BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041O07

Length=651
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011087584.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    389   4e-127   Sesamum indicum [beniseed]
ref|XP_009604645.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    384   1e-125   Nicotiana tomentosiformis
ref|XP_003554590.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    385   1e-125   Glycine max [soybeans]
ref|XP_009604646.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    384   1e-125   Nicotiana tomentosiformis
gb|KHN43389.1|  DEAD-box ATP-dependent RNA helicase 3, chloroplastic    386   2e-125   Glycine soja [wild soybean]
ref|XP_002278318.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    384   2e-125   Vitis vinifera
ref|XP_008246347.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    383   8e-125   Prunus mume [ume]
ref|XP_007208352.1|  hypothetical protein PRUPE_ppa001778mg             382   9e-125   Prunus persica
ref|XP_009789500.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    382   1e-124   Nicotiana sylvestris
ref|XP_003521635.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    382   1e-124   Glycine max [soybeans]
emb|CDP17754.1|  unnamed protein product                                381   4e-124   Coffea canephora [robusta coffee]
ref|XP_010245402.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    379   2e-123   Nelumbo nucifera [Indian lotus]
ref|XP_004244948.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    378   4e-123   Solanum lycopersicum
ref|XP_006355275.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    377   6e-123   Solanum tuberosum [potatoes]
ref|XP_009337853.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    377   2e-122   Pyrus x bretschneideri [bai li]
ref|XP_004302309.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    376   3e-122   Fragaria vesca subsp. vesca
ref|XP_008364011.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    374   7e-122   
ref|XP_008370322.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    375   9e-122   
ref|XP_007163272.1|  hypothetical protein PHAVU_001G220500g             375   1e-121   Phaseolus vulgaris [French bean]
gb|EPS66084.1|  hypothetical protein M569_08688                         375   1e-121   Genlisea aurea
ref|XP_010932029.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    374   1e-121   
gb|KCW58706.1|  hypothetical protein EUGRSUZ_H01352                     371   2e-121   Eucalyptus grandis [rose gum]
ref|XP_011039071.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    369   5e-121   Populus euphratica
ref|XP_009365993.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    372   2e-120   Pyrus x bretschneideri [bai li]
ref|XP_006382238.1|  hypothetical protein POPTR_0005s00240g             370   3e-120   
ref|XP_007031309.1|  DEAD box RNA helicase (RH3) isoform 4              367   3e-120   
ref|XP_010094933.1|  DEAD-box ATP-dependent RNA helicase 3              372   5e-120   
ref|XP_008777792.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    370   5e-120   Phoenix dactylifera
ref|XP_006382233.1|  hypothetical protein POPTR_0005s00200g             370   5e-120   Populus trichocarpa [western balsam poplar]
ref|XP_006382234.1|  hypothetical protein POPTR_0005s00200g             370   6e-120   Populus trichocarpa [western balsam poplar]
ref|XP_006382239.1|  hypothetical protein POPTR_0005s00240g             370   6e-120   Populus trichocarpa [western balsam poplar]
gb|KDP23314.1|  hypothetical protein JCGZ_23147                         369   8e-120   Jatropha curcas
gb|EYU35387.1|  hypothetical protein MIMGU_mgv1a001660mg                369   1e-119   Erythranthe guttata [common monkey flower]
ref|XP_008798630.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    369   1e-119   Phoenix dactylifera
ref|XP_010070121.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    369   2e-119   Eucalyptus grandis [rose gum]
ref|XP_003626109.1|  DEAD-box ATP-dependent RNA helicase                368   3e-119   
ref|XP_007031308.1|  DEAD box RNA helicase (RH3) isoform 3              365   4e-119   
ref|XP_011039069.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    367   7e-119   Populus euphratica
ref|XP_002512602.1|  dead box ATP-dependent RNA helicase, putative      367   8e-119   Ricinus communis
ref|XP_011039068.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    367   8e-119   Populus euphratica
ref|XP_003536002.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    365   2e-118   Glycine max [soybeans]
ref|XP_010551750.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    366   2e-118   Tarenaya hassleriana [spider flower]
ref|XP_006480317.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    366   2e-118   
ref|XP_006480316.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    366   2e-118   Citrus sinensis [apfelsine]
ref|XP_006480315.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    366   2e-118   Citrus sinensis [apfelsine]
gb|KHN13959.1|  DEAD-box ATP-dependent RNA helicase 3, chloroplastic    365   2e-118   Glycine soja [wild soybean]
ref|XP_006423935.1|  hypothetical protein CICLE_v10027858mg             366   3e-118   Citrus clementina [clementine]
ref|XP_006423936.1|  hypothetical protein CICLE_v10027858mg             366   3e-118   Citrus clementina [clementine]
ref|XP_004981197.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    365   3e-118   Setaria italica
ref|XP_007031307.1|  DEAD box RNA helicase isoform 2                    365   3e-118   
ref|XP_010546798.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    365   4e-118   Tarenaya hassleriana [spider flower]
ref|XP_007031306.1|  DEAD box RNA helicase isoform 1                    365   4e-118   
ref|XP_010680184.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    365   5e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009381394.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    364   7e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009381386.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    365   9e-118   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN77581.1|  hypothetical protein VITISV_015347                     365   1e-117   Vitis vinifera
gb|AAC13590.1|  contains similarity to the conserved C-terminal d...    355   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841548.1|  hypothetical protein AMTR_s00003p00168720          363   3e-117   Amborella trichopoda
gb|EYU33253.1|  hypothetical protein MIMGU_mgv1a001505mg                364   3e-117   Erythranthe guttata [common monkey flower]
ref|XP_003555166.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    361   1e-116   Glycine max [soybeans]
gb|ACG27839.1|  nucleolar RNA helicase 2                                360   2e-116   Zea mays [maize]
gb|AIG56841.1|  DEAD-box RNA helicase                                   355   2e-116   Triticum aestivum [Canadian hard winter wheat]
gb|KHN17840.1|  DEAD-box ATP-dependent RNA helicase 3, chloroplastic    360   2e-116   Glycine soja [wild soybean]
ref|XP_011039072.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    361   3e-116   Populus euphratica
ref|XP_009383719.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    361   3e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001051773.1|  Os03g0827700                                       358   6e-116   
ref|XP_008681151.1|  PREDICTED: uncharacterized protein LOC100193...    358   9e-116   Zea mays [maize]
ref|XP_008671379.1|  PREDICTED: uncharacterized protein LOC100191...    358   9e-116   Zea mays [maize]
ref|XP_008681152.1|  PREDICTED: uncharacterized protein LOC100193...    358   1e-115   Zea mays [maize]
gb|KJB45516.1|  hypothetical protein B456_007G309800                    357   2e-115   Gossypium raimondii
ref|XP_010493909.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    354   2e-115   
sp|Q0DM51.2|RH3_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA h...    358   2e-115   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76452.1|  hypothetical protein OsI_14162                          358   2e-115   Oryza sativa Indica Group [Indian rice]
emb|CDX87045.1|  BnaC09g03600D                                          357   3e-115   
ref|XP_003591285.1|  DEAD-box ATP-dependent RNA helicase                353   4e-115   
ref|NP_001190402.1|  DEAD-box ATP-dependent RNA helicase 3              353   1e-114   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004495832.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    351   1e-114   Cicer arietinum [garbanzo]
dbj|BAD21122.1|  ATP-dependent RNA helicase                             355   2e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003563192.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    356   2e-114   Brachypodium distachyon [annual false brome]
ref|XP_010421509.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    355   3e-114   Camelina sativa [gold-of-pleasure]
ref|XP_004165586.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    354   4e-114   
gb|KHG19221.1|  DEAD-box ATP-dependent RNA helicase 3, chloroplas...    355   4e-114   Gossypium arboreum [tree cotton]
ref|XP_002874312.1|  RNA helicase                                       354   5e-114   Arabidopsis lyrata subsp. lyrata
ref|XP_006290010.1|  hypothetical protein CARUB_v10003641mg             354   5e-114   Capsella rubella
gb|KJB45517.1|  hypothetical protein B456_007G309800                    356   5e-114   Gossypium raimondii
gb|EEE60225.1|  hypothetical protein OsJ_13207                          353   6e-114   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008450498.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    354   7e-114   Cucumis melo [Oriental melon]
ref|NP_680225.2|  DEAD-box ATP-dependent RNA helicase 3                 353   9e-114   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031943.1|  DEAD-box ATP-dependent RNA helicase 3              353   9e-114   Arabidopsis thaliana [mouse-ear cress]
gb|AAM91087.1|  At5g26740                                               353   1e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CAA09196.1|  RNA helicase                                           353   1e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004135577.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    353   1e-113   Cucumis sativus [cucumbers]
ref|XP_010493908.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    353   2e-113   
ref|XP_010455001.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    353   2e-113   Camelina sativa [gold-of-pleasure]
ref|XP_007145071.1|  hypothetical protein PHAVU_007G207200g             352   4e-113   Phaseolus vulgaris [French bean]
gb|EMS52116.1|  DEAD-box ATP-dependent RNA helicase 3, chloroplastic    355   6e-113   Triticum urartu
gb|KFK26417.1|  hypothetical protein AALP_AA8G245800                    351   9e-113   Arabis alpina [alpine rockcress]
ref|XP_006394884.1|  hypothetical protein EUTSA_v10003698mg             349   5e-112   Eutrema salsugineum [saltwater cress]
ref|XP_009111705.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    348   6e-112   Brassica rapa
ref|XP_009129927.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    347   2e-111   Brassica rapa
emb|CDY05524.1|  BnaA02g31670D                                          347   2e-111   
emb|CDY66725.1|  BnaC02g48430D                                          346   5e-111   Brassica napus [oilseed rape]
emb|CDX80564.1|  BnaC07g28800D                                          345   8e-111   
emb|CDY19766.1|  BnaA09g04190D                                          346   1e-110   Brassica napus [oilseed rape]
ref|XP_009151140.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    345   3e-110   Brassica rapa
emb|CDY61108.1|  BnaA06g39420D                                          343   1e-109   Brassica napus [oilseed rape]
gb|ABR16298.1|  unknown                                                 343   4e-109   Picea sitchensis
gb|AHW45791.1|  DEAD-box ATP-dependent RNA helicase 3                   340   1e-108   Brassica rapa subsp. chinensis [bok-choy]
dbj|BAJ90819.1|  predicted protein                                      298   2e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABF99668.1|  DEAD/DEAH box helicase family protein, expressed        307   1e-97    Oryza sativa Japonica Group [Japonica rice]
gb|ABF99667.1|  DEAD/DEAH box helicase family protein, expressed        307   2e-97    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130659.1|  uncharacterized protein LOC100191761               306   3e-97    Zea mays [maize]
ref|XP_006650834.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    306   4e-97    Oryza brachyantha
ref|XP_001753075.1|  predicted protein                                  309   3e-96    
ref|XP_001773524.1|  predicted protein                                  300   2e-94    
ref|XP_001753085.1|  predicted protein                                  291   7e-91    
ref|XP_001762375.1|  predicted protein                                  284   1e-87    
gb|AIE38016.1|  DEAD-box RNA helicase 1                                 286   1e-87    Equisetum arvense [common horsetail]
gb|KDO64254.1|  hypothetical protein CISIN_1g007084mg                   278   2e-87    Citrus sinensis [apfelsine]
gb|KDO64255.1|  hypothetical protein CISIN_1g007084mg                   277   3e-87    Citrus sinensis [apfelsine]
emb|CBI31778.3|  unnamed protein product                                280   3e-87    Vitis vinifera
emb|CAN60235.1|  hypothetical protein VITISV_028850                     281   1e-86    Vitis vinifera
gb|KDO64256.1|  hypothetical protein CISIN_1g007084mg                   272   3e-86    Citrus sinensis [apfelsine]
ref|XP_002284103.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    280   3e-86    Vitis vinifera
ref|XP_010258650.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    278   1e-85    Nelumbo nucifera [Indian lotus]
gb|KDO64251.1|  hypothetical protein CISIN_1g007084mg                   277   1e-85    Citrus sinensis [apfelsine]
ref|XP_006429692.1|  hypothetical protein CICLE_v10013510mg             275   7e-85    Citrus clementina [clementine]
ref|XP_002990210.1|  hypothetical protein SELMODRAFT_30996              275   9e-85    
ref|XP_002992481.1|  hypothetical protein SELMODRAFT_30997              275   9e-85    
ref|XP_006836382.1|  hypothetical protein AMTR_s00092p00127820          274   1e-84    
emb|CDY37406.1|  BnaC05g30240D                                          270   4e-84    Brassica napus [oilseed rape]
ref|XP_010466510.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   1e-83    Camelina sativa [gold-of-pleasure]
ref|XP_002973699.1|  hypothetical protein SELMODRAFT_99603              267   1e-83    
ref|XP_006382235.1|  hypothetical protein POPTR_0005s00210g             265   2e-83    
ref|NP_188870.1|  DEAD-box ATP-dependent RNA helicase                   271   2e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004149532.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   3e-83    
gb|KJB75399.1|  hypothetical protein B456_012G039900                    266   3e-83    Gossypium raimondii
ref|XP_009145390.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   4e-83    Brassica rapa
ref|XP_010036054.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   4e-83    Eucalyptus grandis [rose gum]
gb|KFK39521.1|  hypothetical protein AALP_AA3G255300                    270   4e-83    Arabis alpina [alpine rockcress]
emb|CDY10634.1|  BnaA05g17280D                                          270   4e-83    Brassica napus [oilseed rape]
ref|XP_010511242.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   5e-83    Camelina sativa [gold-of-pleasure]
emb|CDY37408.1|  BnaC05g30220D                                          270   5e-83    Brassica napus [oilseed rape]
gb|KHN38369.1|  DEAD-box ATP-dependent RNA helicase 53                  266   5e-83    Glycine soja [wild soybean]
gb|KGN54960.1|  hypothetical protein Csa_4G616790                       271   6e-83    Cucumis sativus [cucumbers]
ref|XP_010916633.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   6e-83    Elaeis guineensis
ref|XP_004162573.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   6e-83    
ref|XP_010488255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   7e-83    
emb|CDY46329.1|  BnaC01g31630D                                          268   7e-83    Brassica napus [oilseed rape]
ref|XP_002883355.1|  hypothetical protein ARALYDRAFT_479746             270   9e-83    
