHYLRSFREIKMPG  153

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
             +P            +LLYGRAG+LWA  F+ +H+G 
Sbjct  154  DVP-----------NELLYGRAGYLWACSFLNKHIGE  179



>ref|XP_007215460.1| hypothetical protein PRUPE_ppa006408mg [Prunus persica]
 gb|EMJ16659.1| hypothetical protein PRUPE_ppa006408mg [Prunus persica]
Length=413

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 89/156 (57%), Gaps = 15/156 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            +E F + A+ LK+ ++  T  A G       D T+Y+G LGTA    +S+Q T N  DL 
Sbjct  46   SERFKRTALDLKETILTETLGATGQHV---HDFTLYSGALGTALLLFKSYQVTSNTNDLS  102

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC+ I+  C SA+  + R +TF+CGR G+ ALGAVAA + GD    D YL  F E+   +
Sbjct  103  LCSQIIKACDSASLGS-RDVTFICGRAGVCALGAVAAKHLGDSASLDYYLTQFREIKLSR  161

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
             LP            +LLYG+ GFLWA LF+ +HLG
Sbjct  162  NLPD-----------ELLYGKVGFLWACLFLNKHLG  186



>ref|XP_010686440.1| PREDICTED: lanC-like protein GCL2 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 89/151 (59%), Gaps = 15/151 (10%)
 Frame = +1

Query  187  QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  366
            + A+ +K+ VV  TW   G + V   D T+Y G LGTA+   +S++ T N  DL LC +I
Sbjct  48   RQALDIKETVVVETWGRSGQNVV---DFTLYVGDLGTAFLLFKSYKVTNNIHDLTLCHEI  104

Query  367  VDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVG  546
            V  C  A+  + R +TF+CGR G+ ALGAV A + G++Q  + YL  F ++   K LP  
Sbjct  105  VKACDHASSHS-RDVTFICGRAGVCALGAVVAKHMGNEQLLNYYLTQFKQINLPKDLPD-  162

Query  547  PEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
                      +LLYGRAGFLWA LF+ +HLG
Sbjct  163  ----------ELLYGRAGFLWACLFVNKHLG  183



>gb|EMS68258.1| LanC-like protein 2 [Triticum urartu]
Length=436

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 84/145 (58%), Gaps = 15/145 (10%)
 Frame = +1

Query  211  QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            QVV  TW   GG      D T+YTG LGTA    +SFQ TG+R+DL L +DIV  C  AA
Sbjct  83   QVVQETWTRTGGQVT---DYTLYTGALGTALLLFKSFQVTGDRRDLNLASDIVQAC-DAA  138

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
               +  +TF+CGR G+ ALGAV A +C DQ    ++L  F E+   + +P          
Sbjct  139  SLGLPFLTFICGRAGVCALGAVIAKHCNDQLMETNFLSSFDEIIITEKVP----------  188

Query  571  SYDLLYGRAGFLWAALFIKQHLGSE  645
              +LLYGRAG+LWA LF+ +HL  +
Sbjct  189  -NELLYGRAGYLWACLFLNEHLSDK  212



>ref|XP_010675629.1| PREDICTED: lanC-like protein GCR2 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 93/157 (59%), Gaps = 15/157 (10%)
 Frame = +1

Query  175  ETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRL  354
            E    +A+ LKD VV  TW A+ G  V   D ++YTG LGTA+   +++Q T N+ DL L
Sbjct  44   EILKNSALQLKDAVVKETW-AKSGKRVQ--DYSLYTGALGTAFLLFKAYQVTNNKGDLAL  100

Query  355  CADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKA  534
             + I+  C SA+  + ++ITF+CGR G+ ALGAV A + GD+   + Y+  F ++     
Sbjct  101  SSQIIQACDSASRGS-KNITFICGRSGVCALGAVVAKHAGDENLLNHYVTEFKQIKLPAD  159

Query  535  LPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            LP           Y+LLYG+ GFLW+  F+K+H+G +
Sbjct  160  LP-----------YELLYGKTGFLWSCSFLKKHIGED  185



>ref|XP_007132705.1| hypothetical protein PHAVU_011G117700g [Phaseolus vulgaris]
 gb|ESW04699.1| hypothetical protein PHAVU_011G117700g [Phaseolus vulgaris]
Length=414

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 97/174 (56%), Gaps = 19/174 (11%)
 Frame = +1

Query  118  DSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGT  297
            DS  + +  P AP     +E   +AA+ LK+ +V  TW   G S     D ++Y G+LGT
Sbjct  33   DSLPKLLAMPHAPL----SERLKRAALDLKETIVIETW---GVSWRKDGDFSLYCGVLGT  85

Query  298  AYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGD  477
            A+  L+S++ T N  DL LC+ IV  C  AA    R +TF+CGR G+ +LGAVAA + GD
Sbjct  86   AFLLLKSYEVTRNGNDLSLCSQIVKAC-DAASVRSRDVTFICGRAGVCSLGAVAAKHAGD  144

Query  478  QQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
             +    Y+  F ++   K LP            +LLYGR GFLWA LF+ +HLG
Sbjct  145  DESLRYYMAQFEKIKLSKDLPD-----------ELLYGRVGFLWACLFLNKHLG  187



>ref|XP_009343572.1| PREDICTED: lanC-like protein GCR2 [Pyrus x bretschneideri]
Length=409

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 92/157 (59%), Gaps = 15/157 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++    +A+ LK+ VV  T    GG  V   D ++YTG LGTA+   +++Q T N  DL+
Sbjct  43   SDILKSSALDLKETVVRQTC-GLGGKRVE--DYSLYTGALGTAFLAFKAYQVTKNESDLK  99

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC++IV  C SA+  + R ++F+CGR G+ ALGAV A + GD+   D Y+  F E+    
Sbjct  100  LCSEIVKACDSASTGS-RRVSFICGRAGVCALGAVVAKHTGDKMLLDRYISKFKEIKLSS  158

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
             LP            +LLYGRAGFLWA  F+ +H+G+
Sbjct  159  DLP-----------NELLYGRAGFLWACSFLNKHIGN  184



>ref|XP_006661914.1| PREDICTED: lanC-like protein GCR2-like [Oryza brachyantha]
Length=399

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 90/158 (57%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            A+    AA+ +KD+VV+ TW  R    VT  D T+YTG LGTA    +SFQ TG+R DL 
Sbjct  33   ADRLRAAALRIKDEVVEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGDRADLS  89

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            L  DIV  C  AA   +  +TF+CGR G+ ALGA+ A +  DQ     YL  F E+   +
Sbjct  90   LAGDIVKEC-DAASRGLPFLTFICGRAGVCALGAMIAKHSDDQLLVTHYLSKFDEILVTE  148

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             +P            +LLYGRAG+LWA LF+  HLG +
Sbjct  149  NVP-----------NELLYGRAGYLWACLFLNTHLGEK  175



>ref|XP_011045509.1| PREDICTED: lanC-like protein GCL2 [Populus euphratica]
Length=409

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 93/156 (60%), Gaps = 15/156 (10%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ F ++ + LK+ +V  TW    G  V H D T+Y+G LGTA    +S+Q T N  DL 
Sbjct  42   SKQFQRSGLDLKETIVMETWGL--GGQVVH-DFTLYSGNLGTALLLYKSYQVTSNENDLF  98

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC +IV  C SA+ A+ R +TF+CGR G+ ALGAVAA +  D+  +  YL    E+   K
Sbjct  99   LCLEIVKACDSASRAS-RDVTFICGRAGVCALGAVAAKHANDEALQSYYLSQLGEI---K  154

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
             L   P+E        LLYGR+GFLWA LF+ +H+G
Sbjct  155  LLRNHPDE--------LLYGRSGFLWACLFLNKHMG  182



>gb|EAZ16566.1| hypothetical protein OsJ_32039 [Oryza sativa Japonica Group]
Length=461

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 83/145 (57%), Gaps = 15/145 (10%)
 Frame = +1

Query  211  QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            QV++ TW  R    VT  D T+YTG LGTA    +SFQ TGNR DL L  DIV  C  AA
Sbjct  108  QVMEETW-TRARRQVT--DYTLYTGALGTALLLFKSFQVTGNRADLALAGDIVKEC-DAA  163

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
               +  +TF+CGR G+ ALGAV A +C DQ     YL  F E+   + +P          
Sbjct  164  SRGLPFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEKVP----------  213

Query  571  SYDLLYGRAGFLWAALFIKQHLGSE  645
              +LLYGRAG+LWA LF+  HLG +
Sbjct  214  -NELLYGRAGYLWACLFLNTHLGEK  237



>ref|XP_004514463.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=446

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 102/192 (53%), Gaps = 23/192 (12%)
 Frame = +1

Query  76   ASPESNGTNHE----DGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARG  243
            A+P +    HE       DS  + +  P AP     +E   +AA+ LK  +V  TW   G
Sbjct  47   ATPSTQHELHEAITVTTGDSLHKLLAMPHAPL----SERLKRAALDLKQTIVMETW---G  99