ref|XP_010488254.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   9e-83    Camelina sativa [gold-of-pleasure]
ref|XP_008464653.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   1e-82    Cucumis melo [Oriental melon]
ref|NP_188872.2|  putative mitochondrial RNA helicase 2                 269   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297246.1|  hypothetical protein CARUB_v10013251mg             268   2e-82    Capsella rubella
ref|XP_010112885.1|  DEAD-box ATP-dependent RNA helicase 53             271   2e-82    
ref|XP_010511251.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010906630.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    270   2e-82    Elaeis guineensis
ref|XP_010488258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   2e-82    Camelina sativa [gold-of-pleasure]
ref|XP_002883354.1|  hypothetical protein ARALYDRAFT_479744             268   2e-82    
ref|XP_006406184.1|  hypothetical protein EUTSA_v10020296mg             269   2e-82    Eutrema salsugineum [saltwater cress]
ref|XP_010488257.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   3e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010466515.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   3e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010466514.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   3e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010511255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   3e-82    Camelina sativa [gold-of-pleasure]
ref|XP_010904642.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   3e-82    
ref|XP_006406182.1|  hypothetical protein EUTSA_v10020290mg             268   4e-82    Eutrema salsugineum [saltwater cress]
ref|XP_010904640.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   4e-82    Elaeis guineensis
ref|XP_010466512.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   4e-82    Camelina sativa [gold-of-pleasure]
ref|XP_007141482.1|  hypothetical protein PHAVU_008G199700g             268   5e-82    Phaseolus vulgaris [French bean]
ref|XP_008776036.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   5e-82    Phoenix dactylifera
ref|XP_009108947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    267   6e-82    Brassica rapa
ref|XP_008776030.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    269   6e-82    Phoenix dactylifera
ref|XP_003518490.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    267   7e-82    Glycine max [soybeans]
gb|KFK39522.1|  hypothetical protein AALP_AA3G255500                    267   1e-81    Arabis alpina [alpine rockcress]
gb|KHG04586.1|  DEAD-box ATP-dependent RNA helicase 53 -like protein    267   1e-81    Gossypium arboreum [tree cotton]
ref|XP_003545384.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    266   1e-81    Glycine max [soybeans]
gb|KJB75398.1|  hypothetical protein B456_012G039900                    267   1e-81    Gossypium raimondii
ref|XP_008804703.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   1e-81    Phoenix dactylifera
ref|XP_008805257.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    266   1e-81    
ref|XP_006829732.1|  hypothetical protein AMTR_s00126p00110160          267   2e-81    Amborella trichopoda
ref|XP_006297190.1|  hypothetical protein CARUB_v10013195mg             266   3e-81    Capsella rubella
ref|XP_002976111.1|  hypothetical protein SELMODRAFT_10661              265   5e-81    
sp|Q0D8N0.2|RH53_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    264   6e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002968267.1|  hypothetical protein SELMODRAFT_10677              265   7e-81    
gb|AET00260.2|  DEAD-box ATP-dependent RNA helicase-like protein        264   7e-81    Medicago truncatula
ref|XP_004491264.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    264   8e-81    Cicer arietinum [garbanzo]
ref|XP_004499961.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    263   1e-80    Cicer arietinum [garbanzo]
gb|KEH33610.1|  DEAD-box ATP-dependent RNA helicase-like protein        262   2e-80    Medicago truncatula
ref|XP_007048882.1|  DEAD-box ATP-dependent RNA helicase 53 isofo...    264   2e-80    
ref|XP_007048884.1|  DEAD-box ATP-dependent RNA helicase 53 isofo...    264   2e-80    
gb|KEH33609.1|  DEAD-box ATP-dependent RNA helicase-like protein        262   3e-80    Medicago truncatula
ref|XP_003557638.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    262   6e-80    Brachypodium distachyon [annual false brome]
gb|KHN28526.1|  DEAD-box ATP-dependent RNA helicase 53                  260   6e-80    Glycine soja [wild soybean]
ref|XP_002308835.2|  hypothetical protein POPTR_0006s02500g             260   9e-80    
ref|XP_007217634.1|  hypothetical protein PRUPE_ppa002643mg             262   1e-79    Prunus persica
ref|XP_008380050.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    258   1e-79    
ref|XP_011040644.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   2e-79    Populus euphratica
ref|XP_006602288.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   2e-79    
ref|XP_011004482.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   2e-79    Populus euphratica
ref|XP_006380943.1|  hypothetical protein POPTR_0006s02500g             260   2e-79    Populus trichocarpa [western balsam poplar]
ref|XP_002461445.1|  hypothetical protein SORBIDRAFT_02g002790          260   2e-79    Sorghum bicolor [broomcorn]
ref|XP_008229751.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    261   2e-79    Prunus mume [ume]
ref|XP_006602287.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   2e-79    
ref|XP_006602283.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   3e-79    Glycine max [soybeans]
ref|XP_006602286.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   3e-79    
ref|XP_006602279.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   4e-79    
dbj|BAJ89481.1|  predicted protein                                      260   4e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006602284.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   4e-79    Glycine max [soybeans]
ref|XP_003553167.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   4e-79    Glycine max [soybeans]
ref|XP_004955446.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    259   4e-79    
ref|XP_006602282.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   5e-79    Glycine max [soybeans]
ref|XP_011467638.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   5e-79    Fragaria vesca subsp. vesca
ref|XP_006602281.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   5e-79    Glycine max [soybeans]
gb|EMS54347.1|  DEAD-box ATP-dependent RNA helicase 53                  259   5e-79    Triticum urartu
ref|XP_003617301.1|  DEAD-box ATP-dependent RNA helicase                263   7e-79    
ref|XP_008348328.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    256   7e-79    
ref|XP_008342283.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    259   7e-79    
ref|XP_006664735.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    258   8e-79    Oryza brachyantha
ref|XP_010532528.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    259   1e-78    Tarenaya hassleriana [spider flower]
ref|XP_010551735.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    264   1e-78    Tarenaya hassleriana [spider flower]
ref|XP_010551734.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    264   1e-78    Tarenaya hassleriana [spider flower]
ref|XP_010551733.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    264   2e-78    Tarenaya hassleriana [spider flower]
ref|XP_010688871.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    258   3e-78    Beta vulgaris subsp. vulgaris [field beet]
gb|KDP21988.1|  hypothetical protein JCGZ_02878                         258   3e-78    Jatropha curcas
ref|XP_006658271.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    257   4e-78    Oryza brachyantha
ref|XP_002502509.1|  DEAD/DEAH box RNA helicase                         260   6e-78    Micromonas commoda
ref|XP_010323935.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    256   1e-77    
ref|NP_001147777.1|  nucleolar RNA helicase 2                           256   1e-77    
emb|CDP16079.1|  unnamed protein product                                257   1e-77    Coffea canephora [robusta coffee]
ref|XP_007146300.1|  hypothetical protein PHAVU_006G028900g             253   5e-77    Phaseolus vulgaris [French bean]
gb|EYU43163.1|  hypothetical protein MIMGU_mgv1a003141mg                253   6e-77    Erythranthe guttata [common monkey flower]
ref|XP_002323192.2|  hypothetical protein POPTR_0016s02340g             254   8e-77    Populus trichocarpa [western balsam poplar]
ref|XP_011085434.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    254   1e-76    Sesamum indicum [beniseed]
gb|EYU43162.1|  hypothetical protein MIMGU_mgv1a003141mg                253   1e-76    Erythranthe guttata [common monkey flower]
ref|XP_011010099.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    253   1e-76    Populus euphratica
ref|XP_003530710.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    253   1e-76    Glycine max [soybeans]
gb|KHM99686.1|  DEAD-box ATP-dependent RNA helicase 53                  253   1e-76    Glycine soja [wild soybean]
ref|XP_006352957.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    253   2e-76    Solanum tuberosum [potatoes]
ref|XP_003056927.1|  DEAD/DEAH box RNA helicase                         256   2e-76    Micromonas pusilla CCMP1545
ref|XP_009787018.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    253   3e-76    Nicotiana sylvestris
ref|XP_009593230.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    252   5e-76    Nicotiana tomentosiformis
ref|XP_009591168.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    252   7e-76    Nicotiana tomentosiformis
ref|XP_004963159.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    251   1e-75    
ref|XP_009771005.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    251   1e-75    Nicotiana sylvestris
ref|XP_009388962.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    251   1e-75    Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS73227.1|  hypothetical protein M569_01530                         248   5e-75    Genlisea aurea
ref|XP_008647316.1|  PREDICTED: uncharacterized protein LOC100501...    249   6e-75    Zea mays [maize]
ref|XP_004303914.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    249   6e-75    Fragaria vesca subsp. vesca
ref|XP_009388961.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    250   6e-75    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_005642988.1|  DEAD-domain-containing protein                     250   8e-75    Coccomyxa subellipsoidea C-169
ref|NP_001183357.1|  putative DEAD-box ATP-dependent RNA helicase...    244   2e-74    Zea mays [maize]
ref|XP_002443537.1|  hypothetical protein SORBIDRAFT_08g021180          246   6e-74    Sorghum bicolor [broomcorn]
gb|EAY83860.1|  hypothetical protein OsI_39082                          245   3e-73    Oryza sativa Indica Group [Indian rice]
sp|Q0ILZ4.1|RH9_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA h...    244   4e-73    Oryza sativa Japonica Group [Japonica rice]
gb|EEE53593.1|  hypothetical protein OsJ_36838                          244   1e-72    Oryza sativa Japonica Group [Japonica rice]
dbj|BAK08013.1|  predicted protein                                      243   2e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA55122.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    237   7e-72    
ref|XP_008674301.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    240   1e-71    Zea mays [maize]
ref|XP_002520585.1|  dead box ATP-dependent RNA helicase, putative      233   1e-71    
tpg|DAA59526.2|  TPA: putative DEAD-box ATP-dependent RNA helicas...    229   1e-70    
ref|XP_004251555.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    238   1e-70    Solanum lycopersicum
ref|XP_003577522.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   6e-70    Brachypodium distachyon [annual false brome]
ref|XP_006351994.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   8e-70    Solanum tuberosum [potatoes]
ref|XP_006351993.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   9e-70    Solanum tuberosum [potatoes]
ref|XP_006351991.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    236   1e-69    Solanum tuberosum [potatoes]
emb|CEF97957.1|  Helicase, C-terminal                                   236   6e-69    Ostreococcus tauri
ref|XP_003079318.1|  ATP-dependent RNA helicase (ISS)                   234   6e-69    
gb|KCW45861.1|  hypothetical protein EUGRSUZ_L00282                     230   1e-68    Eucalyptus grandis [rose gum]
ref|XP_007514064.1|  predicted protein                                  236   2e-68    Bathycoccus prasinos
gb|KCW45860.1|  hypothetical protein EUGRSUZ_L00282                     230   2e-68    Eucalyptus grandis [rose gum]
ref|XP_004300419.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    228   2e-68    Fragaria vesca subsp. vesca
ref|XP_011468632.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    228   3e-68    Fragaria vesca subsp. vesca
ref|XP_008653609.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    229   7e-68    
ref|XP_008666359.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    221   2e-67    
ref|XP_002954582.1|  hypothetical protein VOLCADRAFT_82854              223   5e-67    Volvox carteri f. nagariensis
ref|WP_011529747.1|  RNA helicase                                       225   5e-66    Deinococcus geothermalis
ref|WP_019586850.1|  RNA helicase                                       223   4e-65    Deinococcus apachensis
ref|WP_025568025.1|  RNA helicase                                       222   6e-65    Deinococcus wulumuqiensis
ref|WP_034337391.1|  RNA helicase                                       221   1e-64    Deinococcus misasensis
ref|WP_017869532.1|  RNA helicase                                       221   1e-64    
ref|XP_001417991.1|  predicted protein                                  215   2e-64    
gb|KDO35219.1|  hypothetical protein SPRG_00065                         223   2e-64    
ref|WP_014685248.1|  RNA helicase                                       220   3e-64    
ref|WP_034404761.1|  RNA helicase                                       220   4e-64    
ref|WP_034384892.1|  RNA helicase                                       219   5e-64    
ref|WP_027460038.1|  RNA helicase                                       219   8e-64    
ref|WP_034341698.1|  RNA helicase                                       218   1e-63    
dbj|BAE71238.1|  hypothetical protein                                   214   2e-63    
ref|WP_013557636.1|  RNA helicase                                       218   3e-63    
ref|XP_001697172.1|  hypothetical protein CHLREDRAFT_119793             212   4e-63    
ref|WP_034358487.1|  RNA helicase                                       217   4e-63    
ref|XP_005844807.1|  hypothetical protein CHLNCDRAFT_36787              219   5e-63    
ref|XP_005833945.1|  hypothetical protein GUITHDRAFT_159596             218   1e-62    
ref|WP_015236876.1|  DNA/RNA helicase                                   214   4e-62    
ref|WP_029480358.1|  RNA helicase                                       215   4e-62    
ref|WP_029479098.1|  RNA helicase                                       214   1e-61    
ref|WP_027479878.1|  RNA helicase                                       213   3e-61    
pdb|4KBF|A  Chain A, Two Different Open Conformations Of The Heli...    204   2e-60    
ref|WP_039684150.1|  RNA helicase                                       209   5e-60    
ref|WP_027461758.1|  RNA helicase                                       208   9e-60    
ref|WP_022801760.1|  RNA helicase                                       208   9e-60    
ref|WP_012693774.1|  RNA helicase                                       207   3e-59    
ref|WP_014509839.1|  DEAD/DEAH box helicase                             205   4e-59    
ref|WP_013614915.1|  RNA helicase                                       207   4e-59    
pdb|3MWJ|A  Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Dom...    196   5e-59    
pdb|2GXQ|A  Chain A, Hera N-Terminal Domain In Complex With Amp, ...    196   5e-59    
gb|ERZ97705.1|  hypothetical protein GLOINDRAFT_340006                  208   7e-59    
emb|CAA65745.1|  heat resistant RNA dependent ATPase                    204   8e-59    
gb|AAS82237.1|  heat resistant RNA dependent ATPase                     204   1e-58    
ref|WP_024118950.1|  DEAD/DEAH box helicase                             204   1e-58    