Query  244  GSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLC  423
             +     D T+Y GLLGTA+   +S+  T N  DL LC+ I+  C +A+  + R ++F+C
Sbjct  100  FTEQRVGDFTLYCGLLGTAFLLFKSYNVTQNANDLTLCSQIIKACDTASLYS-REVSFIC  158

Query  424  GRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGF  603
            GR G+ ALGAVAA + G+ +    YL  F ++   K LP            +LLYGR GF
Sbjct  159  GRAGVCALGAVAAKHAGNDESLRYYLAQFQKIKLPKDLPD-----------ELLYGRVGF  207

Query  604  LWAALFIKQHLG  639
            LWA LF+ +HLG
Sbjct  208  LWACLFLNKHLG  219



>ref|XP_010661310.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
Length=270

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/198 (36%), Positives = 103/198 (52%), Gaps = 23/198 (12%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            M S +V    P    T  + G DS  + +  P    F   ++   + A+ LK+  V  TW
Sbjct  1    MDSELVEETPPTQEETPAQGGKDSLIKLLSIP----FSALSQRLKRTALDLKETAVIETW  56

Query  232  KARGGSAVTHMDPTVYT--GLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIR  405
               G       D T+Y+  G+LGT Y  L ++  T N+ DL LC++IV  C S +  + +
Sbjct  57   GLIGQHV---RDFTLYSESGVLGTTY--LLAYLVTANKTDLGLCSEIVKACDSTSFGS-K  110

Query  406  HITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLL  585
             ITF+CGR G+ ALGAV   Y GD++  + YL  F E+   ++LP            +LL
Sbjct  111  DITFICGRAGVCALGAVVVKYSGDERLMNYYLSRFNEIKLPRSLP-----------DELL  159

Query  586  YGRAGFLWAALFIKQHLG  639
            YGR GFLWA LF+ +H+G
Sbjct  160  YGRVGFLWACLFLNKHIG  177



>gb|EMT26581.1| LanC-like protein 2 [Aegilops tauschii]
Length=579

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 84/145 (58%), Gaps = 15/145 (10%)
 Frame = +1

Query  211  QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            QVV  TW   GG      D T+YTG LGTA    +SFQ TG+R+DL L ++IV  C  AA
Sbjct  226  QVVQETWTRTGGHVT---DYTLYTGALGTALLLFKSFQVTGDRRDLNLASEIVQAC-DAA  281

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
               +  +TF+CGR G+ ALGAV A +C DQ    ++L  F E+   + +P          
Sbjct  282  SLGLPFLTFICGRAGVCALGAVIAKHCNDQLMETNFLSSFDEIIITEKVP----------  331

Query  571  SYDLLYGRAGFLWAALFIKQHLGSE  645
              +LLYGRAG+LWA LF+ +HL  +
Sbjct  332  -NELLYGRAGYLWACLFLNEHLSDK  355



>ref|XP_006409014.1| hypothetical protein EUTSA_v10002001mg [Eutrema salsugineum]
 gb|ESQ50467.1| hypothetical protein EUTSA_v10002001mg [Eutrema salsugineum]
Length=405

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 99/183 (54%), Gaps = 19/183 (10%)
 Frame = +1

Query  97   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  276
            T  E G DS    + +  A  +   ++   ++A+ LK+ VV  TW   G S     D T+
Sbjct  17   TESEAGGDS----LTNLLAMPYSSLSQLLKRSALDLKETVVMETW---GFSGQLVQDFTL  69

Query  277  YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAV  456
            Y+G LG A+   R++Q TGN  DL LC  IV  C  AA A+   +TF+CGR G++ LGA 
Sbjct  70   YSGALGAAFLLFRAYQVTGNANDLSLCLQIVKAC-DAASASSGDVTFICGRTGVFGLGAA  128

Query  457  AANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHL  636
            AA   GDQ+  + YL  F ++     +P            +LLYGR G+LWA LF+ +++
Sbjct  129  AAKRSGDQELLNYYLAQFRQIRLSSEIP-----------NELLYGRVGYLWACLFVNKYV  177

Query  637  GSE  645
            G+E
Sbjct  178  GAE  180



>gb|KFK43530.1| hypothetical protein AALP_AA1G138200 [Arabis alpina]
Length=290

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 81/146 (55%), Gaps = 14/146 (10%)
 Frame = +1

Query  211  QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            +VV  TW  R G  V   D  +YTG+LGTAY   +S+  T N++DL+LC +IV  C   A
Sbjct  29   KVVLETWD-RCGKHVR--DYNMYTGVLGTAYLLFKSYLVTSNQEDLKLCLEIVKACDVVA  85

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
                  +TF CG  G+ ALGAV A   GD Q +D YL  F E+     LP          
Sbjct  86   SKDSLRVTFFCGYAGVCALGAVVAKCIGDDQLQDRYLTRFREIRLPIDLP----------  135

Query  571  SYDLLYGRAGFLWAALFIKQHLGSEA  648
             Y+LLYGR G+LW  LF+ +H+G ++
Sbjct  136  -YELLYGRVGYLWGCLFLNKHIGKDS  160



>ref|XP_004244212.1| PREDICTED: lanC-like protein GCR2 [Solanum lycopersicum]
Length=407

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 90/163 (55%), Gaps = 19/163 (12%)
 Frame = +1

Query  166  LPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  333
            LP +T  Q     A++LKD+VV  TW A+G       D T+YTG LGTAY   +S+Q T 
Sbjct  33   LPYDTITQRLKLDAINLKDEVVRETWSAKGRHV---KDYTLYTGTLGTAYILFKSYQITR  89

Query  334  NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  513
            N  D+ LC+DI+  C +A        TF+ G  G+YALGAVAA   GD Q    +L  F 
Sbjct  90   NIDDIALCSDIIQACDTACNG-FGPPTFIGGHAGIYALGAVAAKNNGDDQLCQIFLTKF-  147

Query  514  EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
               +E  LP+        +  DL YGRAG+LWA  F+ +HLG 
Sbjct  148  ---KEMKLPI-------DLGDDLFYGRAGYLWACSFLNKHLGK  180



>ref|XP_002884221.1| hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60480.1| hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/181 (38%), Positives = 99/181 (55%), Gaps = 15/181 (8%)
 Frame = +1

Query  103  HEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYT  282
             E  ++SG  ++ +  A  +   ++   ++A+ LK+ VV  TW   G S  T  D T+Y+
Sbjct  15   KEKESESGGDSLRNLLAMPYSSLSQQLKRSALDLKETVVMETW---GFSGQTVEDFTLYS  71

Query  283  GLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAA  462
            G LG A+   R++Q TGN  DL LC +IV  C  AA A+   +TFLCGR G+  LGA AA
Sbjct  72   GTLGAAFLLFRAYQVTGNVNDLSLCLEIVKAC-DAASASSGDVTFLCGRAGVCGLGAAAA  130

Query  463  NYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
               G+++  + YL  F  +     LP            +LLYGR G+LWA LFI +++G 
Sbjct  131  KLSGEEELLNYYLAQFRLIRLSSDLP-----------NELLYGRVGYLWACLFINKYIGK  179

Query  643  E  645
            E
Sbjct  180  E  180



>ref|NP_850003.1| protein GCR2-LIKE 2 [Arabidopsis thaliana]
 sp|Q8VZQ6.1|GCL2_ARATH RecName: Full=LanC-like protein GCL2; AltName: Full=G protein-coupled 
receptor 2-like protein 2; Short=Protein GCR2-like 
2 [Arabidopsis thaliana]
 gb|AAL36290.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20120.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07068.1| protein GCR2-LIKE 2 [Arabidopsis thaliana]
Length=405

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 99/181 (55%), Gaps = 15/181 (8%)
 Frame = +1

Query  103  HEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYT  282
             E  + SG  T+ +  A  +   ++   ++A+ LK+ VV  TW   G S  T  D T+Y+
Sbjct  15   KEKESVSGGDTLRNLLAMPYSSLSQQLKRSALDLKETVVIETW---GFSGQTVEDFTLYS  71

Query  283  GLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAA  462
            G LG A+   R++Q TGN  DL LC +IV  C +A+ A+   +TFLCGR G+  LGAVAA
Sbjct  72   GTLGAAFLLFRAYQVTGNANDLSLCLEIVKACDTAS-ASSGDVTFLCGRAGVCGLGAVAA  130

Query  463  NYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
               G++   + YL  F  +     LP            +LLYGR G+LWA LFI +++G 
Sbjct  131  KLSGEEDLLNYYLGQFRLIRLSSDLP-----------NELLYGRVGYLWACLFINKYIGK  179

Query  643  E  645
            E
Sbjct  180  E  180



>gb|ABQ14360.1| abscisic acid ABA receptor [Populus trichocarpa]
Length=443

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 86/150 (57%), Gaps = 20/150 (13%)
 Frame = +1

Query  211  QVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA  390
            +VV  TW   G S     D ++YTG LGTAY   +++Q T N+ DL LC+DI+  C S +
Sbjct  86   EVVRETW---GMSGKRVKDYSLYTGALGTAYLLFKAYQVTKNQNDLNLCSDIIKACDSVS  142