ref|WP_011227716.1|  DEAD/DEAH box helicase                             204   1e-58    
ref|WP_041443764.1|  DEAD/DEAH box helicase                             204   1e-58    
gb|KGQ22660.2|  DEAD/DEAH box helicase                                  204   1e-58    
ref|XP_009832022.1|  hypothetical protein H257_07980                    206   2e-58    
gb|KDD76076.1|  DEAD/DEAH box helicase                                  197   2e-58    
gb|KFH66922.1|  hypothetical protein MVEG_07447                         205   4e-58    
ref|WP_014630217.1|  DEAD/DEAH box helicase                             202   5e-58    
ref|WP_013702947.1|  DEAD/DEAH box helicase                             202   5e-58    
ref|XP_002289813.1|  RNA helicase                                       201   5e-58    
ref|XP_008866608.1|  hypothetical protein H310_04172                    204   9e-58    
ref|WP_028493347.1|  DEAD/DEAH box helicase                             201   1e-57    
ref|WP_038032505.1|  DEAD/DEAH box helicase                             201   1e-57    
ref|WP_038070307.1|  DEAD/DEAH box helicase                             201   1e-57    
ref|XP_004334405.1|  DEAD/DEAH box helicase domain containing pro...    204   1e-57    
ref|XP_006676381.1|  hypothetical protein BATDEDRAFT_84954              204   2e-57    
ref|XP_005825225.1|  hypothetical protein GUITHDRAFT_158516             198   2e-57    
ref|WP_015717873.1|  DEAD/DEAH box helicase                             199   5e-57    
ref|WP_013157226.1|  DEAD/DEAH box helicase                             200   6e-57    
gb|ETP29814.1|  hypothetical protein F442_21078                         201   2e-56    
gb|ETI31844.1|  hypothetical protein F443_21248                         201   2e-56    
ref|WP_019550323.1|  DEAD/DEAH box helicase                             198   3e-56    
ref|WP_036270060.1|  DEAD/DEAH box helicase                             197   4e-56    
ref|XP_001702450.1|  RNA helicase                                       200   4e-56    
ref|WP_018111713.1|  DEAD/DEAH box helicase                             197   5e-56    
ref|WP_026234151.1|  DEAD/DEAH box helicase                             196   6e-56    
ref|WP_016329945.1|  DNA/RNA helicase, superfamily II                   196   6e-56    
ref|XP_008914911.1|  hypothetical protein PPTG_18629                    199   9e-56    
ref|WP_003045265.1|  DEAD/DEAH box helicase                             196   1e-55    
ref|WP_027891433.1|  DEAD/DEAH box helicase                             196   1e-55    
ref|WP_039456624.1|  DEAD/DEAH box helicase                             196   1e-55    
ref|WP_027886523.1|  MULTISPECIES: DEAD/DEAH box helicase               196   1e-55    
ref|WP_013015065.1|  DEAD/DEAH box helicase                             196   2e-55    
ref|WP_024050610.1|  DEAD/DEAH box helicase                             196   2e-55    
ref|WP_038041581.1|  DEAD/DEAH box helicase                             195   3e-55    
ref|WP_019008173.1|  RNA helicase                                       196   3e-55    
ref|WP_027876834.1|  DEAD/DEAH box helicase                             196   3e-55    
ref|XP_009532454.1|  hypothetical protein PHYSODRAFT_547952             196   8e-55    
ref|XP_002955657.1|  hypothetical protein VOLCADRAFT_66087              196   9e-55    
ref|WP_038045492.1|  DEAD/DEAH box helicase                             193   9e-55    
ref|XP_786504.3|  PREDICTED: nucleolar RNA helicase 2-like              196   1e-54    
emb|CBJ26838.1|  DEAD box helicase                                      196   1e-54    
gb|ETK84781.1|  hypothetical protein L915_10285                         196   1e-54    
ref|WP_013456952.1|  DEAD/DEAH box helicase                             193   1e-54    
ref|XP_005708224.1|  ATP-dependent RNA helicase                         196   1e-54    
ref|XP_008893573.1|  hypothetical protein PPTG_01933                    196   1e-54    
ref|XP_005535707.1|  nucleolar RNA helicase II/Gu                       195   3e-54    
ref|WP_014516186.1|  DEAD/DEAH box helicase                             192   3e-54    
ref|XP_009520796.1|  hypothetical protein PHYSODRAFT_326516             196   4e-54    
ref|WP_022797334.1|  DEAD/DEAH box helicase                             191   5e-54    
emb|CCI10877.1|  unnamed protein product                                193   9e-54    
ref|XP_001742267.1|  hypothetical protein                               192   1e-53    
ref|XP_009038465.1|  hypothetical protein AURANDRAFT_28650              189   2e-53    
ref|WP_018466973.1|  hypothetical protein                               190   2e-53    
ref|XP_004344972.1|  nucleolar RNA helicase 2                           193   2e-53    
emb|CCA23433.1|  DEAD/DEAH box RNA helicase putative                    192   3e-53    
gb|EOB09008.1|  Nucleolar RNA helicase 2                                191   3e-53    
ref|XP_010887236.1|  PREDICTED: nucleolar RNA helicase 2-like           192   5e-53    
ref|XP_008873274.1|  hypothetical protein H310_09087                    191   7e-53    
ref|XP_006820781.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    191   7e-53    
ref|XP_002738237.2|  PREDICTED: nucleolar RNA helicase 2-like iso...    191   7e-53    
ref|NP_001120807.1|  nucleolar RNA helicase 2                           191   9e-53    
ref|XP_005854803.1|  dead deah box rna                                  191   9e-53    
gb|EWM21167.1|  dead deah box rna                                       191   9e-53    
emb|CBN74178.1|  DEAD box helicase                                      192   1e-52    
ref|XP_008611506.1|  hypothetical protein SDRG_07451                    190   1e-52    
ref|XP_001764376.1|  predicted protein                                  190   1e-52    
ref|XP_005776221.1|  hypothetical protein EMIHUDRAFT_443976             191   1e-52    
gb|KDO19871.1|  hypothetical protein SPRG_14901                         190   1e-52    
gb|ACH85363.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21               189   1e-52    
ref|XP_002975210.1|  hypothetical protein SELMODRAFT_150370             189   2e-52    
ref|XP_005009180.1|  PREDICTED: nucleolar RNA helicase 2                190   2e-52    
ref|XP_010109082.1|  DEAD-box ATP-dependent RNA helicase 7              189   2e-52    
ref|XP_009499705.1|  PREDICTED: nucleolar RNA helicase 2-like           189   3e-52    
ref|XP_002977618.1|  hypothetical protein SELMODRAFT_107027             189   4e-52    
ref|XP_007253242.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    189   5e-52    
ref|XP_009993186.1|  PREDICTED: nucleolar RNA helicase 2-like           185   6e-52    
ref|XP_007253243.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    189   7e-52    
ref|XP_009674661.1|  PREDICTED: nucleolar RNA helicase 2-like           188   8e-52    
ref|XP_006273541.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    186   1e-51    
ref|XP_002866477.1|  hypothetical protein ARALYDRAFT_496396             187   1e-51    
gb|KJB39373.1|  hypothetical protein B456_007G009400                    186   1e-51    
ref|XP_010302670.1|  PREDICTED: nucleolar RNA helicase 2-like           187   1e-51    
ref|XP_009484668.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...    187   1e-51    
ref|WP_013178590.1|  DEAD/DEAH box helicase                             185   1e-51    
ref|XP_007423216.1|  PREDICTED: nucleolar RNA helicase 2                186   2e-51    
ref|XP_005645158.1|  DEAD-domain-containing protein                     187   2e-51    
ref|XP_006023204.1|  PREDICTED: nucleolar RNA helicase 2-like           187   2e-51    
ref|XP_001232052.1|  PREDICTED: nucleolar RNA helicase 2                187   2e-51    
ref|XP_010712591.1|  PREDICTED: nucleolar RNA helicase 2-like           187   2e-51    
emb|CDQ75565.1|  unnamed protein product                                187   2e-51    
gb|KJB39371.1|  hypothetical protein B456_007G009400                    186   2e-51    
emb|CAH93507.1|  hypothetical protein                                   182   2e-51    
ref|XP_006273542.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    187   2e-51    
ref|XP_010458375.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    186   2e-51    
ref|XP_006780037.1|  PREDICTED: nucleolar RNA helicase 2-like           187   2e-51    
ref|XP_010483921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    186   3e-51    
ref|XP_009324264.1|  PREDICTED: nucleolar RNA helicase 2-like           186   3e-51    
ref|XP_010011653.1|  PREDICTED: nucleolar RNA helicase 2-like           186   3e-51    
ref|XP_010293567.1|  PREDICTED: nucleolar RNA helicase 2-like           186   3e-51    
gb|AAK62631.1|  AT5g62190/mmi9_10                                       186   3e-51    
ref|XP_010444062.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    186   3e-51    
ref|XP_005733301.1|  PREDICTED: nucleolar RNA helicase 2-like           187   3e-51    
ref|XP_010133283.1|  PREDICTED: nucleolar RNA helicase 2-like           186   3e-51    
ref|XP_005433606.1|  PREDICTED: nucleolar RNA helicase 2-like           186   3e-51    
ref|XP_005235247.1|  PREDICTED: nucleolar RNA helicase 2-like           186   3e-51    
ref|XP_009635265.1|  PREDICTED: nucleolar RNA helicase 2-like           186   4e-51    
ref|XP_005849733.1|  hypothetical protein CHLNCDRAFT_20835              185   4e-51    
ref|XP_009288852.1|  PREDICTED: nucleolar RNA helicase 2-like           186   4e-51    
ref|XP_005915179.1|  PREDICTED: nucleolar RNA helicase 2-like           187   4e-51    
ref|XP_004539930.1|  PREDICTED: nucleolar RNA helicase 2-like           187   4e-51    
gb|KDO65345.1|  hypothetical protein CISIN_1g005470mg                   184   4e-51    
ref|XP_009806451.1|  PREDICTED: nucleolar RNA helicase 2-like           186   4e-51    
ref|XP_009967651.1|  PREDICTED: nucleolar RNA helicase 2-like           186   4e-51    
ref|XP_005467227.1|  PREDICTED: nucleolar RNA helicase 2-like           186   4e-51    
gb|KDO65346.1|  hypothetical protein CISIN_1g005470mg                   185   4e-51    
ref|XP_009913610.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...    186   4e-51    
ref|XP_009464337.1|  PREDICTED: nucleolar RNA helicase 2-like           186   4e-51    
ref|XP_006279587.1|  hypothetical protein CARUB_v10026032mg             186   5e-51    
gb|KJB39370.1|  hypothetical protein B456_007G009400                    186   6e-51    
ref|XP_010034995.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    186   6e-51    
ref|XP_009987183.1|  PREDICTED: nucleolar RNA helicase 2-like           186   6e-51    
gb|KHG06828.1|  DEAD-box ATP-dependent RNA helicase 7                   186   6e-51    
gb|KJB39369.1|  hypothetical protein B456_007G009400                    186   6e-51    
gb|KHG06829.1|  DEAD-box ATP-dependent RNA helicase 7                   186   6e-51    
ref|XP_010578254.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    186   6e-51    
ref|XP_010578253.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    186   6e-51    
ref|XP_010126598.1|  PREDICTED: nucleolar RNA helicase 2-like           184   7e-51    
ref|XP_005048019.1|  PREDICTED: nucleolar RNA helicase 2-like           185   7e-51    
gb|ERE87826.1|  nucleolar RNA helicase 2-like protein                   182   7e-51    
ref|XP_009863017.1|  PREDICTED: nucleolar RNA helicase 2-like           185   8e-51    
ref|XP_008641093.1|  PREDICTED: nucleolar RNA helicase 2-like           185   8e-51    
ref|XP_006394423.1|  hypothetical protein EUTSA_v10003756mg             185   9e-51    
gb|KDO65344.1|  hypothetical protein CISIN_1g005470mg                   184   9e-51    
gb|EGH06265.1|  ATP-dependent RNA helicase rhlE                         177   1e-50    
emb|CBK20101.2|  unnamed protein product                                183   1e-50    
ref|XP_005718016.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21-li...    185   1e-50    
ref|XP_007938868.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   1e-50    
ref|XP_009837773.1|  hypothetical protein H257_12310                    185   1e-50    
ref|NP_001067252.2|  Os12g0611200                                       173   1e-50    
ref|XP_002904811.1|  DEAD/DEAH box RNA helicase, putative               185   1e-50    
ref|XP_008290699.1|  PREDICTED: nucleolar RNA helicase 2-like           185   1e-50    
ref|XP_010399213.1|  PREDICTED: nucleolar RNA helicase 2-like           185   1e-50    
ref|NP_001013216.2|  ATP-dependent RNA helicase DDX50                   185   1e-50    
ref|XP_009905419.1|  PREDICTED: nucleolar RNA helicase 2-like           185   1e-50    
ref|XP_003578458.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   1e-50    
gb|EDL92963.1|  rCG22084, isoform CRA_b                                 184   1e-50    
ref|XP_007938867.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   1e-50    
ref|XP_005429045.1|  PREDICTED: nucleolar RNA helicase 2-like           184   2e-50    
gb|KDO65342.1|  hypothetical protein CISIN_1g005470mg                   184   2e-50    
gb|EYU19497.1|  hypothetical protein MIMGU_mgv1a002250mg                184   2e-50    
ref|XP_009094281.1|  PREDICTED: nucleolar RNA helicase 2-like           184   2e-50    
ref|XP_010221060.1|  PREDICTED: uncharacterized protein LOC104575417    187   2e-50    
ref|XP_009695874.1|  PREDICTED: nucleolar RNA helicase 2-like           184   2e-50    
emb|CEG79803.1|  hypothetical protein RMATCC62417_14224                 181   2e-50    
ref|XP_005491115.1|  PREDICTED: nucleolar RNA helicase 2-like           184   2e-50    
ref|XP_006421777.1|  hypothetical protein CICLE_v10004459mg             184   2e-50    
ref|XP_005907372.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   2e-50    
ref|XP_005226487.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   2e-50    
gb|EGH45114.1|  helicase                                                176   2e-50    
ref|XP_005699182.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   2e-50    
ref|XP_004680885.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   2e-50    
ref|XP_006060393.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   2e-50    
ref|XP_005429044.1|  PREDICTED: nucleolar RNA helicase 2-like           183   2e-50    
ref|XP_005699181.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   2e-50    
ref|XP_009955676.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...    184   2e-50    
ref|XP_006060388.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   2e-50    
ref|NP_201025.1|  DEAD/DEAH box RNA helicase PRH75                      184   2e-50    
ref|XP_005990005.1|  PREDICTED: nucleolar RNA helicase 2                182   2e-50    
ref|XP_009942746.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...    184   3e-50    
ref|XP_005978744.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    183   3e-50    
gb|EMS53462.1|  DEAD-box ATP-dependent RNA helicase 9                   181   3e-50    
ref|XP_007121106.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   3e-50    
ref|XP_005153742.1|  PREDICTED: nucleolar RNA helicase 2-like           184   3e-50    
ref|XP_010337728.1|  PREDICTED: ATP-dependent RNA helicase DDX50        183   3e-50    
ref|XP_004049567.1|  PREDICTED: ATP-dependent RNA helicase DDX50        183   3e-50    
ref|XP_008495910.1|  PREDICTED: nucleolar RNA helicase 2-like           184   3e-50    
ref|XP_005530565.1|  PREDICTED: nucleolar RNA helicase 2-like           184   3e-50    
gb|EPS64456.1|  hypothetical protein M569_10323                         184   3e-50    
ref|NP_001192982.1|  ATP-dependent RNA helicase DDX50                   184   3e-50    
ref|XP_009575208.1|  PREDICTED: nucleolar RNA helicase 2-like           183   3e-50    
ref|WP_017095575.1|  RNA helicase                                       179   3e-50    
ref|XP_008467258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    183   3e-50    
ref|XP_004393747.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    183   3e-50    
ref|XP_005326062.1|  PREDICTED: ATP-dependent RNA helicase DDX50        184   3e-50    
ref|XP_009703721.1|  PREDICTED: nucleolar RNA helicase 2-like           181   3e-50    
ref|XP_008830864.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    183   3e-50    
ref|XP_004680884.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    184   4e-50    
ref|XP_005048018.1|  PREDICTED: nucleolar RNA helicase 2-like           184   4e-50    
ref|XP_008071282.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    183   4e-50    
ref|XP_009487807.1|  PREDICTED: nucleolar RNA helicase 2-like           182   4e-50    



>ref|XP_011087584.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Sesamum indicum]
Length=770

 Score =   389 bits (998),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 194/216 (90%), Positives = 204/216 (94%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPIIK + + EQ K S RRGRLP+VLVLAPTRELA
Sbjct  147  LVPALEGRDIIARAKTGTGKTLAFGIPIIKGL-DAEQEKGSLRRGRLPKVLVLAPTRELA  205

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE KESAP+LNT CI GGVSYVTQESALSRGVDVVVGTPGR+IDLINNNSLKLGEV
Sbjct  206  KQVEKEFKESAPYLNTVCIYGGVSYVTQESALSRGVDVVVGTPGRIIDLINNNSLKLGEV  265

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVEVILEKLPS+RQSMLFSATMP WVKKLARK+LNNPLTIDL
Sbjct  266  QYLVLDEADQMLAVGFEEDVEVILEKLPSERQSMLFSATMPGWVKKLARKFLNNPLTIDL  325

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD+EEKLAEGIKLYAIPTTATSKRTIL DL+ VYA
Sbjct  326  VGDQEEKLAEGIKLYAIPTTATSKRTILGDLVTVYA  361



>ref|XP_009604645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=738

 Score =   384 bits (987),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 206/216 (95%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIP++K+++ DE+ + + RRGRLP++LVLAPTRELA
Sbjct  131  LVPALEGRDIIARAKTGTGKTLAFGIPVLKKLSGDEEIRNTLRRGRLPKILVLAPTRELA  190

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE+KESAP+LNT CI GGVSY TQ++AL+RGVDVVVGTPGRLIDLINNN+LKLGEV
Sbjct  191  KQVEKEMKESAPYLNTVCIYGGVSYATQQNALTRGVDVVVGTPGRLIDLINNNTLKLGEV  250

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMP WVKKLARKYLNNPLTIDL
Sbjct  251  EYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPGWVKKLARKYLNNPLTIDL  310

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD+EEKLAEGIKLYA+ TTATSKRTILSDL+ VYA
Sbjct  311  VGDQEEKLAEGIKLYALSTTATSKRTILSDLVTVYA  346



>ref|XP_003554590.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Glycine max]
Length=771

 Score =   385 bits (989),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPIIK +TEDE +   +R GRLPR LVLAPTRELA
Sbjct  141  LVPALEGRDIIARAKTGTGKTLAFGIPIIKGLTEDEHAPSHRRSGRLPRFLVLAPTRELA  200

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+L+T C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDLIN NSLKL EV
Sbjct  201  KQVEKEIKESAPYLSTVCVYGGVSYVTQQSALSRGVDVVVGTPGRIIDLINGNSLKLSEV  260

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVE+ILE LPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL
Sbjct  261  QYLVLDEADQMLAVGFEEDVEMILENLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  320

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGDEEEKLAEGIKLYAI  TATSKRTILSDL+ VYA
Sbjct  321  VGDEEEKLAEGIKLYAIAATATSKRTILSDLVTVYA  356



>ref|XP_009604646.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=737

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 206/216 (95%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIP++K+++ DE+ + + RRGRLP++LVLAPTRELA
Sbjct  131  LVPALEGRDIIARAKTGTGKTLAFGIPVLKKLSGDEEIRNTLRRGRLPKILVLAPTRELA  190

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE+KESAP+LNT CI GGVSY TQ++AL+RGVDVVVGTPGRLIDLINNN+LKLGEV
Sbjct  191  KQVEKEMKESAPYLNTVCIYGGVSYATQQNALTRGVDVVVGTPGRLIDLINNNTLKLGEV  250

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMP WVKKLARKYLNNPLTIDL
Sbjct  251  EYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPGWVKKLARKYLNNPLTIDL  310

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD+EEKLAEGIKLYA+ TTATSKRTILSDL+ VYA
Sbjct  311  VGDQEEKLAEGIKLYALSTTATSKRTILSDLVTVYA  346



>gb|KHN43389.1| DEAD-box ATP-dependent RNA helicase 3, chloroplastic [Glycine 
soja]
Length=817

 Score =   386 bits (991),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 190/216 (88%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPIIK +TEDE +   +R GRLPR LVLAPTRELA
Sbjct  139  LVPALEGRDIIARAKTGTGKTLAFGIPIIKGLTEDEHAPSHRRSGRLPRFLVLAPTRELA  198

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+L+T C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDLIN NSLKL EV
Sbjct  199  KQVEKEIKESAPYLSTVCVYGGVSYVTQQSALSRGVDVVVGTPGRIIDLINGNSLKLSEV  258

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVE+ILE LPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL
Sbjct  259  QYLVLDEADQMLAVGFEEDVEMILENLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  318

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGDEEEKLAEGIKLYAI  TATSKRTILSDL+ VYA
Sbjct  319  VGDEEEKLAEGIKLYAIAATATSKRTILSDLVTVYA  354



>ref|XP_002278318.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Vitis vinifera]
 emb|CBI39694.3| unnamed protein product [Vitis vinifera]
Length=764

 Score =   384 bits (987),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/217 (87%), Positives = 207/217 (95%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRD+IARAKTGTGKTLAFGIPIIKR++ED++ + SQRR GRLPRVLVLAPTREL
Sbjct  147  LVPALEGRDLIARAKTGTGKTLAFGIPIIKRLSEDDEKRTSQRRSGRLPRVLVLAPTREL  206

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY+TQ++ALSRGVDVVVGTPGR+IDLI  NSLKLGE
Sbjct  207  AKQVEKEIKESAPYLSTVCVYGGVSYITQQNALSRGVDVVVGTPGRIIDLIKGNSLKLGE  266

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQ LVLDEADQMLAVGFEEDVEVILEKLPS+RQSMLFSATMP+WVKKLARKYL+NPLTID
Sbjct  267  VQNLVLDEADQMLAVGFEEDVEVILEKLPSERQSMLFSATMPAWVKKLARKYLDNPLTID  326

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD +EKLAEGIKLYAIPTTATSKRTILSDLI VYA
Sbjct  327  LVGDHDEKLAEGIKLYAIPTTATSKRTILSDLITVYA  363



>ref|XP_008246347.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Prunus mume]
Length=768

 Score =   383 bits (983),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 205/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPI+KR+TED++ + S RR G LPRVLVLAPTREL
Sbjct  146  LVPALEGRDIIARAKTGTGKTLAFGIPILKRLTEDDEQRSSHRRTGYLPRVLVLAPTREL  205

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+LNT C+ GGVSY+TQ+SALSRGVDVVVGTPGR+IDLIN NSLKLGE
Sbjct  206  AKQVEKEIKESAPYLNTVCVYGGVSYITQQSALSRGVDVVVGTPGRIIDLINGNSLKLGE  265

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQYLVLDEAD MLAVGFEEDVEVIL+KLP+QRQSMLFSATMP+WVKKLARKYL+NPLTID
Sbjct  266  VQYLVLDEADSMLAVGFEEDVEVILQKLPTQRQSMLFSATMPTWVKKLARKYLDNPLTID  325

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD+EEKLAEGIKLYA+ TT +SKRTILSDLI VYA
Sbjct  326  LVGDQEEKLAEGIKLYALSTTGSSKRTILSDLITVYA  362



>ref|XP_007208352.1| hypothetical protein PRUPE_ppa001778mg [Prunus persica]
 gb|EMJ09551.1| hypothetical protein PRUPE_ppa001778mg [Prunus persica]
Length=766

 Score =   382 bits (982),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 205/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPI+KR+TED++ + S RR G LPRVLVLAPTREL
Sbjct  146  LVPALEGRDIIARAKTGTGKTLAFGIPILKRLTEDDEQRSSHRRTGYLPRVLVLAPTREL  205

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+LNT C+ GGVSY+TQ+SALSRGVDVVVGTPGR+IDLIN NSLKLGE
Sbjct  206  AKQVEKEIKESAPYLNTVCVYGGVSYITQQSALSRGVDVVVGTPGRIIDLINGNSLKLGE  265

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQYLVLDEAD MLAVGFEEDVEVIL+KLP+QRQSMLFSATMP+WVKKLARKYL+NPLTID
Sbjct  266  VQYLVLDEADSMLAVGFEEDVEVILQKLPTQRQSMLFSATMPAWVKKLARKYLDNPLTID  325

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD+EEKLAEGIKLYA+ TT +SKRTILSDLI VYA
Sbjct  326  LVGDQEEKLAEGIKLYALSTTGSSKRTILSDLITVYA  362



>ref|XP_009789500.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Nicotiana sylvestris]
Length=741

 Score =   382 bits (980),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 206/216 (95%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEG+DIIARAKTGTGKTLAFGIP++K+++ DE+ + + RRGRLP++LVLAPTRELA
Sbjct  135  LVPALEGQDIIARAKTGTGKTLAFGIPVLKKLSGDEEMRNTLRRGRLPKILVLAPTRELA  194

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE+KESAP+LNT CI GGVSY TQ++AL+RGVDVVVGTPGRLIDLINNN+LKLGEV
Sbjct  195  KQVEKEMKESAPYLNTVCIYGGVSYATQQNALTRGVDVVVGTPGRLIDLINNNTLKLGEV  254

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMP WVKKLARKYLNNPLTIDL
Sbjct  255  EYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPGWVKKLARKYLNNPLTIDL  314

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD+EEKLAEGIKLYA+ TTATSKRTILSDL+ VYA
Sbjct  315  VGDQEEKLAEGIKLYALLTTATSKRTILSDLVTVYA  350



>ref|XP_003521635.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Glycine max]
Length=771

 Score =   382 bits (981),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 188/216 (87%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPIIK +TEDE +   +R GRLPR LVLAPTRELA
Sbjct  142  LVPALEGRDIIARAKTGTGKTLAFGIPIIKGLTEDEHAPSHRRSGRLPRFLVLAPTRELA  201

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+L+T C+ GGVSYVTQ+ ALSRGVDVVVGTPGR+IDLIN NSLKL EV
Sbjct  202  KQVEKEIKESAPYLSTVCVYGGVSYVTQQGALSRGVDVVVGTPGRIIDLINGNSLKLSEV  261

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVE+ILE LP+QRQSMLFSATMPSWVKKLARKYLNNPLTIDL
Sbjct  262  QYLVLDEADQMLAVGFEEDVEMILENLPAQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  321

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGDEEEKLAEGIKLYAI  TATSKRTILSDL+ VYA
Sbjct  322  VGDEEEKLAEGIKLYAIAATATSKRTILSDLVTVYA  357