Query  391  PATIRHITFL-----CGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEE  555
              + R +TF+     CGR G+ ALGAVAA + GD +  D YL  F E+     LP     
Sbjct  143  RDSGR-VTFICGLTGCGRAGVCALGAVAAKHAGDGRLLDHYLAQFKEIKLPSDLP-----  196

Query  556  GGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                  Y+LLYGRAGFLWA  F+ +H+G E
Sbjct  197  ------YELLYGRAGFLWACSFLNKHIGKE  220



>ref|XP_008338576.1| PREDICTED: uncharacterized protein LOC103401641, partial [Malus 
domestica]
Length=183

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 72/112 (64%), Gaps = 8/112 (7%)
 Frame = +1

Query  52   MSSSIVHLASPESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTW  231
            MS  +    SPE     H+D N+     V DP AP+    + TFL+AAV+LKDQVV  TW
Sbjct  1    MSFGVEFAPSPE----EHDDANNERLDLV-DPAAPTLSPSSGTFLRAAVTLKDQVVQATW  55

Query  232  KA---RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTC  378
            +     G      +DPTVYTGLLGTA+TCLRS++A GNRQDL LCA+IVD C
Sbjct  56   EGGHDSGTPTGMVLDPTVYTGLLGTAFTCLRSYEAAGNRQDLVLCAEIVDKC  107



>ref|XP_006348233.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=407

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 93/172 (54%), Gaps = 21/172 (12%)
 Frame = +1

Query  142  DPTAPSFILPAETFLQA----AVSLKDQVVDMTWKARGGSAVTHM-DPTVYTGLLGTAYT  306
            D  +    LP +T  Q     A +LKD+VV  TW A+G     H+ D  +YTG LGTAY 
Sbjct  25   DSLSKLLSLPYDTISQRLKLDATNLKDEVVRETWAAKG----RHVNDYRLYTGTLGTAYL  80

Query  307  CLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQK  486
              +S+Q T N  DL LC+DI+  C +A   +    TF+ G  G+YALGAVAA   GD Q 
Sbjct  81   LFKSYQITQNNDDLVLCSDIIQACDAACNGS-GPPTFIGGHAGIYALGAVAAKNNGDDQL  139

Query  487  RDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
               +L  F E+     LP+        +  DL YGRAG+LWA  F+ +HLG 
Sbjct  140  CQQFLTKFKEI----KLPI-------DLGDDLFYGRAGYLWACSFLNKHLGK  180



>ref|XP_010241996.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nelumbo nucifera]
Length=436

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 104/209 (50%), Gaps = 41/209 (20%)
 Frame = +1

Query  97   TNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTV  276
            TN E G +    ++L   +  +   A    + A+ LK+ +V  TW   G S     D T+
Sbjct  17   TNDETGAEGIEDSLLKLLSLPYPTLAAKLKRTALDLKETIVTNTW---GFSGRCVSDFTL  73

Query  277  YTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATI------------------  402
            YTG LGTA+   +++QAT N+ DL LCA+IV  C SA+  +                   
Sbjct  74   YTGSLGTAFLLFKAYQATKNKNDLNLCAEIVKACDSASSGSGFSLSLSLSLHSFSLTVLI  133

Query  403  ---------RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEE  555
                       +TF+CGR G+ +LGA+AA + G++Q  + YL  F E+   K +P     
Sbjct  134  YGFMRLLYSSDVTFICGRAGVCSLGAIAAKHAGNEQLLNHYLTQFKEIKLPKNVP-----  188

Query  556  GGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
                   +LLYGRAGFLWA LFI +H+G 
Sbjct  189  ------NELLYGRAGFLWACLFINKHIGK  211



>gb|EYU26156.1| hypothetical protein MIMGU_mgv1a007017mg [Erythranthe guttata]
Length=422

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 90/155 (58%), Gaps = 14/155 (9%)
 Frame = +1

Query  181  FLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCA  360
            F +AA+ LK  +V  TW    G  V   D T+Y+G LGTA+   + +Q T N+ DL L +
Sbjct  57   FQRAALDLKQTIVVKTWGGFTGQHVE--DFTLYSGTLGTAFLLFKFYQVTHNKNDLTLSS  114

Query  361  DIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALP  540
            +IV  C SA+  + R ++F+CGR G+ ++GAV A + GD +    YL+ F ++   +  P
Sbjct  115  EIVKACDSASVHS-RDVSFMCGRAGVCSIGAVVAKHMGDDKLVHYYLNQFKKIRLSEDHP  173

Query  541  VGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                        +LLYGRAG+LWA LF+ +H G+E
Sbjct  174  D-----------ELLYGRAGYLWACLFLNKHFGNE  197



>emb|CDP14758.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/177 (40%), Positives = 97/177 (55%), Gaps = 21/177 (12%)
 Frame = +1

Query  115  NDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDM--TWKARGGSAVTHMDPTVYTGL  288
             +S FR +  P    +   +E   +AA+ LK+ +V +  TW   G       D T+Y+G 
Sbjct  37   EESLFRLLATP----YTTLSEKLKRAALDLKETIVVVVDTWGLTGQKVD---DFTLYSGA  89

Query  289  LGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANY  468
            LGTA    +SF  T N  DL LC+ IV+ C SA+  +   +TF+CGR G+ ALGAV A Y
Sbjct  90   LGTALLLFKSFLVTRNGNDLILCSQIVNACDSASLHST-DVTFICGRAGVCALGAVVAKY  148

Query  469  CGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
             G  Q    YL++F E+   + LP            +LLYGRAG+LWA LFI +H+G
Sbjct  149  LGYDQLLHYYLNHFKEIRLTRDLPD-----------ELLYGRAGYLWACLFINEHIG  194



>gb|KFK40450.1| hypothetical protein AALP_AA3G374700 [Arabis alpina]
Length=407

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/199 (36%), Positives = 100/199 (50%), Gaps = 20/199 (10%)
 Frame = +1

Query  52   MSSSIVHLASPE-SNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMT  228
            M+    H   P+    T  E G DS    +  P +      +    ++A+ LK+ VV  T
Sbjct  3    MADRFFHNVMPDFVRETETEAGGDSLMHLLAMPYSS----LSHQLKRSALDLKETVVIET  58

Query  229  WKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH  408
            W   G +     D T+Y+G LG A+   RSFQ T N  DL LC  IV  C  AA A+ R 
Sbjct  59   W---GFTGQLVQDFTLYSGTLGVAFLLFRSFQVTKNANDLSLCLQIVKAC-DAASASSRD  114

Query  409  ITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLY  588
            +TF+CGR G+ +LGA AA   G++   + YL  F ++     LP            +LLY
Sbjct  115  VTFICGRAGVCSLGAAAAKLSGEEDLLNYYLAQFRQIRLASDLP-----------NELLY  163

Query  589  GRAGFLWAALFIKQHLGSE  645
            GR G+LWA LFI +++ +E
Sbjct  164  GRVGYLWACLFINKYVAAE  182



>ref|NP_001174024.1| Os04g0529600 [Oryza sativa Japonica Group]
 emb|CAD41202.1| OSJNBa0074L08.13 [Oryza sativa Japonica Group]
 emb|CAE03855.1| OSJNBa0081C01.1 [Oryza sativa Japonica Group]
 gb|EAY94933.1| hypothetical protein OsI_16739 [Oryza sativa Indica Group]
 gb|EAZ31418.1| hypothetical protein OsJ_15552 [Oryza sativa Japonica Group]
 dbj|BAH92752.1| Os04g0529600 [Oryza sativa Japonica Group]
Length=422

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 89/162 (55%), Gaps = 20/162 (12%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARG------GSAVTHMDPTVYTGLLGTAYTCLRSFQATG  333
            A+ FL AA+ LK +VV  TW  R       G AV   D T+YTG LGTA    R++  TG
Sbjct  50   ADRFLHAALHLKQKVVHETWDKRRRAAAAAGEAVG--DFTLYTGALGTALLLFRAYLVTG  107

Query  334  NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  513
            +R DL  CA+IV  C  AA       TF+CGR G+ ALGAV A + GD+     YL  F 
Sbjct  108  DRADLATCAEIVAAC-DAASMGAEIATFICGRAGVCALGAVVAKHAGDEAGVAHYLSAFK  166

Query  514  EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            E+   K     P+E        LLYGRAG+LWA  F+ +HLG
Sbjct  167  EI---KIHSKSPDE--------LLYGRAGYLWACTFLNKHLG  197



>emb|CAJ86377.1| OSIGBa0155K17.4 [Oryza sativa Indica Group]
Length=422

 Score =   107 bits (268),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 89/162 (55%), Gaps = 20/162 (12%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWK------ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  333
            A+ FL AA+ LK +VV  TW       A  G AV   D T+YTG LGTA    R++  TG
Sbjct  50   ADRFLHAALHLKQKVVHETWDKRRRAAAAAGEAVG--DFTLYTGALGTALLLFRAYLVTG  107

Query  334  NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFF  513
            +R DL  CA+IV  C  AA       TF+CGR G+ ALGAV A + GD+     YL  F 
Sbjct  108  DRADLATCAEIVAAC-DAASMGAEIATFICGRAGVCALGAVVAKHAGDEAGVAHYLSAFK  166