>emb|CDP17754.1| unnamed protein product [Coffea canephora]
Length=779

 Score =   381 bits (979),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 189/217 (87%), Positives = 206/217 (95%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPIIKR++EDE+ +  +RR G+LP+VLVLAPTREL
Sbjct  160  LVPALEGRDIIARAKTGTGKTLAFGIPIIKRLSEDEEERGPRRRSGQLPKVLVLAPTREL  219

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESA +LNT C+ GGVSY+TQ++A+SRGVDVVVGTPGRLIDLIN+ SLKLGE
Sbjct  220  AKQVEKEIKESASYLNTVCVYGGVSYITQQNAISRGVDVVVGTPGRLIDLINSGSLKLGE  279

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQYLVLDEADQMLAVGFEEDVEVILEKLPS+RQSMLFSATMP WVKKLARKYL+NPLTID
Sbjct  280  VQYLVLDEADQMLAVGFEEDVEVILEKLPSERQSMLFSATMPGWVKKLARKYLDNPLTID  339

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGDEEEKLAEGIKLYAIPTT TSKRTILSDLI VYA
Sbjct  340  LVGDEEEKLAEGIKLYAIPTTPTSKRTILSDLITVYA  376



>ref|XP_010245402.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Nelumbo nucifera]
Length=761

 Score =   379 bits (973),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 205/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRIT-EDEQSKFSQRRGRLPRVLVLAPTREL  179
            L+PALEGRD+IARAKTGTGKTLAFGIPIIKRIT +DE    S+R G LPRVLVLAPTREL
Sbjct  148  LLPALEGRDLIARAKTGTGKTLAFGIPIIKRITVDDEGRSLSRRSGCLPRVLVLAPTREL  207

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+LNT C+ GGVSY +Q++ALSRGVDVVVGTPGR+IDLIN+NSLKLGE
Sbjct  208  AKQVEKEIKESAPYLNTVCVYGGVSYNSQQNALSRGVDVVVGTPGRIIDLINSNSLKLGE  267

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQYLVLDEADQMLAVGFEEDVE+IL+KLPS+RQSMLFSATMP WVKKLARKYL+NPLTID
Sbjct  268  VQYLVLDEADQMLAVGFEEDVEIILQKLPSERQSMLFSATMPGWVKKLARKYLHNPLTID  327

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAIPTTATSKRTIL+DLI VYA
Sbjct  328  LVGDQDEKLAEGIKLYAIPTTATSKRTILTDLITVYA  364



>ref|XP_004244948.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Solanum lycopersicum]
Length=746

 Score =   378 bits (970),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIP++K+++ DE+ + +QRRGRLP+VLVLAPTRELA
Sbjct  136  LVPALEGRDIIARAKTGTGKTLAFGIPVLKKLSTDEEMRNTQRRGRLPKVLVLAPTRELA  195

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
             QVEKE+KESAP+LNT CI GGVSY TQ++ALSRGVDVVVGTPGRLIDLINNN+LKLGEV
Sbjct  196  NQVEKEMKESAPYLNTVCIYGGVSYATQQNALSRGVDVVVGTPGRLIDLINNNTLKLGEV  255

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVEVILEKLP QRQSMLFSATMP WVKKL+RKYLNNPLTIDL
Sbjct  256  EYLVLDEADQMLAVGFEEDVEVILEKLPPQRQSMLFSATMPGWVKKLSRKYLNNPLTIDL  315

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYA+  T+TSKR+IL DL+ VYA
Sbjct  316  VGDQDEKLAEGIKLYALSATSTSKRSILGDLVTVYA  351



>ref|XP_006355275.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Solanum tuberosum]
Length=744

 Score =   377 bits (968),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIP++K+++ DE+ + +QRRGRLP++LVLAPTRELA
Sbjct  136  LVPALEGRDIIARAKTGTGKTLAFGIPVLKKLSTDEEMRNTQRRGRLPKILVLAPTRELA  195

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
             QVEKE+KESAP+LNT CI GGVSY TQ++ALSRGVDVVVGTPGRLIDLINNN+LKLGEV
Sbjct  196  NQVEKEMKESAPYLNTVCIYGGVSYATQQNALSRGVDVVVGTPGRLIDLINNNTLKLGEV  255

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVEVILEKLP QRQSMLFSATMP WVKKL+RKYLNNPLTIDL
Sbjct  256  EYLVLDEADQMLAVGFEEDVEVILEKLPPQRQSMLFSATMPGWVKKLSRKYLNNPLTIDL  315

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYA+  T+TSKR+IL DL+ VYA
Sbjct  316  VGDQDEKLAEGIKLYALSATSTSKRSILGDLVTVYA  351



>ref|XP_009337853.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Pyrus x bretschneideri]
Length=765

 Score =   377 bits (967),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 204/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPI+KR+TED++ + S RR G LPRVLVLAPTREL
Sbjct  144  LVPALEGRDIIARAKTGTGKTLAFGIPILKRLTEDDEQRGSHRRTGYLPRVLVLAPTREL  203

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKE+KESAP+LNT C+ GGVSY+TQ+SALSRGVDVVVGTPGR+IDLIN NSLKLGE
Sbjct  204  AKQVEKEMKESAPYLNTVCVYGGVSYITQQSALSRGVDVVVGTPGRIIDLINGNSLKLGE  263

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQYLVLDEAD MLAVGFEEDVEVIL+KLP+QRQSMLFSATMP WVKKL+RKYL+NPLTID
Sbjct  264  VQYLVLDEADSMLAVGFEEDVEVILQKLPAQRQSMLFSATMPGWVKKLSRKYLDNPLTID  323

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYA+ TT+ SK+TILSDLI VYA
Sbjct  324  LVGDQDEKLAEGIKLYALSTTSASKKTILSDLITVYA  360



>ref|XP_004302309.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=772

 Score =   376 bits (965),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 203/216 (94%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPI+KR+TED++ + S+R G LPRVLVLAPTRELA
Sbjct  148  LVPALEGRDIIARAKTGTGKTLAFGIPILKRLTEDDEQRGSRRSGYLPRVLVLAPTRELA  207

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+LNT C+ GGVSYVTQ+SALSRGVDVVVGTPGRLIDLIN  SLKL EV
Sbjct  208  KQVEKEIKESAPYLNTVCVYGGVSYVTQQSALSRGVDVVVGTPGRLIDLINGGSLKLSEV  267

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFE+DVE IL++LP+QRQSMLFSATMP+WVKKLARKYL+NPLTIDL
Sbjct  268  QYLVLDEADQMLAVGFEDDVETILQRLPAQRQSMLFSATMPTWVKKLARKYLDNPLTIDL  327

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYA+ TT +SKRTILSDLI VYA
Sbjct  328  VGDQDEKLAEGIKLYALSTTNSSKRTILSDLITVYA  363



>ref|XP_008364011.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Malus domestica]
Length=734

 Score =   374 bits (961),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 204/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPI+KR+TED++ + S RR G LPRVLVLAPTREL
Sbjct  113  LVPALEGRDIIARAKTGTGKTLAFGIPILKRLTEDDEQRGSHRRTGYLPRVLVLAPTREL  172

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKE+KESAP+LNT C+ GGVSY+TQ+SALSRGVDVVVGTPGR+IDLIN N+LKLGE
Sbjct  173  AKQVEKEMKESAPYLNTVCVYGGVSYITQQSALSRGVDVVVGTPGRIIDLINGNTLKLGE  232

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQYLVLDEAD MLAVGFEEDVEVIL+KLP+QRQSMLFSATMP WVKKL+RKYL+NP+TID
Sbjct  233  VQYLVLDEADSMLAVGFEEDVEVILQKLPAQRQSMLFSATMPGWVKKLSRKYLDNPMTID  292

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYA+ TT+ SK+TILSDLI VYA
Sbjct  293  LVGDQDEKLAEGIKLYALSTTSASKKTILSDLITVYA  329



>ref|XP_008370322.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Malus domestica]
Length=764

 Score =   375 bits (962),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 181/217 (83%), Positives = 204/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPI+KR+TED++ + S RR G LPRVLVLAPTREL
Sbjct  143  LVPALEGRDIIARAKTGTGKTLAFGIPILKRLTEDDEQRGSHRRTGYLPRVLVLAPTREL  202

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKE+KESAP+LNT C+ GGVSY+TQ+SALSRGVDVVVGTPGR+IDLIN N+LKLGE
Sbjct  203  AKQVEKEMKESAPYLNTVCVYGGVSYITQQSALSRGVDVVVGTPGRIIDLINGNTLKLGE  262

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQYLVLDEAD MLAVGFEEDVEVIL+KLP+QRQSMLFSATMP WVKKL+RKYL+NP+TID
Sbjct  263  VQYLVLDEADSMLAVGFEEDVEVILQKLPAQRQSMLFSATMPGWVKKLSRKYLDNPMTID  322

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYA+ TT+ SK+TILSDLI VYA
Sbjct  323  LVGDQDEKLAEGIKLYALSTTSASKKTILSDLITVYA  359



>ref|XP_007163272.1| hypothetical protein PHAVU_001G220500g [Phaseolus vulgaris]
 gb|ESW35266.1| hypothetical protein PHAVU_001G220500g [Phaseolus vulgaris]
Length=776

 Score =   375 bits (963),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/216 (86%), Positives = 199/216 (92%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PAL+GRDIIARAKTGTGKTLAFGIP+IK +TED      +R GRLPRVLVLAPTRELA
Sbjct  146  LVPALQGRDIIARAKTGTGKTLAFGIPVIKGLTEDGDETSLRRSGRLPRVLVLAPTRELA  205

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+L+T C+ GGVSYV+Q+SALSRGVDVVVGTPGR+IDLIN  SLKL EV
Sbjct  206  KQVEKEIKESAPYLSTVCVYGGVSYVSQQSALSRGVDVVVGTPGRIIDLINGKSLKLSEV  265

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVE+ILE LPSQRQSMLFSATMP+WVKKLARKYLNNPLTIDL
Sbjct  266  QYLVLDEADQMLAVGFEEDVELILENLPSQRQSMLFSATMPAWVKKLARKYLNNPLTIDL  325

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGDEEEKLAEGIKLYAI  TATSKRTILSDL+ VYA
Sbjct  326  VGDEEEKLAEGIKLYAIAATATSKRTILSDLVTVYA  361



>gb|EPS66084.1| hypothetical protein M569_08688 [Genlisea aurea]
Length=775

 Score =   375 bits (962),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPI+K + E  Q + S RRGRLP+VLVLAPTRELA
Sbjct  136  LVPALEGRDIIARAKTGTGKTLAFGIPILKGLDEASQERGSLRRGRLPKVLVLAPTRELA  195

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE KESAP+L+TACI GGVSY+TQE++LSRGVD+VVGTPGR+IDLINNN+LKLGEV
Sbjct  196  KQVEKEFKESAPYLSTACIYGGVSYLTQETSLSRGVDIVVGTPGRIIDLINNNTLKLGEV  255

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVEVILEKLP QRQSMLFSATMP WVKKLARK+L +PLTIDL
Sbjct  256  QYLVLDEADQMLAVGFEEDVEVILEKLPKQRQSMLFSATMPGWVKKLARKFLKDPLTIDL  315

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD+EEKLAEGIKL+A+PTTA SKRTILSDL+ VY 
Sbjct  316  VGDQEEKLAEGIKLFALPTTAASKRTILSDLVTVYG  351



>ref|XP_010932029.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
3, chloroplastic [Elaeis guineensis]
Length=761

 Score =   374 bits (961),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALE RD+IARAKTGTGKTLAFGIPIIKR+TED   +   RRGRLPRVLVLAPTRELA
Sbjct  154  LLPALESRDLIARAKTGTGKTLAFGIPIIKRLTEDNDDRRISRRGRLPRVLVLAPTRELA  213

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+L T C+ GGVSY  Q++AL+RGVDVVVGTPGR+IDLIN+NSL+LGEV
Sbjct  214  KQVEKEIKESAPYLGTVCVYGGVSYNIQQNALARGVDVVVGTPGRIIDLINSNSLQLGEV  273

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVEVILEKLPS RQSMLFSATMP WVKKLAR+YLN+PLTIDL
Sbjct  274  EYLVLDEADQMLAVGFEEDVEVILEKLPSDRQSMLFSATMPGWVKKLARRYLNDPLTIDL  333

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYAIPTTATSKRTILSDL+ VYA
Sbjct  334  VGDQDEKLAEGIKLYAIPTTATSKRTILSDLVTVYA  369



>gb|KCW58706.1| hypothetical protein EUGRSUZ_H01352 [Eucalyptus grandis]
Length=669

 Score =   371 bits (953),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PALEGRD+IARAKTGTGKTLAFGIPI+KR+T+ ++ + S RRGRLPRVL LAPTRELA
Sbjct  175  LTPALEGRDLIARAKTGTGKTLAFGIPILKRLTDGDEHR-SPRRGRLPRVLALAPTRELA  233

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+LNT C+ GGVSYVTQ+SALSRGVDVVVGTPGRLIDLI +NSLKLGEV
Sbjct  234  KQVEKEIKESAPYLNTVCVYGGVSYVTQQSALSRGVDVVVGTPGRLIDLIKSNSLKLGEV  293

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            ++LVLDEADQMLAVGFEEDVE+ILEKLPSQRQSMLFSATMP WVKKLARK+LNNPLTIDL
Sbjct  294  EFLVLDEADQMLAVGFEEDVEMILEKLPSQRQSMLFSATMPGWVKKLARKHLNNPLTIDL  353

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG+++EKLAEGIK++AI  T TSKRTILSDLI VYA
Sbjct  354  VGEQDEKLAEGIKIFAISATPTSKRTILSDLITVYA  389



>ref|XP_011039071.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
isoform X3 [Populus euphratica]
Length=627

 Score =   369 bits (946),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 201/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            LIPALEGRD+IARAKTGTGKTLAFGI IIKR+TED + + SQRR GRLP+VLVLAPTREL
Sbjct  164  LIPALEGRDLIARAKTGTGKTLAFGILIIKRLTEDAELRGSQRRTGRLPKVLVLAPTREL  223