Query  514  EVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
            E+   K     P+E        LLYGRAG+LWA  F+ +HLG
Sbjct  167  EI---KIHSKSPDE--------LLYGRAGYLWACTFLNKHLG  197



>ref|XP_004291663.1| PREDICTED: lanC-like protein GCR2 [Fragaria vesca subsp. vesca]
Length=403

 Score =   107 bits (267),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 87/157 (55%), Gaps = 18/157 (11%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++    +A+ LK  VV  TW  R G      D ++YTG LGTA    +++Q T N  DL+
Sbjct  40   SDMLKSSALDLKQTVVMQTWGKRVG------DYSLYTGALGTACLAFKAYQVTKNLSDLK  93

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC DIV  C  A+  +  H++F+CGR G+ A GAVAA + GD    D YL  F E+    
Sbjct  94   LCCDIVKACDIASRDS-GHVSFICGRAGVCAFGAVAAKHAGDGMLLDHYLSQFKEIKLYS  152

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGS  642
             LP            +LLYGRAG+LWA  F+ +++G+
Sbjct  153  DLP-----------NELLYGRAGYLWACSFLNKNIGN  178



>ref|XP_006299729.1| hypothetical protein CARUB_v10015922mg [Capsella rubella]
 gb|EOA32627.1| hypothetical protein CARUB_v10015922mg [Capsella rubella]
Length=403

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 92/172 (53%), Gaps = 19/172 (11%)
 Frame = +1

Query  142  DPTAPSFILPAETFLQ----AAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTC  309
            D  +   ++P  +  Q    +A+ LK+ VV  TW   G S  T  D T+Y+G LG A+  
Sbjct  22   DSLSNLLVMPYSSLSQHLKRSALDLKETVVMNTW---GFSGQTVEDFTLYSGTLGAAFLL  78

Query  310  LRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKR  489
             R++Q T N  DL LC +IV  C  AA A+   +TFLCGR G+  LGA AA   G+++  
Sbjct  79   FRAYQVTRNANDLSLCLEIVKAC-DAASASSGDVTFLCGRAGVCGLGAAAAKLSGEEELL  137

Query  490  DSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            + YL  F  +     LP            +LLYGR G+LWA LFI +++G E
Sbjct  138  NYYLAQFRLIRLSSDLP-----------NELLYGRIGYLWACLFINKYVGKE  178



>ref|XP_003618310.1| LanC-like protein [Medicago truncatula]
Length=469

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/216 (35%), Positives = 106/216 (49%), Gaps = 42/216 (19%)
 Frame = +1

Query  82   PESNGTNHED---------GNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWK  234
            PES  +  ++         G DS    +  P AP     ++   +AA+ LK+ +V  TW 
Sbjct  39   PESTPSTQQELQEAVTVTTGGDSLLNLLAMPHAPL----SQRLKRAALDLKETIVMETWG  94

Query  235  ARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHIT  414
              G       D T+Y GLLGTA+  L+S+  T N  DL LC+ IV +C  AA  + R +T
Sbjct  95   LTGQRV---GDFTLYCGLLGTAFLLLKSYHVTCNTNDLALCSQIVKSC-DAASLSSRDVT  150

Query  415  FLCGRGGLYALGAVAANYCGDQQKRDSYLDYF--------------FEVAQEKALPVG--  546
            F+CGR G+ ALGAVAA + GD +    YL  F                 A +  + V   
Sbjct  151  FICGRAGVCALGAVAAKHAGDDESLRYYLAQFQQDWAFMQTTCSNRLNAAMQSVIYVRFR  210

Query  547  -----PEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
                 P++    +  +LLYG+ GFLWA LF+ +HLG
Sbjct  211  SDIKLPKD----LPDELLYGKGGFLWACLFLNKHLG  242



>ref|XP_002319360.2| hypothetical protein POPTR_0013s13850g [Populus trichocarpa]
 gb|EEE95283.2| hypothetical protein POPTR_0013s13850g [Populus trichocarpa]
Length=286

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 88/156 (56%), Gaps = 28/156 (18%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ F ++ + LK+ +V  TW   GG+             LGTA    +S+Q TGN  DL 
Sbjct  42   SKQFQRSGLDLKETIVMETW---GGN-------------LGTALLLYKSYQVTGNENDLF  85

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC +IV  C SA+ A+ R +TF+CGR G+ ALGAVAA +  D+  +  YL    E+   K
Sbjct  86   LCLEIVKACDSASRAS-RDVTFICGRAGVCALGAVAAKHVNDEALQSYYLSQLGEI---K  141

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
             L   P+E        LLYGR+GFLWA LF+ +HLG
Sbjct  142  LLRNHPDE--------LLYGRSGFLWACLFLNKHLG  169



>gb|AAD20918.1| hypothetical protein [Arabidopsis thaliana]
Length=371

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 84/148 (57%), Gaps = 15/148 (10%)
 Frame = +1

Query  202  LKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCA  381
            +K++ +  TW   G S  T  D T+Y+G LG A+   R++Q TGN  DL LC +IV  C 
Sbjct  14   VKEKEMIETW---GFSGQTVEDFTLYSGTLGAAFLLFRAYQVTGNANDLSLCLEIVKACD  70

Query  382  SAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGG  561
            +A+ A+   +TFLCGR G+  LGAVAA   G++   + YL  F  +     LP       
Sbjct  71   TAS-ASSGDVTFLCGRAGVCGLGAVAAKLSGEEDLLNYYLGQFRLIRLSSDLP-------  122

Query  562  FGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                 +LLYGR G+LWA LFI +++G E
Sbjct  123  ----NELLYGRVGYLWACLFINKYIGKE  146



>ref|XP_009102106.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Brassica 
rapa]
Length=408

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 100/188 (53%), Gaps = 15/188 (8%)
 Frame = +1

Query  82   PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  261
            P+ + +  E+G+     ++++  A  +   ++   ++A+ LK+ VV  TW   G +    
Sbjct  11   PDLSQSVAEEGD-----SLMNLLAMPYSFLSQNLQRSALGLKETVVMETW---GFTGQLV  62

Query  262  MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  441
             D  +Y+G LG A+   R++Q T N  DL L   I+  C  AA A+ R ITF+CGR G+ 
Sbjct  63   QDFPLYSGTLGAAFLLFRAYQVTANPNDLSLFLQILKACCDAASASSRDITFICGRAGVC  122

Query  442  ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  621
            ALG  AA   GDQ+  + YL  F +      L          ++ +LLYG  G+LWA LF
Sbjct  123  ALGTAAAKRSGDQELLNYYLSQFRQFCFSTLLSS-------YIANELLYGIVGYLWACLF  175

Query  622  IKQHLGSE  645
            + +++G+E
Sbjct  176  VNKYVGAE  183



>gb|AGV54199.1| lanC-like protein [Phaseolus vulgaris]
Length=414

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 93/174 (53%), Gaps = 19/174 (11%)
 Frame = +1

Query  118  DSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGT  297
            DS  + +  P AP     +E   +AA+ LK+ +V  TW   G S     D ++Y G+LGT
Sbjct  33   DSLPKLLAMPHAPL----SERLKRAALDLKETIVIETW---GVSWRKDGDFSLYCGVLGT  85

Query  298  AYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGD  477
            A+  L+S++ T N  DL LC+ IV  C  AA    R +TF+CGR G+ +LGAVAA + GD
Sbjct  86   AFLLLKSYEVTRNGNDLSLCSQIVKAC-DAASVRSRDVTFICGRAGVCSLGAVAAKHAGD  144

Query  478  QQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
             +    Y+  F ++   K LP            +LLYG++ FL      KQHLG
Sbjct  145  DESLRYYMAQFEKIKLSKDLPD-----------ELLYGKSWFLVGLFVPKQHLG  187



>emb|CDY55165.1| BnaCnng28300D [Brassica napus]
Length=303

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +1

Query  442  ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  621
            ALGA+ A+Y GDQ K D +L  F E+A+E+ LP GPEEGGFGMSYDLLYGRAGFLWAAL 
Sbjct  13   ALGAIVASYSGDQSKLDLFLGLFLELAEERELPAGPEEGGFGMSYDLLYGRAGFLWAALL  72

Query  622  IKQHLGS  642
            + ++LG 
Sbjct  73   LNRYLGE  79



>emb|CBI38211.3| unnamed protein product [Vitis vinifera]
Length=246

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 72/126 (57%), Gaps = 12/126 (10%)
 Frame = +1

Query  262  MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLY  441
            +  T+  G LG    C  ++  T N+ DL LC++IV  C S +  + + ITF+CGR G+ 
Sbjct  5    LPSTLSLGFLGQLTCCSEAYLVTANKTDLGLCSEIVKACDSTSFGS-KDITFICGRAGVC  63

Query  442  ALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALF  621
            ALGAV   Y GD++  + YL  F E+   ++LP            +LLYGR GFLWA LF
Sbjct  64   ALGAVVVKYSGDERLMNYYLSRFNEIKLPRSLPD-----------ELLYGRVGFLWACLF  112

Query  622  IKQHLG  639
            + +H+G
Sbjct  113  LNKHIG  118



>ref|XP_010918435.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Elaeis guineensis]
Length=365