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDL+  NSLKLGE
Sbjct  224  AKQVEKEIKESAPYLSTVCVYGGVSYVTQQSALSRGVDVVVGTPGRIIDLLKGNSLKLGE  283

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQML+ GFEEDVEVILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  284  VEYLVLDEADQMLSFGFEEDVEVILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLQID  343

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD+EEKLAEGIKLYA+  TA SKRTILSDL+ VYA
Sbjct  344  LVGDQEEKLAEGIKLYALSATAASKRTILSDLVTVYA  380



>ref|XP_009365993.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Pyrus x bretschneideri]
Length=764

 Score =   372 bits (954),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 203/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPI+KR+TED++   S RR G LPRVLVLAPTREL
Sbjct  143  LVPALEGRDIIARAKTGTGKTLAFGIPILKRLTEDDEQGGSHRRTGYLPRVLVLAPTREL  202

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKE+KESAP+LNT C+ GGVSY+TQ+SALSRGVDVVVGTPGR+IDLIN N+LKLGE
Sbjct  203  AKQVEKEMKESAPYLNTVCVYGGVSYITQQSALSRGVDVVVGTPGRIIDLINGNTLKLGE  262

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEAD MLAVGFEEDVEVIL+KLP+QRQSMLFSATMP WVKKL+RKYL+NP+TID
Sbjct  263  VKYLVLDEADSMLAVGFEEDVEVILQKLPAQRQSMLFSATMPGWVKKLSRKYLDNPMTID  322

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYA+ TT+ SK+TILSDLI VYA
Sbjct  323  LVGDQDEKLAEGIKLYALSTTSASKKTILSDLITVYA  359



>ref|XP_006382238.1| hypothetical protein POPTR_0005s00240g [Populus trichocarpa]
 gb|ERP60035.1| hypothetical protein POPTR_0005s00240g [Populus trichocarpa]
Length=731

 Score =   370 bits (949),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 202/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            LIPALEGRD+IARAKTGTGKTLAFGIPIIKR+TED + + SQRR GRLP+VLVLAPTREL
Sbjct  164  LIPALEGRDLIARAKTGTGKTLAFGIPIIKRLTEDAELRGSQRRTGRLPKVLVLAPTREL  223

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L++ C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDL+  NSLKLGE
Sbjct  224  AKQVEKEIKESAPYLSSVCVYGGVSYVTQQSALSRGVDVVVGTPGRIIDLLKGNSLKLGE  283

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQML+ GFEEDVEVILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  284  VEYLVLDEADQMLSFGFEEDVEVILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLQID  343

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD+EEKLAEGIKLYA+  TA SKRTILSDL+ VYA
Sbjct  344  LVGDQEEKLAEGIKLYALSATAASKRTILSDLVTVYA  380



>ref|XP_007031309.1| DEAD box RNA helicase (RH3) isoform 4 [Theobroma cacao]
 gb|EOY11811.1| DEAD box RNA helicase (RH3) isoform 4 [Theobroma cacao]
Length=622

 Score =   367 bits (941),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 198/218 (91%), Gaps = 2/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR--GRLPRVLVLAPTRE  176
             +PAL+GRDIIARAKTGTGKTLAFGIPIIKR+T D   + S RR  GRLPRVLVLAPTRE
Sbjct  139  FVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTHDAPQQTSPRRMSGRLPRVLVLAPTRE  198

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+LNT C+ GGVSY TQ +ALSRGVDVVVGTPGR+IDLI ++ LKLG
Sbjct  199  LAKQVEKEIKESAPYLNTVCVYGGVSYNTQRNALSRGVDVVVGTPGRIIDLIESSDLKLG  258

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEEDVE ILE LPS+RQSMLFSATMPSWVKKLARKYL+NPL I
Sbjct  259  EVEYLVLDEADQMLAVGFEEDVEEILENLPSKRQSMLFSATMPSWVKKLARKYLDNPLNI  318

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI TT+T+KRTILSDLI VYA
Sbjct  319  DLVGDQDEKLAEGIKLYAISTTSTAKRTILSDLITVYA  356



>ref|XP_010094933.1| DEAD-box ATP-dependent RNA helicase 3 [Morus notabilis]
 gb|EXB57576.1| DEAD-box ATP-dependent RNA helicase 3 [Morus notabilis]
Length=810

 Score =   372 bits (954),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 187/217 (86%), Positives = 202/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED-EQSKFSQRRGRLPRVLVLAPTREL  179
            L+PALEGRD+IARAKTGTGKTLAFGIPIIKR+TED EQ    +R  RLP+ LVLAPTREL
Sbjct  141  LVPALEGRDLIARAKTGTGKTLAFGIPIIKRLTEDDEQRGSRRRSSRLPKGLVLAPTREL  200

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAPHLNT C+ GGVSY+TQ++ALSRGVDVVVGTPGRLIDLIN  SL+LGE
Sbjct  201  AKQVEKEIKESAPHLNTVCVYGGVSYITQQNALSRGVDVVVGTPGRLIDLINGGSLQLGE  260

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQYLVLDEADQMLAVGFEEDVEVILEKLPS+RQSMLFSATMPSWVKKLARKYL+NPLTID
Sbjct  261  VQYLVLDEADQMLAVGFEEDVEVILEKLPSERQSMLFSATMPSWVKKLARKYLDNPLTID  320

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVG+ +EKLAEGIKLYAI TTATSKRTILSDL+ VYA
Sbjct  321  LVGERDEKLAEGIKLYAISTTATSKRTILSDLVTVYA  357



>ref|XP_008777792.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Phoenix dactylifera]
Length=759

 Score =   370 bits (950),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 202/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED-EQSKFSQRRGRLPRVLVLAPTREL  179
            L+PALEGRD+IARAKTGTGKTLAFGIPIIKR+TED E  + S +RGRLPRVLVLAPTREL
Sbjct  153  LLPALEGRDLIARAKTGTGKTLAFGIPIIKRLTEDNEGRRISSKRGRLPRVLVLAPTREL  212

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L T C+ GGVSY  Q++ L+RGVDVVVGTPGR+IDLI++NSL+LGE
Sbjct  213  AKQVEKEIKESAPYLGTVCVYGGVSYNIQQNTLARGVDVVVGTPGRIIDLIDSNSLQLGE  272

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            +QYLVLDEAD+MLAVGFEEDVEVILEKLPS RQSMLFSATMP WVKKLAR+YLN+PLTID
Sbjct  273  IQYLVLDEADRMLAVGFEEDVEVILEKLPSDRQSMLFSATMPGWVKKLARRYLNDPLTID  332

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAIPTT TSKRTILSDLI VYA
Sbjct  333  LVGDQDEKLAEGIKLYAIPTTVTSKRTILSDLITVYA  369



>ref|XP_006382233.1| hypothetical protein POPTR_0005s00200g [Populus trichocarpa]
 gb|ERP60030.1| hypothetical protein POPTR_0005s00200g [Populus trichocarpa]
Length=773

 Score =   370 bits (951),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 201/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            LIP LEGRD+IARAKTGTGKTLAFGIPIIKR+TED + + SQRR GRLP+VLVLAPTREL
Sbjct  166  LIPTLEGRDLIARAKTGTGKTLAFGIPIIKRLTEDAELRGSQRRTGRLPKVLVLAPTREL  225

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY TQ++ALSRGVDVVVGTPGR+IDL+  NSLKLGE
Sbjct  226  AKQVEKEIKESAPYLSTVCVYGGVSYATQQNALSRGVDVVVGTPGRIIDLLKGNSLKLGE  285

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQML+ GFEEDVEVILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  286  VEYLVLDEADQMLSFGFEEDVEVILESLPSKRQSMLFSATMPTWVKKLARKYLDNPLQID  345

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD EEKLAEGIKLYAI TTATSKRTILSDL+ VYA
Sbjct  346  LVGDREEKLAEGIKLYAISTTATSKRTILSDLVTVYA  382



>ref|XP_006382234.1| hypothetical protein POPTR_0005s00200g [Populus trichocarpa]
 gb|ERP60031.1| hypothetical protein POPTR_0005s00200g [Populus trichocarpa]
Length=774

 Score =   370 bits (951),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 201/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            LIP LEGRD+IARAKTGTGKTLAFGIPIIKR+TED + + SQRR GRLP+VLVLAPTREL
Sbjct  166  LIPTLEGRDLIARAKTGTGKTLAFGIPIIKRLTEDAELRGSQRRTGRLPKVLVLAPTREL  225

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY TQ++ALSRGVDVVVGTPGR+IDL+  NSLKLGE
Sbjct  226  AKQVEKEIKESAPYLSTVCVYGGVSYATQQNALSRGVDVVVGTPGRIIDLLKGNSLKLGE  285

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQML+ GFEEDVEVILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  286  VEYLVLDEADQMLSFGFEEDVEVILESLPSKRQSMLFSATMPTWVKKLARKYLDNPLQID  345

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD EEKLAEGIKLYAI TTATSKRTILSDL+ VYA
Sbjct  346  LVGDREEKLAEGIKLYAISTTATSKRTILSDLVTVYA  382



>ref|XP_006382239.1| hypothetical protein POPTR_0005s00240g [Populus trichocarpa]
 gb|ERP60036.1| hypothetical protein POPTR_0005s00240g [Populus trichocarpa]
Length=775

 Score =   370 bits (950),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 202/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            LIPALEGRD+IARAKTGTGKTLAFGIPIIKR+TED + + SQRR GRLP+VLVLAPTREL
Sbjct  164  LIPALEGRDLIARAKTGTGKTLAFGIPIIKRLTEDAELRGSQRRTGRLPKVLVLAPTREL  223

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L++ C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDL+  NSLKLGE
Sbjct  224  AKQVEKEIKESAPYLSSVCVYGGVSYVTQQSALSRGVDVVVGTPGRIIDLLKGNSLKLGE  283

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQML+ GFEEDVEVILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  284  VEYLVLDEADQMLSFGFEEDVEVILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLQID  343

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD+EEKLAEGIKLYA+  TA SKRTILSDL+ VYA
Sbjct  344  LVGDQEEKLAEGIKLYALSATAASKRTILSDLVTVYA  380



>gb|KDP23314.1| hypothetical protein JCGZ_23147 [Jatropha curcas]
Length=758

 Score =   369 bits (948),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 201/216 (93%), Gaps = 2/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPALEGRDIIARAKTGTGKTLAFGIPIIK+ITED  S+  +R GRLP+VLVLAPTRELA
Sbjct  149  LIPALEGRDIIARAKTGTGKTLAFGIPIIKQITEDTGSQ--RRTGRLPKVLVLAPTRELA  206

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEI +SAP+LNT C+ GGVSY+TQ +ALSRGVDVVVGTPGR+IDLI +NSLKLGEV
Sbjct  207  KQVEKEINDSAPYLNTVCVYGGVSYITQRNALSRGVDVVVGTPGRIIDLIKSNSLKLGEV  266

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQML+ GFEEDVEVILE LPS+RQSMLFSATMPSWVKKL+RKYL+NPL IDL
Sbjct  267  QYLVLDEADQMLSFGFEEDVEVILEDLPSKRQSMLFSATMPSWVKKLSRKYLDNPLQIDL  326

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD+EEKLAEGIKLYA+ TTATSKR+ILSDL+ VYA
Sbjct  327  VGDQEEKLAEGIKLYAVSTTATSKRSILSDLVTVYA  362



>gb|EYU35387.1| hypothetical protein MIMGU_mgv1a001660mg [Erythranthe guttata]
Length=777

 Score =   369 bits (948),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPIIK + + EQ+    RRGRLP+VLVLAPTRELA
Sbjct  166  LVPALEGRDIIARAKTGTGKTLAFGIPIIKGLEDSEQTNGPPRRGRLPKVLVLAPTRELA  225

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  +SAP+LNT CI GGVSYVTQ+SAL+RGVDVVVGTPGR+IDLI +NSLKLGEV
Sbjct  226  KQVEKEFMDSAPYLNTVCIYGGVSYVTQQSALTRGVDVVVGTPGRIIDLIRSNSLKLGEV  285

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFE+DVE IL+KLP +RQSMLFSATMP+WVKKLARKYL+NPLTIDL
Sbjct  286  EYLVLDEADQMLAVGFEDDVETILQKLPPKRQSMLFSATMPTWVKKLARKYLDNPLTIDL  345

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD+E+KLAEGIKLYAIPTT+ SKRTILSDL+ VYA
Sbjct  346  VGDQEDKLAEGIKLYAIPTTSASKRTILSDLVTVYA  381



>ref|XP_008798630.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Phoenix dactylifera]
Length=762

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 201/216 (93%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRD+IARAKTGTGKTLAFGIPIIKR+ ED + +   RRGRLPRVLVLAPTRELA
Sbjct  148  LLPALEGRDLIARAKTGTGKTLAFGIPIIKRLAEDNERQSVSRRGRLPRVLVLAPTRELA  207

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+L T C+ GGVSY  Q++AL+ GVDVVVGTPGR+IDLIN++SL+LGEV
Sbjct  208  KQVEKEIKESAPYLGTVCVYGGVSYNIQQNALAHGVDVVVGTPGRIIDLINSSSLRLGEV  267

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVEVILEKLPS+RQ+MLFSATMPSWVKKLAR+YLN+PLTIDL
Sbjct  268  QYLVLDEADQMLAVGFEEDVEVILEKLPSERQNMLFSATMPSWVKKLARRYLNDPLTIDL  327

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKL EGIKLYAIPTT+TSKR ILSDLI VYA
Sbjct  328  VGDQDEKLPEGIKLYAIPTTSTSKRMILSDLIMVYA  363



>ref|XP_010070121.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Eucalyptus grandis]
 gb|KCW58705.1| hypothetical protein EUGRSUZ_H01352 [Eucalyptus grandis]
Length=784