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            A+  L+AA+ LK++VV  TW    G A    D T+YTG LGTA+   +++Q T NR DL 
Sbjct  38   ADKLLRAALDLKEKVVKETWVRLRGRA---KDFTLYTGALGTAFLLFKAYQVTNNRGDLS  94

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYF  510
            LC++I+  C  A+     H+TF+CGR G+ ALGAV A + GD+   + YL  F
Sbjct  95   LCSEIIRACDVASQGD-PHVTFICGRAGVCALGAVVAKHAGDEALLNHYLSSF  146



>emb|CDY31938.1| BnaA07g00570D [Brassica napus]
Length=391

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/190 (32%), Positives = 97/190 (51%), Gaps = 20/190 (11%)
 Frame = +1

Query  82   PESNGTNHEDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTH  261
            P+ + +  E+G+     ++++  A  +   ++   ++A+ LK+ VV  TW   G +    
Sbjct  11   PDLSQSVAEEGD-----SLMNLLAMPYSFLSQNLQRSALGLKETVVMETW---GFTGQLV  62

Query  262  MDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAA--PATIRHITFLCGRGG  435
             D  +Y+G LG A+   R++Q T N  DL L   I+  C      P   R ITF+CGR G
Sbjct  63   QDFPLYSGTLGAAFLLFRAYQVTANPNDLSLFLQILKACLVMLLLPPLGRDITFICGRAG  122

Query  436  LYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAA  615
            + ALG  AA   GDQ+  + YL  F +               F ++ +LLYG  G+LWA 
Sbjct  123  VCALGTAAAKRSGDQELLNYYLSQFRQFCFST----------FYIANELLYGIVGYLWAC  172

Query  616  LFIKQHLGSE  645
            LF+ +++G+E
Sbjct  173  LFVNKYVGAE  182



>ref|XP_010555129.1| PREDICTED: lanC-like protein GCL2 [Tarenaya hassleriana]
Length=405

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 89/158 (56%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ F ++A+ LK+ +V  TW   G S     D T+Y+G LG A    +  Q + N  DL 
Sbjct  38   SQQFKRSALDLKETIVMETW---GFSGQNVKDFTLYSGTLGAALLLFKVHQMSKNANDLA  94

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC  IV  C +A+ ++ R++TF+CGR G+ ALGA AA   G+ +    YL  F ++   +
Sbjct  95   LCLQIVKACDAASRSS-RNVTFICGRAGVCALGAAAAKVAGEAELLSYYLTQFRQIELPR  153

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             LP            +LLYGRAG+LWA LF+ +H+G E
Sbjct  154  DLPD-----------ELLYGRAGYLWACLFLNKHIGEE  180



>ref|XP_010555131.1| PREDICTED: lanC-like protein GCL2 [Tarenaya hassleriana]
Length=405

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 88/158 (56%), Gaps = 15/158 (9%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ F ++A+ LK+ +V  TW   G S     D T+Y+G LG A    +  Q + N  DL 
Sbjct  38   SQQFKRSALDLKETIVMETW---GFSGQNVKDFTLYSGTLGAALLLFKVHQMSKNANDLA  94

Query  352  LCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEK  531
            LC  IV  C +A+ ++ R +TF+CGR G+ ALGA AA   G+ +    YL  F ++   +
Sbjct  95   LCLQIVKACDAASRSS-RDVTFICGRAGVCALGAAAAKVAGEAELLSYYLTQFRQIELPR  153

Query  532  ALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
             LP            +LLYGRAG+LWA LF+ +H+G E
Sbjct  154  DLPD-----------ELLYGRAGYLWACLFLNKHIGEE  180



>gb|KCW62074.1| hypothetical protein EUGRSUZ_H04744 [Eucalyptus grandis]
Length=472

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +1

Query  508  FFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
            F EVAQE+ALPVGPEEGGFGMSYDLLYGRAGFLWAALF+ ++LG E
Sbjct  200  FHEVAQERALPVGPEEGGFGMSYDLLYGRAGFLWAALFLNKNLGEE  245



>ref|XP_006591493.1| PREDICTED: lanC-like protein 2-like isoform X4 [Glycine max]
Length=350

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = +1

Query  517  VAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLGSEA  648
            VA+E+ALPVGPEEGGFGMSYDLLYGRAGFLW ALF+ +HLG +A
Sbjct  88   VAKERALPVGPEEGGFGMSYDLLYGRAGFLWGALFVNKHLGDDA  131



>gb|EPS72953.1| hypothetical protein M569_01804, partial [Genlisea aurea]
Length=139

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 68/107 (64%), Gaps = 5/107 (5%)
 Frame = +1

Query  154  PSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATG  333
            PS  L  E   +A + LK++VV  TW  + G      D ++YTG LGTA+   +++Q +G
Sbjct  38   PSAALSLE-LKKAGLELKNKVVRETWLRKSGPV---DDYSLYTGALGTAFLLFKAYQISG  93

Query  334  NRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYALGAVAANYCG  474
            +  D+ LC+DI+  C SA+  +  ++TF+CG+ G+YALGAV +++ G
Sbjct  94   DNNDIILCSDIIKACDSASRGS-PNLTFICGKAGVYALGAVVSHHIG  139



>gb|KJB84322.1| hypothetical protein B456_N018400 [Gossypium raimondii]
 gb|KJB84325.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=300

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 11/81 (14%)
 Frame = +1

Query  403  RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  582
            R +TF+CGR G+YALGAV A + GD   +  YL+ F E+     LP           ++L
Sbjct  7    RRVTFICGRAGVYALGAVIAKHSGDTSLQQRYLEKFKEIRFPSDLP-----------HEL  55

Query  583  LYGRAGFLWAALFIKQHLGSE  645
            LYGRAGFLWA  F+ +H+G +
Sbjct  56   LYGRAGFLWACSFLNKHIGKD  76



>gb|KJB84323.1| hypothetical protein B456_N018400 [Gossypium raimondii]
Length=340

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 11/85 (13%)
 Frame = +1

Query  391  PATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGM  570
            P+    +TF+CGR G+YALGAV A + GD   +  YL+ F E+     LP          
Sbjct  43   PSKKPRVTFICGRAGVYALGAVIAKHSGDTSLQQRYLEKFKEIRFPSDLP----------  92

Query  571  SYDLLYGRAGFLWAALFIKQHLGSE  645
             ++LLYGRAGFLWA  F+ +H+G +
Sbjct  93   -HELLYGRAGFLWACSFLNKHIGKD  116



>ref|XP_004172119.1| PREDICTED: lanC-like protein 2-like, partial [Cucumis sativus]
Length=293

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 47/78 (60%), Gaps = 11/78 (14%)
 Frame = +1

Query  406  HITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLL  585
            H+TF+CGR G+ ALGAVAA +  D +  D YL  F ++     LP            +LL
Sbjct  1    HVTFICGRAGVCALGAVAAKFANDGRLVDHYLAKFKDIKLPSDLP-----------NELL  49

Query  586  YGRAGFLWAALFIKQHLG  639
            YGRAGFLWA LF+ +H+G
Sbjct  50   YGRAGFLWACLFLNKHIG  67



>gb|KDO74127.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=298

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 11/81 (14%)
 Frame = +1

Query  403  RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  582
            R +TF+CGR G+ ALGAV A + GD++  D YL  F E+     LP            +L
Sbjct  5    RRVTFICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPSDLP-----------NEL  53

Query  583  LYGRAGFLWAALFIKQHLGSE  645
            LYGR GFLWA  F+ +H+G +
Sbjct  54   LYGRVGFLWACSFLNKHMGKD  74



>tpg|DAA49458.1| TPA: hypothetical protein ZEAMMB73_373795 [Zea mays]
Length=156

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 48/73 (66%), Gaps = 3/73 (4%)
 Frame = +1

Query  172  AETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLR  351
            ++ F++AA  LKD+VV+ TW  + G  VT  D T+YTG LGTA    +SFQ TG+R DL 
Sbjct  83   SDHFVRAARRLKDKVVEETW-VKAGRKVT--DYTLYTGSLGTALLLFKSFQVTGDRGDLA  139

Query  352  LCADIVDTCASAA  390
            L ADIV  C  A+
Sbjct  140  LAADIVRACDDAS  152



>emb|CBG76444.1| OO_Ba0013J05-OO_Ba0033A15.31 [Oryza officinalis]
Length=1333

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 46/79 (58%), Gaps = 11/79 (14%)
 Frame = +1

Query  403   RHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDL  582
             R +TF+CGR G+ ALGAV A + GD+     YL  F E+  +  LP            +L
Sbjct  1052  RIVTFICGRAGVCALGAVVAKHAGDEAGVAHYLSAFKEIKIQSKLP-----------DEL  1100

Query  583   LYGRAGFLWAALFIKQHLG  639
             LYGRAG+LWA  F+ +HLG
Sbjct  1101  LYGRAGYLWACTFLNKHLG  1119



>ref|XP_001605213.2| PREDICTED: lanC-like protein 1 isoform X1 [Nasonia vitripennis]
 ref|XP_008216990.1| PREDICTED: lanC-like protein 1 isoform X1 [Nasonia vitripennis]
Length=451

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 67/125 (54%), Gaps = 8/125 (6%)
 Frame = +1