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 202/216 (94%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PALEGRD+IARAKTGTGKTLAFGIPI+KR+T+ ++ + S RRGRLPRVL LAPTRELA
Sbjct  175  LTPALEGRDLIARAKTGTGKTLAFGIPILKRLTDGDEHR-SPRRGRLPRVLALAPTRELA  233

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+LNT C+ GGVSYVTQ+SALSRGVDVVVGTPGRLIDLI +NSLKLGEV
Sbjct  234  KQVEKEIKESAPYLNTVCVYGGVSYVTQQSALSRGVDVVVGTPGRLIDLIKSNSLKLGEV  293

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            ++LVLDEADQMLAVGFEEDVE+ILEKLPSQRQSMLFSATMP WVKKLARK+LNNPLTIDL
Sbjct  294  EFLVLDEADQMLAVGFEEDVEMILEKLPSQRQSMLFSATMPGWVKKLARKHLNNPLTIDL  353

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG+++EKLAEGIK++AI  T TSKRTILSDLI VYA
Sbjct  354  VGEQDEKLAEGIKIFAISATPTSKRTILSDLITVYA  389



>ref|XP_003626109.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|ABD32851.1| Helicase, C-terminal; Zinc finger, CCHC-type; GUCT [Medicago 
truncatula]
Length=753

 Score =   368 bits (944),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 186/216 (86%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPII  + + + S    RR RLPR LVLAPTRELA
Sbjct  139  LVPALEGRDIIARAKTGTGKTLAFGIPIINGLDDGQDSGPYSRR-RLPRALVLAPTRELA  197

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+L T CI GGVSYVTQ+SALSRGVDVVVGTPGRLIDLIN N+LKL EV
Sbjct  198  KQVEKEIKESAPYLKTVCIYGGVSYVTQQSALSRGVDVVVGTPGRLIDLINGNTLKLSEV  257

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVEVILEKLP++RQSMLFSATMPSWVKKLARKYLNNPLTIDL
Sbjct  258  EYLVLDEADQMLAVGFEEDVEVILEKLPAKRQSMLFSATMPSWVKKLARKYLNNPLTIDL  317

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGDEEEKLAEGIKLYAI  T+TSKRTILSDLI VYA
Sbjct  318  VGDEEEKLAEGIKLYAISATSTSKRTILSDLITVYA  353



>ref|XP_007031308.1| DEAD box RNA helicase (RH3) isoform 3, partial [Theobroma cacao]
 gb|EOY11810.1| DEAD box RNA helicase (RH3) isoform 3, partial [Theobroma cacao]
Length=689

 Score =   365 bits (938),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 198/218 (91%), Gaps = 2/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR--GRLPRVLVLAPTRE  176
             +PAL+GRDIIARAKTGTGKTLAFGIPIIKR+T D   + S RR  GRLPRVLVLAPTRE
Sbjct  139  FVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTHDAPQQTSPRRMSGRLPRVLVLAPTRE  198

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+LNT C+ GGVSY TQ +ALSRGVDVVVGTPGR+IDLI ++ LKLG
Sbjct  199  LAKQVEKEIKESAPYLNTVCVYGGVSYNTQRNALSRGVDVVVGTPGRIIDLIESSDLKLG  258

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEEDVE ILE LPS+RQSMLFSATMPSWVKKLARKYL+NPL I
Sbjct  259  EVEYLVLDEADQMLAVGFEEDVEEILENLPSKRQSMLFSATMPSWVKKLARKYLDNPLNI  318

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI TT+T+KRTILSDLI VYA
Sbjct  319  DLVGDQDEKLAEGIKLYAISTTSTAKRTILSDLITVYA  356



>ref|XP_011039069.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=775

 Score =   367 bits (943),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 201/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            LIPALEGRD+IARAKTGTGKTLAFGI IIKR+TED + + SQRR GRLP+VLVLAPTREL
Sbjct  164  LIPALEGRDLIARAKTGTGKTLAFGILIIKRLTEDAELRGSQRRTGRLPKVLVLAPTREL  223

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDL+  NSLKLGE
Sbjct  224  AKQVEKEIKESAPYLSTVCVYGGVSYVTQQSALSRGVDVVVGTPGRIIDLLKGNSLKLGE  283

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQML+ GFEEDVEVILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  284  VEYLVLDEADQMLSFGFEEDVEVILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLQID  343

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD+EEKLAEGIKLYA+  TA SKRTILSDL+ VYA
Sbjct  344  LVGDQEEKLAEGIKLYALSATAASKRTILSDLVTVYA  380



>ref|XP_002512602.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF50054.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=772

 Score =   367 bits (943),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 183/217 (84%), Positives = 202/217 (93%), Gaps = 3/217 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRD+IARAKTGTGKTLAFGIPIIK ITED++S  SQRR GRLPRVLVLAPTREL
Sbjct  151  LVPALEGRDLIARAKTGTGKTLAFGIPIIKCITEDDKS--SQRRTGRLPRVLVLAPTREL  208

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEI ESAP+L+T C+ GGVSY+TQ +ALSRGVDVVVGTPGR+IDLIN+ SLKLGE
Sbjct  209  AKQVEKEINESAPYLSTVCVYGGVSYITQRNALSRGVDVVVGTPGRIIDLINSGSLKLGE  268

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQML+ GFEEDVEVILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  269  VEYLVLDEADQMLSFGFEEDVEVILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLQID  328

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD+EEKLAEGIKLYAI T ATSKR+ILSDL+ VYA
Sbjct  329  LVGDQEEKLAEGIKLYAISTNATSKRSILSDLVTVYA  365



>ref|XP_011039068.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=776

 Score =   367 bits (943),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 182/217 (84%), Positives = 201/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            LIPALEGRD+IARAKTGTGKTLAFGI IIKR+TED + + SQRR GRLP+VLVLAPTREL
Sbjct  164  LIPALEGRDLIARAKTGTGKTLAFGILIIKRLTEDAELRGSQRRTGRLPKVLVLAPTREL  223

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDL+  NSLKLGE
Sbjct  224  AKQVEKEIKESAPYLSTVCVYGGVSYVTQQSALSRGVDVVVGTPGRIIDLLKGNSLKLGE  283

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQML+ GFEEDVEVILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  284  VEYLVLDEADQMLSFGFEEDVEVILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLQID  343

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD+EEKLAEGIKLYA+  TA SKRTILSDL+ VYA
Sbjct  344  LVGDQEEKLAEGIKLYALSATAASKRTILSDLVTVYA  380



>ref|XP_003536002.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Glycine max]
Length=736

 Score =   365 bits (938),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 199/216 (92%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEG+DIIARAKTGTGKTLAFGIPI+K +T D++    +R GRLP+ LVLAPTRELA
Sbjct  123  LVPALEGKDIIARAKTGTGKTLAFGIPILKGLTNDDEQSPHRRSGRLPKALVLAPTRELA  182

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEI+ESAP+L T C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDL+N NSLKL EV
Sbjct  183  KQVEKEIQESAPYLKTVCVYGGVSYVTQQSALSRGVDVVVGTPGRIIDLVNGNSLKLSEV  242

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVEVIL+K+P+QRQ+MLFSATMP WVKKL+RKYLNNPLTIDL
Sbjct  243  QYLVLDEADQMLAVGFEEDVEVILDKVPTQRQTMLFSATMPGWVKKLSRKYLNNPLTIDL  302

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG++EEKLAEGIKLYA+  TATSKRT+LSDLI VYA
Sbjct  303  VGEQEEKLAEGIKLYALLATATSKRTVLSDLITVYA  338



>ref|XP_010551750.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Tarenaya hassleriana]
Length=756

 Score =   366 bits (939),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/218 (84%), Positives = 201/218 (92%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L PALEGRDIIARAKTGTGKTLAFGIPIIKR+TED  +QS F +R GRLP+VLVLAPTRE
Sbjct  139  LHPALEGRDIIARAKTGTGKTLAFGIPIIKRLTEDAVDQSSF-RRSGRLPKVLVLAPTRE  197

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY TQ+SALSRGVDVVVGTPGR+IDLI   SLKLG
Sbjct  198  LAKQVEKEIKESAPYLSTVCVYGGVSYNTQQSALSRGVDVVVGTPGRIIDLIEGKSLKLG  257

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEEDVE ILE LPS+RQSMLFSATMP+W+KKLARKYL+NPL I
Sbjct  258  EVEYLVLDEADQMLAVGFEEDVECILENLPSKRQSMLFSATMPAWIKKLARKYLDNPLNI  317

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKL+AIP T+TSKRTILSDLI VYA
Sbjct  318  DLVGDQDEKLAEGIKLFAIPATSTSKRTILSDLITVYA  355



>ref|XP_006480317.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=766

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PAL+GRD+IARAKTGTGKTLAFGIPI+KR+TE  +   S RR RLP+VLVLAPTRELA+Q
Sbjct  157  PALQGRDLIARAKTGTGKTLAFGIPILKRLTEGYEQAISLRRSRLPKVLVLAPTRELARQ  216

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VEKEIKESAP+LNT C+ GGVSY TQ++ALSRGVDVVVGTPGR+IDLINN+SLKLGEV+Y
Sbjct  217  VEKEIKESAPYLNTVCVYGGVSYNTQQNALSRGVDVVVGTPGRIIDLINNSSLKLGEVEY  276

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            LVLDEADQMLAVGFEEDVE+ILE LP +RQSMLFSATMPSWVKKL+RKYL+NPL IDLVG
Sbjct  277  LVLDEADQMLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVG  336

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            +++EKLAEGIKLYAI TTATSKRTILSDLI VYA
Sbjct  337  NQDEKLAEGIKLYAISTTATSKRTILSDLITVYA  370



>ref|XP_006480316.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=767

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PAL+GRD+IARAKTGTGKTLAFGIPI+KR+TE  +   S RR RLP+VLVLAPTRELA+Q
Sbjct  157  PALQGRDLIARAKTGTGKTLAFGIPILKRLTEGYEQAISLRRSRLPKVLVLAPTRELARQ  216

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VEKEIKESAP+LNT C+ GGVSY TQ++ALSRGVDVVVGTPGR+IDLINN+SLKLGEV+Y
Sbjct  217  VEKEIKESAPYLNTVCVYGGVSYNTQQNALSRGVDVVVGTPGRIIDLINNSSLKLGEVEY  276

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            LVLDEADQMLAVGFEEDVE+ILE LP +RQSMLFSATMPSWVKKL+RKYL+NPL IDLVG
Sbjct  277  LVLDEADQMLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVG  336

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            +++EKLAEGIKLYAI TTATSKRTILSDLI VYA
Sbjct  337  NQDEKLAEGIKLYAISTTATSKRTILSDLITVYA  370



>ref|XP_006480315.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=768

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PAL+GRD+IARAKTGTGKTLAFGIPI+KR+TE  +   S RR RLP+VLVLAPTRELA+Q
Sbjct  157  PALQGRDLIARAKTGTGKTLAFGIPILKRLTEGYEQAISLRRSRLPKVLVLAPTRELARQ  216

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VEKEIKESAP+LNT C+ GGVSY TQ++ALSRGVDVVVGTPGR+IDLINN+SLKLGEV+Y
Sbjct  217  VEKEIKESAPYLNTVCVYGGVSYNTQQNALSRGVDVVVGTPGRIIDLINNSSLKLGEVEY  276

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            LVLDEADQMLAVGFEEDVE+ILE LP +RQSMLFSATMPSWVKKL+RKYL+NPL IDLVG
Sbjct  277  LVLDEADQMLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVG  336

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            +++EKLAEGIKLYAI TTATSKRTILSDLI VYA
Sbjct  337  NQDEKLAEGIKLYAISTTATSKRTILSDLITVYA  370



>gb|KHN13959.1| DEAD-box ATP-dependent RNA helicase 3, chloroplastic [Glycine 
soja]
Length=727

 Score =   365 bits (937),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 199/216 (92%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEG+DIIARAKTGTGKTLAFGIPI+K +T D++    +R GRLP+ LVLAPTRELA
Sbjct  115  LVPALEGKDIIARAKTGTGKTLAFGIPILKGLTNDDEQSPHRRSGRLPKALVLAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEI+ESAP+L T C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDL+N NSLKL EV
Sbjct  175  KQVEKEIQESAPYLKTVCVYGGVSYVTQQSALSRGVDVVVGTPGRIIDLVNGNSLKLSEV  234

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVEVIL+K+P+QRQ+MLFSATMP WVKKL+RKYLNNPLTIDL
Sbjct  235  QYLVLDEADQMLAVGFEEDVEVILDKVPTQRQTMLFSATMPGWVKKLSRKYLNNPLTIDL  294

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG++EEKLAEGIKLYA+  TATSKRT+LSDLI VYA
Sbjct  295  VGEQEEKLAEGIKLYALLATATSKRTVLSDLITVYA  330



>ref|XP_006423935.1| hypothetical protein CICLE_v10027858mg [Citrus clementina]
 ref|XP_006423937.1| hypothetical protein CICLE_v10027858mg [Citrus clementina]
 gb|ESR37175.1| hypothetical protein CICLE_v10027858mg [Citrus clementina]
 gb|ESR37177.1| hypothetical protein CICLE_v10027858mg [Citrus clementina]
Length=779

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PAL+GRD+IARAKTGTGKTLAFGIPI+KR+TE  +   S RR RLP+VLVLAPTRELA+Q
Sbjct  157  PALQGRDLIARAKTGTGKTLAFGIPILKRLTEGYEQAISLRRSRLPKVLVLAPTRELARQ  216

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VEKEIKESAP+LNT C+ GGVSY TQ++ALSRGVDVVVGTPGR+IDLINN+SLKLGEV+Y
Sbjct  217  VEKEIKESAPYLNTVCVYGGVSYNTQQNALSRGVDVVVGTPGRIIDLINNSSLKLGEVEY  276