Query  265  DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  444
            D ++YTGL G AYT     +   ++  +    ++V  C        RH+TFL G  G  A
Sbjct  106  DTSLYTGLPGVAYTFYHYGKYFEDQSYISRSTELVGKCIEKLRGK-RHVTFLTGNAGPLA  164

Query  445  LGAVAANYCGDQQKRDSYLDYFFEVAQEKALP-VGPEEGGFGMSYDLLYGRAGFLWAALF  621
            LGAV  ++ G++++  +       +++ K L      E G G+  ++LYGRAG+L+A LF
Sbjct  165  LGAVMNHFLGEKEESKNM------ISKLKYLSSYAIYEDGSGLPDEILYGRAGYLYALLF  218

Query  622  IKQHL  636
            + +H+
Sbjct  219  VNKHM  223



>ref|XP_003424467.1| PREDICTED: lanC-like protein 2 isoform X2 [Nasonia vitripennis]
Length=405

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = +1

Query  265  DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  444
            D ++YTGL G AYT     +   ++  +    ++V  C        RH+TFL G  G  A
Sbjct  60   DTSLYTGLPGVAYTFYHYGKYFEDQSYISRSTELVGKCIEKLRGK-RHVTFLTGNAGPLA  118

Query  445  LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  624
            LGAV  ++ G++++  + +     ++          E G G+  ++LYGRAG+L+A LF+
Sbjct  119  LGAVMNHFLGEKEESKNMISKLKYLSSYAIY-----EDGSGLPDEILYGRAGYLYALLFV  173

Query  625  KQHL  636
             +H+
Sbjct  174  NKHM  177



>ref|XP_004172511.1| PREDICTED: lanC-like protein 2-like, partial [Cucumis sativus]
Length=118

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 41/66 (62%), Gaps = 3/66 (5%)
 Frame = +1

Query  187  QAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADI  366
            QAA++LK+ VV  TW   G       D T+YTG LGTA+  L+SF  + N  DL+LC++I
Sbjct  51   QAALNLKETVVRETWTLSGRHP---QDNTLYTGALGTAFLALKSFFVSKNENDLKLCSEI  107

Query  367  VDTCAS  384
            V  C S
Sbjct  108  VTACES  113



>ref|XP_004335796.1| LanC lantibiotic synthetase, partial [Acanthamoeba castellanii 
str. Neff]
 gb|ELR13783.1| LanC lantibiotic synthetase, partial [Acanthamoeba castellanii 
str. Neff]
Length=344

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 83/182 (46%), Gaps = 16/182 (9%)
 Frame = +1

Query  136  VLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTGLLGTAYTCLR  315
            V+ P  P+F  PAE  L       D+++++       +  T  D TVY G  G A   LR
Sbjct  6    VMAPPGPAFPTPAE--LHHLRKKTDKLIEIIQDDWPANLETQNDATVYQGAAGAALMFLR  63

Query  316  SFQATGNRQD-----------LRLCADIVDTCASAAPATIR-HITFLCGRGGLYALGAVA  459
             ++A     D           +R+   +++      P + +  ++F  G  G +AL AV 
Sbjct  64   LWEADYELPDQTNALERAEEYIRIAHRLIEEKEKLDPVSAKTSVSFTLGDAGTFALAAVI  123

Query  460  ANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFIKQHLG  639
             ++ G ++K   Y+D    + Q   +P+ P     G +++  YG AG+L+   F++QHL 
Sbjct  124  YHHLGRREKAAEYVDRLTGL-QNPVVPL-PGASRPGETWEPFYGMAGYLYCIYFVEQHLE  181

Query  640  SE  645
             E
Sbjct  182  RE  183



>ref|XP_002110672.1| hypothetical protein TRIADDRAFT_54925 [Trichoplax adhaerens]
 gb|EDV26676.1| hypothetical protein TRIADDRAFT_54925 [Trichoplax adhaerens]
Length=393

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 70/134 (52%), Gaps = 15/134 (11%)
 Frame = +1

Query  265  DPTVYTGLLGTAYTCLRSFQATGNRQD---LRLCADIVDTCASAAPATIRH--ITFLCGR  429
            DP++Y G  G A   +R  +A  N +    L+   + +    +    T RH  +TFLCG 
Sbjct  72   DPSIYVGYAGVAMLYIRLSEALDNGKKELYLKTAWNYLSISLTMISNTRRHKDVTFLCGD  131

Query  430  GGLYALGAVAANYCG-DQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFL  606
             G+YAL AV  +  G +QQ +D        + Q +AL V  ++    +  +LLYGR+G+L
Sbjct  132  AGIYALAAVVCHKLGVEQQSKDL-------IEQLQALHVHCDDR--SLPDELLYGRSGYL  182

Query  607  WAALFIKQHLGSEA  648
             +  F++ HLG +A
Sbjct  183  HSLKFVQLHLGKDA  196



>ref|XP_009967231.1| PREDICTED: lanC-like protein 1 [Tyto alba]
Length=143

 Score = 58.5 bits (140),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 64/136 (47%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S +  T R ITF
Sbjct  3    RGLKSADPEDCTTYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKK--SLSCLTRRSITF  60

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  61   LCGDAGPLAVAAVIYHKLQNQKQSEECITRLLHL--HKLDPRVPDE--------LLYGRM  110

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  111  GYLYALIFVNRHFGEE  126



>ref|XP_005021837.1| PREDICTED: lanC-like protein 1 [Anas platyrhynchos]
 gb|EOA99661.1| LanC-like protein 1, partial [Anas platyrhynchos]
Length=399

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG       D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  49   RGLKCADPHDCTAYTGWTGIALLYLHLYDVYGDPAYLQVAQEYVKKSLSCL--TKRSITF  106

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  107  LCGDAGPLAVAAVVYHKLQNQKQSEDCITRLLHL--HKVDPRVPDE--------LLYGRM  156

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A LF+ +H G E
Sbjct  157  GYLYALLFVNKHFGEE  172



>ref|XP_009015183.1| hypothetical protein HELRODRAFT_188186 [Helobdella robusta]
 gb|ESO05815.1| hypothetical protein HELRODRAFT_188186 [Helobdella robusta]
Length=441

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 83/185 (45%), Gaps = 23/185 (12%)
 Frame = +1

Query  106  EDGNDSGFRTVLDPTAPSFILPAETFLQAAVSLKDQVVDMTWKARGGSAVTHMDPTVYTG  285
            +DG+ S    +LD +  S +       Q   SLK +  ++             D +VYTG
Sbjct  44   DDGSASSTSQLLDSSEHSILRQ-----QIKDSLKKKANELLSDLENNYKPQWNDFSVYTG  98

Query  286  LLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRH-----ITFLCGRGGLYALG  450
              G A     +++   N +  +   D ++T       ++ H     +TFLCG  G  A+G
Sbjct  99   SAGLALLYFEAYEKLTNDEKRK--QDYLETSTRYLNKSLEHMHGSEVTFLCGNAGPMAVG  156

Query  451  AVAANYCGDQQKRDSYLDYFFEVAQEKAL--PVGPEEGGFGMSYDLLYGRAGFLWAALFI  624
             V  ++ G   K +  LD    + Q KAL  P  P E        LLYGRAG+L++ +F+
Sbjct  157  TVVFHHAGINIKSEQCLDGLLSLCQ-KALNEPNLPNE--------LLYGRAGYLYSLMFV  207

Query  625  KQHLG  639
            + +LG
Sbjct  208  EGYLG  212



>ref|XP_010406143.1| PREDICTED: lanC-like protein 1 [Corvus cornix cornix]
Length=400

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 64/136 (47%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  50   RGLKSADPHDCTAYTGWTGIALLYLHLYDVYGDPAYLQVAHEYVKK--SLRCMTRRSITF  107

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ + Y+     +   KA P  P+E        LLYGR 
Sbjct  108  LCGDAGPLAVAAVIYHKLQNQKQAEDYIIRLLHL--HKADPRLPDE--------LLYGRM  157

Query  598  GFLWAALFIKQHLGSE  645
            G+L A +F+ +H G E
Sbjct  158  GYLSALIFVNKHFGEE  173



>gb|KFO54122.1| LanC-like 1, partial [Corvus brachyrhynchos]
Length=373

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 64/136 (47%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  23   RGLKSADPHDCTAYTGWTGIALLYLHLYDVYGDPAYLQVAHEYVKK--SLRCMTRRSITF  80

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ + Y+     +   KA P  P+E        LLYGR 
Sbjct  81   LCGDAGPLAVAAVIYHKLQNQKQAEDYIIRLLHL--HKADPRLPDE--------LLYGRM  130

Query  598  GFLWAALFIKQHLGSE  645
            G+L A +F+ +H G E
Sbjct  131  GYLSALIFVNKHFGEE  146



>ref|XP_008641803.1| PREDICTED: lanC-like protein 1 [Corvus brachyrhynchos]
Length=423

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 64/136 (47%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  73   RGLKSADPHDCTAYTGWTGIALLYLHLYDVYGDPAYLQVAHEYVKK--SLRCMTRRSITF  130

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ + Y+     +   KA P  P+E        LLYGR 
Sbjct  131  LCGDAGPLAVAAVIYHKLQNQKQAEDYIIRLLHL--HKADPRLPDE--------LLYGRM  180

Query  598  GFLWAALFIKQHLGSE  645
            G+L A +F+ +H G E
Sbjct  181  GYLSALIFVNKHFGEE  196



>ref|XP_003766010.1| PREDICTED: lanC-like protein 1 [Sarcophilus harrisii]
Length=411

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 65/135 (48%), Gaps = 12/135 (9%)
 Frame = +1

Query  241  GGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFL  420
            G  +    D T YTG  G A   L  ++  G+   L++  + V    S    T R ITFL
Sbjct  62   GLKSADRRDCTTYTGWAGIALLYLHLYEVYGDPVYLQMSHEYVKK--SLNTLTKRTITFL  119

Query  421  CGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAG  600
            CG  G  A+GAV  +  G++++ +  L     V   K  P  P+E        +LYGR G
Sbjct  120  CGDAGPLAIGAVVYHKMGNEKQVEDCLTRL--VHLHKLDPRAPDE--------MLYGRMG  169

Query  601  FLWAALFIKQHLGSE  645
            +++A LF+ ++ G E
Sbjct  170  YIYALLFVNKYFGQE  184



>ref|XP_001364295.2| PREDICTED: lanC-like protein 1 isoform X1 [Monodelphis domestica]
 ref|XP_007501859.1| PREDICTED: lanC-like protein 1 isoform X3 [Monodelphis domestica]
 ref|XP_007501860.1| PREDICTED: lanC-like protein 1 isoform X4 [Monodelphis domestica]
Length=399

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 12/127 (9%)
 Frame = +1

Query  265  DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  444
            D T+YTG  G A   L  +   G+   L++  + +    S    T R ITFLCG GG  A
Sbjct  58   DCTIYTGWAGIALLYLHLYDVYGDPVYLQMSHEYIKK--SLNCLTKRTITFLCGDGGPLA  115

Query  445  LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  624
            +GAV  +  G++++ +  +     +   K  P  P+E        +LYGR G+++A LF+
Sbjct  116  VGAVVYHKMGNEKQAEDCITRLLHL--NKLDPRAPDE--------MLYGRMGYVYALLFV  165

Query  625  KQHLGSE  645
             ++ G E
Sbjct  166  NENFGQE  172



>ref|XP_007501858.1| PREDICTED: lanC-like protein 1 isoform X2 [Monodelphis domestica]
Length=461

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 64/127 (50%), Gaps = 12/127 (9%)
 Frame = +1

Query  265  DPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITFLCGRGGLYA  444
            D T+YTG  G A   L  +   G+   L++  + +    S    T R ITFLCG GG  A
Sbjct  120  DCTIYTGWAGIALLYLHLYDVYGDPVYLQMSHEYIKK--SLNCLTKRTITFLCGDGGPLA  177

Query  445  LGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRAGFLWAALFI  624
            +GAV  +  G++++ +  +     +   K  P  P+E        +LYGR G+++A LF+
Sbjct  178  VGAVVYHKMGNEKQAEDCITRLLHL--NKLDPRAPDE--------MLYGRMGYVYALLFV  227

Query  625  KQHLGSE  645
             ++ G E
Sbjct  228  NENFGQE  234



>ref|XP_007470076.1| PREDICTED: lanC-like protein 1 [Lipotes vexillifer]
Length=399

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D TVYTG  G A   L  +   G+   L+   D V    S    T   ITF
Sbjct  49   RGLKSADPRDSTVYTGWAGIAVLYLHLYDVFGDPSYLQKAHDYVKQ--SLNCLTKHSITF  106

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG GG  A+ AV  +   ++++ + YL     +   K  P  P E        +LYGR 
Sbjct  107  LCGDGGPLAVAAVVHHKMNNEKRAEDYLTRLIHL--NKIDPHAPNE--------MLYGRM  156

Query  598  GFLWAALFIKQHLGSE  645
            G++ A LF+ ++ G E
Sbjct  157  GYICALLFVNKNFGVE  172



>gb|KGL95390.1| LanC-like 1 [Charadrius vociferus]
Length=399

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  49   RGLKSADPQDCTAYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  106

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  107  LCGDAGPLAVAAVVYHKLQNQKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  156

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  157  GYLYALIFVNKHFGEE  172



>ref|XP_009885874.1| PREDICTED: lanC-like protein 1 isoform X1 [Charadrius vociferus]
Length=400

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  50   RGLKSADPQDCTAYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  107

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  108  LCGDAGPLAVAAVVYHKLQNQKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  157

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  158  GYLYALIFVNKHFGEE  173



>ref|XP_009885875.1| PREDICTED: lanC-like protein 1 isoform X2 [Charadrius vociferus]
Length=353

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  3    RGLKSADPQDCTAYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  60

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  61   LCGDAGPLAVAAVVYHKLQNQKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  110

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  111  GYLYALIFVNKHFGEE  126



>ref|XP_010281072.1| PREDICTED: lanC-like protein 1 [Phaethon lepturus]
Length=353

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  3    RGLKSADPQDCTTYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  60

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  61   LCGDAGPLAVAAVVYHKLQNQKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  110

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  111  GYLYALVFVNKHFGEE  126



>gb|KFP32110.1| LanC-like 1, partial [Colius striatus]
Length=373

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  23   RGLKSADPQDCTTYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  80

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  81   LCGDAGPLAVAAVVYHKLQNQKQAEDCITRLLHL--HKLDPRVPDE--------LLYGRM  130

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  131  GYLYALIFVNKHFGEE  146



>ref|XP_010581555.1| PREDICTED: lanC-like protein 1 [Haliaeetus leucocephalus]
Length=400

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  50   RGLKSADPQDCTTYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  107

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  108  LCGDAGPLAVAAVVFHKLQNQKQSEDCVTRLLHL--HKLDPRVPDE--------LLYGRM  157

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  158  GYLYALIFVNKHFGEE  173



>ref|XP_010201115.1| PREDICTED: lanC-like protein 1 [Colius striatus]
Length=353

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  3    RGLKSADPQDCTTYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  60

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  61   LCGDAGPLAVAAVVYHKLQNQKQAEDCITRLLHL--HKLDPRVPDE--------LLYGRM  110

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  111  GYLYALIFVNKHFGEE  126



>ref|XP_008926719.1| PREDICTED: lanC-like protein 1 [Manacus vitellinus]
Length=424

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  74   RGLKSADPHDCTAYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  131

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   KA P  P+E        LLYGR 
Sbjct  132  LCGDAGPLAVAAVIYHKLHNQKQAEDCITRLLHLL--KADPRVPDE--------LLYGRM  181

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A  F+ +H G E
Sbjct  182  GYLYALTFVNKHFGEE  197



>gb|KFW84735.1| LanC-like 1, partial [Manacus vitellinus]
Length=395

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  45   RGLKSADPHDCTAYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  102

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   KA P  P+E        LLYGR 
Sbjct  103  LCGDAGPLAVAAVIYHKLHNQKQAEDCITRLLHLL--KADPRVPDE--------LLYGRM  152

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A  F+ +H G E
Sbjct  153  GYLYALTFVNKHFGEE  168



>ref|XP_005486943.1| PREDICTED: lanC-like protein 1 [Zonotrichia albicollis]
Length=400

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 71/150 (47%), Gaps = 15/150 (10%)
 Frame = +1

Query  202  LKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDT  375
            L +++ ++  +   G  SA  H D T YTG  G A   L  F   G+   L++  + V  
Sbjct  37   LNNKIRELLQQMEKGLKSADPH-DCTAYTGWTGIALLYLHLFDVYGDPAYLQVAHEYVKK  95

Query  376  CASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEE  555
              S    T R ITFLCG  G  A+ AV  +   +Q++ +  +     +   KA P  P+E
Sbjct  96   --SLRCLTRRSITFLCGDAGPLAVAAVVYHKLQNQKQAEDCIIRLLHL--HKADPRVPDE  151

Query  556  GGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                    LLYGR G+L A LF+ +H G E
Sbjct  152  --------LLYGRMGYLSALLFVNKHFGEE  173



>gb|KFV88367.1| LanC-like 1, partial [Struthio camelus australis]
Length=373

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  23   RGLKSADPRDCTAYTGWTGIALLYLHLYNVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  80

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   + ++ +  +     +   K  P  P+E        LLYGR 
Sbjct  81   LCGDAGPLAVAAVIYHKLQNHKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  130

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A LF+ +H G E
Sbjct  131  GYLYALLFVNKHFGEE  146



>gb|KFO80625.1| LanC-like 1, partial [Cuculus canorus]
Length=394

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L+   + V    S    T R ITF
Sbjct  44   RGLKSADPKDCTAYTGWAGIALLYLHLYDVYGDPAHLQAAHEYVKKSLSCL--TRRSITF  101

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  102  LCGDAGPLAVAAVVYHKLQNQKQAEECITRLLHL--HKLDPRVPDE--------LLYGRM  151

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  152  GYLYALVFVNKHFGEE  167



>gb|KFP09242.1| LanC-like 1, partial [Egretta garzetta]
Length=373

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L      G+   L++  + V    S    T R ITF
Sbjct  23   RGLKSADPQDCTTYTGWAGIALLYLHLHDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  80

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  81   LCGDAGPLAVAAVVYHKLQNQKQAEDCITRLLHL--HKVDPRVPDE--------LLYGRM  130

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  131  GYLYALIFVNKHFGEE  146



>ref|XP_009686963.1| PREDICTED: lanC-like protein 1 [Struthio camelus australis]
Length=353

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  3    RGLKSADPRDCTAYTGWTGIALLYLHLYNVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  60

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   + ++ +  +     +   K  P  P+E        LLYGR 
Sbjct  61   LCGDAGPLAVAAVIYHKLQNHKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  110

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A LF+ +H G E
Sbjct  111  GYLYALLFVNKHFGEE  126



>ref|XP_009634935.1| PREDICTED: lanC-like protein 1 [Egretta garzetta]
Length=353

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L      G+   L++  + V    S    T R ITF
Sbjct  3    RGLKSADPQDCTTYTGWAGIALLYLHLHDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  60

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  61   LCGDAGPLAVAAVVYHKLQNQKQAEDCITRLLHL--HKVDPRVPDE--------LLYGRM  110

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  111  GYLYALIFVNKHFGEE  126



>ref|XP_009279358.1| PREDICTED: lanC-like protein 1 [Aptenodytes forsteri]
Length=412

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + +    S    T R ITF
Sbjct  62   RGLKSADPRDCTTYTGWAGIALLYLHLYDVYGDPAYLQVAHEYMKKSLSCL--TRRSITF  119

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  120  LCGDAGPLAVAAVIYHKLQNQKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  169

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  170  GYLYALIFVNKHFGEE  185



>ref|XP_005244494.1| PREDICTED: lanC-like protein 1 [Falco peregrinus]
Length=459

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L      G+   L++  + V    S    T R ITF
Sbjct  109  RGLKSADPHDCTAYTGWAGIALLYLHLHDVYGDPAYLQVAHEYVKKSLSCL--TKRSITF  166

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  167  LCGDAGPLAVAAVVYHKLQNQKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRI  216

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  217  GYLYALIFVNKHFGEE  232



>gb|KFQ90951.1| LanC-like 1 [Nipponia nippon]
Length=399

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  49   RGLKSADPQDCTTYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  106

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV      ++++ +  +     +   K  P  P+E        LLYGR 
Sbjct  107  LCGDAGPLAVAAVVYRKLQNEKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  156

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  157  GYLYALIFVNKHFGEE  172



>ref|XP_009565204.1| PREDICTED: lanC-like protein 1 [Cuculus canorus]
Length=353

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L+   + V    S    T R ITF
Sbjct  3    RGLKSADPKDCTAYTGWAGIALLYLHLYDVYGDPAHLQAAHEYVKKSLSCL--TRRSITF  60

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  61   LCGDAGPLAVAAVVYHKLQNQKQAEECITRLLHL--HKLDPRVPDE--------LLYGRM  110

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  111  GYLYALVFVNKHFGEE  126



>ref|XP_009460226.1| PREDICTED: lanC-like protein 1 [Nipponia nippon]
Length=400

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + V    S    T R ITF
Sbjct  50   RGLKSADPQDCTTYTGWAGIALLYLHLYDVYGDPAYLQVAHEYVKKSLSCL--TRRSITF  107

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV      ++++ +  +     +   K  P  P+E        LLYGR 
Sbjct  108  LCGDAGPLAVAAVVYRKLQNEKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  157

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  158  GYLYALIFVNKHFGEE  173



>ref|XP_005428015.1| PREDICTED: lanC-like protein 1 [Geospiza fortis]
Length=400

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 71/150 (47%), Gaps = 15/150 (10%)
 Frame = +1

Query  202  LKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDT  375
            L +++ ++  +   G  SA  H D T YTG  G A   L  F   G+   L++  + V  
Sbjct  37   LNNKIRELLQQMEKGLRSADPH-DCTAYTGWTGIALLYLHLFDVYGDATYLQVAHEYVKK  95

Query  376  CASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEE  555
              S    T R ITFLCG  G  A+ AV  +   +Q++ +  +     +   KA P  P+E
Sbjct  96   --SLRCLTRRSITFLCGDAGPLAVAAVVYHKLQNQKQAEDCIIRLLHL--HKADPRVPDE  151

Query  556  GGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                    LLYGR G+L A +F+ +H G E
Sbjct  152  --------LLYGRMGYLSALIFVNKHFGEE  173



>ref|XP_002197149.1| PREDICTED: lanC-like protein 1 [Taeniopygia guttata]
Length=400

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 71/150 (47%), Gaps = 15/150 (10%)
 Frame = +1

Query  202  LKDQVVDMTWKARGG--SAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDT  375
            L +++ ++  +   G  SA  H D T YTG  G A   L  F   G+   L++  + V  
Sbjct  37   LNNKIRELLQQMEKGLKSADPH-DCTAYTGWTGIALLYLHLFDVYGDPAYLQVAHEYVKK  95

Query  376  CASAAPATIRHITFLCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEE  555
              S    T R ITFLCG  G  A+ AV  +   +Q++ +  +     +   KA P  P+E
Sbjct  96   --SLRCLTRRSITFLCGDAGPLAVAAVVYHKLQNQKQAEDCIIRLLHL--HKADPRVPDE  151

Query  556  GGFGMSYDLLYGRAGFLWAALFIKQHLGSE  645
                    LLYGR G+L A +F+ +H G E
Sbjct  152  --------LLYGRMGYLSALIFVNKHFGEE  173



>ref|XP_005441569.1| PREDICTED: lanC-like protein 1, partial [Falco cherrug]
Length=390

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L      G+   L++  + V    S    T R ITF
Sbjct  40   RGLKSADPHDCTAYTGWAGIALLYLHLHDVYGDPAYLQVAHEYVKKSLSCL--TKRSITF  97

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  98   LCGDAGPLAVAAVVYHKLQNQKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRI  147

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  148  GYLYALIFVNKHFGEE  163



>ref|XP_010711615.1| PREDICTED: lanC-like protein 1 [Meleagris gallopavo]
Length=400

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 61/136 (45%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  A    D T YTG  G A   L      G+   L +  + V    S    T R ITF
Sbjct  50   RGLKAADPRDCTAYTGWAGIAVLYLHLHDVYGDPAYLHVAHEYVKKSLSCL--TRRSITF  107

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   + ++ +  +     +   KA P  P+E        LLYGR 
Sbjct  108  LCGDAGPLAVAAVIYHKLQNHKQSEDCITRLLHL--HKADPQVPDE--------LLYGRM  157

Query  598  GFLWAALFIKQHLGSE  645
            G+++A LF+ +H G E
Sbjct  158  GYVYALLFVNKHFGEE  173



>ref|XP_009327921.1| PREDICTED: lanC-like protein 1 [Pygoscelis adeliae]
Length=353

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + +    S    T R ITF
Sbjct  3    RGLKSADPRDCTTYTGWAGIALLYLHLYDVYGDPAYLQVAHEYMKKSLSCL--TRRSITF  60

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  61   LCGDAGPLAVAAVIYHKLQNQKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  110

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  111  GYLYALIFVNKHFGEE  126



>gb|KFM08745.1| LanC-like 1, partial [Aptenodytes forsteri]
Length=373

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 63/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +    D T YTG  G A   L  +   G+   L++  + +    S    T R ITF
Sbjct  23   RGLKSADPRDCTTYTGWAGIALLYLHLYDVYGDPAYLQVAHEYMKKSLSCL--TRRSITF  80

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   +Q++ +  +     +   K  P  P+E        LLYGR 
Sbjct  81   LCGDAGPLAVAAVIYHKLQNQKQSEDCITRLLHL--HKLDPRVPDE--------LLYGRM  130

Query  598  GFLWAALFIKQHLGSE  645
            G+L+A +F+ +H G E
Sbjct  131  GYLYALIFVNKHFGEE  146



>ref|XP_008143428.1| PREDICTED: lanC-like protein 1 [Eptesicus fuscus]
Length=399

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 62/136 (46%), Gaps = 12/136 (9%)
 Frame = +1

Query  238  RGGSAVTHMDPTVYTGLLGTAYTCLRSFQATGNRQDLRLCADIVDTCASAAPATIRHITF  417
            RG  +  H D T YTG  G A   L  +   G+   L++    V    S    + R ITF
Sbjct  49   RGLKSADHRDGTAYTGWTGIAVLYLHLYDVFGDPAYLQMAHSYVKQ--SLNCLSKRSITF  106

Query  418  LCGRGGLYALGAVAANYCGDQQKRDSYLDYFFEVAQEKALPVGPEEGGFGMSYDLLYGRA  597
            LCG  G  A+ AV  +   ++++ D  +     +   K  P  P E        +LYGR 
Sbjct  107  LCGDAGPLAVAAVVYHKMSNEKQADDCITRLIHL--NKVDPHAPNE--------MLYGRM  156

Query  598  GFLWAALFIKQHLGSE  645
            G+++A LF+ ++ G E
Sbjct  157  GYIYALLFVNRNFGVE  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 987899701625