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            LVLDEADQMLAVGFEEDVE+ILE LP +RQSMLFSATMPSWVKKL+RKYL+NPL IDLVG
Sbjct  277  LVLDEADQMLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVG  336

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            +++EKLAEGIKLYAI TTATSKRTILSDLI VYA
Sbjct  337  NQDEKLAEGIKLYAISTTATSKRTILSDLITVYA  370



>ref|XP_006423936.1| hypothetical protein CICLE_v10027858mg [Citrus clementina]
 gb|ESR37176.1| hypothetical protein CICLE_v10027858mg [Citrus clementina]
Length=780

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 199/214 (93%), Gaps = 0/214 (0%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PAL+GRD+IARAKTGTGKTLAFGIPI+KR+TE  +   S RR RLP+VLVLAPTRELA+Q
Sbjct  157  PALQGRDLIARAKTGTGKTLAFGIPILKRLTEGYEQAISLRRSRLPKVLVLAPTRELARQ  216

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VEKEIKESAP+LNT C+ GGVSY TQ++ALSRGVDVVVGTPGR+IDLINN+SLKLGEV+Y
Sbjct  217  VEKEIKESAPYLNTVCVYGGVSYNTQQNALSRGVDVVVGTPGRIIDLINNSSLKLGEVEY  276

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            LVLDEADQMLAVGFEEDVE+ILE LP +RQSMLFSATMPSWVKKL+RKYL+NPL IDLVG
Sbjct  277  LVLDEADQMLAVGFEEDVELILENLPPKRQSMLFSATMPSWVKKLSRKYLDNPLNIDLVG  336

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            +++EKLAEGIKLYAI TTATSKRTILSDLI VYA
Sbjct  337  NQDEKLAEGIKLYAISTTATSKRTILSDLITVYA  370



>ref|XP_004981197.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Setaria italica]
Length=759

 Score =   365 bits (938),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPALEGRD+IARAKTGTGKTLAFGIP+IKR+  ++  + S RRGR+PRVLVLAPTRELA
Sbjct  126  LIPALEGRDLIARAKTGTGKTLAFGIPMIKRLMGEDDGR-STRRGRIPRVLVLAPTRELA  184

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP L+T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV
Sbjct  185  KQVEKEIKESAPKLSTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEV  244

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVE IL++LP++RQSMLFSATMPSWVKKL+R+YLNNPLTIDL
Sbjct  245  QYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPSWVKKLSRRYLNNPLTIDL  304

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYAIP TATSKRTILSDLI VYA
Sbjct  305  VGDQDEKLAEGIKLYAIPLTATSKRTILSDLITVYA  340



>ref|XP_007031307.1| DEAD box RNA helicase isoform 2 [Theobroma cacao]
 gb|EOY11809.1| DEAD box RNA helicase isoform 2 [Theobroma cacao]
Length=732

 Score =   365 bits (936),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 198/218 (91%), Gaps = 2/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR--GRLPRVLVLAPTRE  176
             +PAL+GRDIIARAKTGTGKTLAFGIPIIKR+T D   + S RR  GRLPRVLVLAPTRE
Sbjct  139  FVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTHDAPQQTSPRRMSGRLPRVLVLAPTRE  198

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+LNT C+ GGVSY TQ +ALSRGVDVVVGTPGR+IDLI ++ LKLG
Sbjct  199  LAKQVEKEIKESAPYLNTVCVYGGVSYNTQRNALSRGVDVVVGTPGRIIDLIESSDLKLG  258

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEEDVE ILE LPS+RQSMLFSATMPSWVKKLARKYL+NPL I
Sbjct  259  EVEYLVLDEADQMLAVGFEEDVEEILENLPSKRQSMLFSATMPSWVKKLARKYLDNPLNI  318

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI TT+T+KRTILSDLI VYA
Sbjct  319  DLVGDQDEKLAEGIKLYAISTTSTAKRTILSDLITVYA  356



>ref|XP_010546798.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Tarenaya hassleriana]
Length=739

 Score =   365 bits (936),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/218 (85%), Positives = 199/218 (91%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            LIPALEGRDIIARAKTGTGKTLAFGIPIIKR+TED  + S F +R GRLP++LVLAPTRE
Sbjct  129  LIPALEGRDIIARAKTGTGKTLAFGIPIIKRLTEDAVDHSSF-RRSGRLPKLLVLAPTRE  187

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY TQ+SALSRGVDVVVGTPGR+IDLI   SLKLG
Sbjct  188  LAKQVEKEIKESAPYLSTVCVYGGVSYNTQQSALSRGVDVVVGTPGRIIDLIEGRSLKLG  247

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LPS+RQSMLFSATMPSWVKKLARKYL+NPL I
Sbjct  248  EVEYLVLDEADQMLAVGFEEAVESILENLPSKRQSMLFSATMPSWVKKLARKYLDNPLNI  307

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD EEKLAEGIKLYAIP T+TSKRTILSDLI VYA
Sbjct  308  DLVGDREEKLAEGIKLYAIPATSTSKRTILSDLITVYA  345



>ref|XP_007031306.1| DEAD box RNA helicase isoform 1 [Theobroma cacao]
 gb|EOY11808.1| DEAD box RNA helicase isoform 1 [Theobroma cacao]
Length=742

 Score =   365 bits (936),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 198/218 (91%), Gaps = 2/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR--GRLPRVLVLAPTRE  176
             +PAL+GRDIIARAKTGTGKTLAFGIPIIKR+T D   + S RR  GRLPRVLVLAPTRE
Sbjct  139  FVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTHDAPQQTSPRRMSGRLPRVLVLAPTRE  198

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+LNT C+ GGVSY TQ +ALSRGVDVVVGTPGR+IDLI ++ LKLG
Sbjct  199  LAKQVEKEIKESAPYLNTVCVYGGVSYNTQRNALSRGVDVVVGTPGRIIDLIESSDLKLG  258

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEEDVE ILE LPS+RQSMLFSATMPSWVKKLARKYL+NPL I
Sbjct  259  EVEYLVLDEADQMLAVGFEEDVEEILENLPSKRQSMLFSATMPSWVKKLARKYLDNPLNI  318

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI TT+T+KRTILSDLI VYA
Sbjct  319  DLVGDQDEKLAEGIKLYAISTTSTAKRTILSDLITVYA  356



>ref|XP_010680184.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=778

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 202/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PA EGRDIIARAKTGTGKTLAFGIPI+KR+TE  + +   RR GRLPRVLVLAPTREL
Sbjct  138  LLPAAEGRDIIARAKTGTGKTLAFGIPILKRLTEGNEERGPLRRTGRLPRVLVLAPTREL  197

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            A+QVEKE+KESAP+L+T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDL+N+NSLKLGE
Sbjct  198  ARQVEKEMKESAPYLSTVCVYGGVSYSAQQNALSRGVDVVVGTPGRIIDLVNSNSLKLGE  257

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V++LVLDEADQMLAVGFEEDVEVILEKLPS+RQSMLFSATMP+WVKKLARKYLN PLTID
Sbjct  258  VEFLVLDEADQMLAVGFEEDVEVILEKLPSERQSMLFSATMPAWVKKLARKYLNTPLTID  317

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD EEKLAEGIKL+AI TTATSKRTILSD+I+VYA
Sbjct  318  LVGDREEKLAEGIKLHAISTTATSKRTILSDIISVYA  354



>ref|XP_009381394.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=754

 Score =   364 bits (935),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 204/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITE-DEQSKFSQRRGRLPRVLVLAPTREL  179
            L+PALEG+DIIARAKTGTGKTLAFGIPIIKR++E DE  + S++ GRLPR LVLAPTREL
Sbjct  145  LLPALEGQDIIARAKTGTGKTLAFGIPIIKRLSEGDEGRRKSRQLGRLPRALVLAPTREL  204

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            A+QVEKEIKESAP+L+T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN+NSL+LGE
Sbjct  205  ARQVEKEIKESAPYLSTVCVYGGVSYNIQKNALSRGVDVVVGTPGRIIDLINDNSLRLGE  264

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQ+LVLDEADQMLAVGFEEDVEVILEKLPS+RQ+MLFSATMP WVKKLAR+ LN+PLTID
Sbjct  265  VQFLVLDEADQMLAVGFEEDVEVILEKLPSERQNMLFSATMPGWVKKLARRNLNDPLTID  324

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAIPTTATSKRTILSDL+ VYA
Sbjct  325  LVGDQDEKLAEGIKLYAIPTTATSKRTILSDLVTVYA  361



>ref|XP_009381386.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=769

 Score =   365 bits (936),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 180/217 (83%), Positives = 204/217 (94%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITE-DEQSKFSQRRGRLPRVLVLAPTREL  179
            L+PALEG+DIIARAKTGTGKTLAFGIPIIKR++E DE  + S++ GRLPR LVLAPTREL
Sbjct  145  LLPALEGQDIIARAKTGTGKTLAFGIPIIKRLSEGDEGRRKSRQLGRLPRALVLAPTREL  204

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            A+QVEKEIKESAP+L+T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN+NSL+LGE
Sbjct  205  ARQVEKEIKESAPYLSTVCVYGGVSYNIQKNALSRGVDVVVGTPGRIIDLINDNSLRLGE  264

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQ+LVLDEADQMLAVGFEEDVEVILEKLPS+RQ+MLFSATMP WVKKLAR+ LN+PLTID
Sbjct  265  VQFLVLDEADQMLAVGFEEDVEVILEKLPSERQNMLFSATMPGWVKKLARRNLNDPLTID  324

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAIPTTATSKRTILSDL+ VYA
Sbjct  325  LVGDQDEKLAEGIKLYAIPTTATSKRTILSDLVTVYA  361



>emb|CAN77581.1| hypothetical protein VITISV_015347 [Vitis vinifera]
Length=786

 Score =   365 bits (936),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 186/236 (79%), Positives = 204/236 (86%), Gaps = 24/236 (10%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRD+IARAKTGTGKTLAFGIPIIKR++ED++ + SQRR GRLPRVLVLAPTREL
Sbjct  147  LVPALEGRDLIARAKTGTGKTLAFGIPIIKRLSEDDEKRTSQRRSGRLPRVLVLAPTREL  206

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY+TQ++ALSRGVDVVVGTPGR+IDLI  NSLKLGE
Sbjct  207  AKQVEKEIKESAPYLSTVCVYGGVSYITQQNALSRGVDVVVGTPGRIIDLIKGNSLKLGE  266

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQ LVLDEADQMLAVGFEEDVEVILEKLPS+RQSMLFSATMP+WVKKLARKYL+NPLTID
Sbjct  267  VQNLVLDEADQMLAVGFEEDVEVILEKLPSERQSMLFSATMPAWVKKLARKYLDNPLTID  326

Query  540  L-----------------------VGDEEEKLAEGIKLYAIPTTATSKRTILSDLI  638
            L                       VGD +EKLAEGIKLYAIPTTATSKRTILSDLI
Sbjct  327  LGNFCPHWGLNLEPPKNPPQTLDHVGDHDEKLAEGIKLYAIPTTATSKRTILSDLI  382



>gb|AAC13590.1| contains similarity to the conserved C-terminal domain of helicases 
(Pfam: helicase_C.hmm, score: 90.11), similar to DEAD-box 
h, partial [Arabidopsis thaliana]
Length=477

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 196/219 (89%), Gaps = 3/219 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITE---DEQSKFSQRRGRLPRVLVLAPTR  173
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE   D  +  S R GRLP+ LVLAPTR
Sbjct  133  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEEAGDYTAFRSLRSGRLPKFLVLAPTR  192

Query  174  ELAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKL  353
            ELAKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKL
Sbjct  193  ELAKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKL  252

Query  354  GEVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLT  533
            GEV+YLVLDEADQMLAVGFEE VE ILE LP++RQSMLFSATMP+WVKKLARKYL+NPL 
Sbjct  253  GEVEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLN  312

Query  534  IDLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            IDLVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  313  IDLVGDQDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  351



>ref|XP_006841548.1| hypothetical protein AMTR_s00003p00168720 [Amborella trichopoda]
 gb|ERN03223.1| hypothetical protein AMTR_s00003p00168720 [Amborella trichopoda]
Length=768

 Score =   363 bits (932),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/216 (83%), Positives = 198/216 (92%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDII RAKTGTGKTLAF IPIIKR+ ++ +S     RGRLPRVLVLAPTRELA
Sbjct  158  LVPALEGRDIIGRAKTGTGKTLAFAIPIIKRLDDEGRSP---SRGRLPRVLVLAPTRELA  214

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+L+T C+ GGVSY  Q++AL+RGVDVVVGTPGR+IDL+N NSL+LGEV
Sbjct  215  KQVEKEIKESAPYLSTVCVYGGVSYNIQQNALTRGVDVVVGTPGRIIDLVNGNSLQLGEV  274

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVEVILEKLP+ RQSMLFSATMP WVKKLARKYL+NP+TIDL
Sbjct  275  QYLVLDEADQMLAVGFEEDVEVILEKLPTGRQSMLFSATMPGWVKKLARKYLDNPMTIDL  334

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD+EEKLAEGIKLYAIPTTAT+KRTIL DLI VYA
Sbjct  335  VGDQEEKLAEGIKLYAIPTTATTKRTILGDLITVYA  370



>gb|EYU33253.1| hypothetical protein MIMGU_mgv1a001505mg [Erythranthe guttata]
Length=806

 Score =   364 bits (934),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPI+K + + E  + S RRGR P+VLVLAPTRELA
Sbjct  148  LVPALEGRDIIARAKTGTGKTLAFGIPILKGL-DAENERGSLRRGRFPKVLVLAPTRELA  206

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ESAP+L+T CI GGVSYVTQ+SAL+RGVDVVVGTPGR+IDLINNN+L+LGEV
Sbjct  207  KQVEKEFTESAPYLSTVCIYGGVSYVTQQSALTRGVDVVVGTPGRIIDLINNNNLQLGEV  266

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVE I+EKLP  RQSMLFSATMPSWVKKLAR+++NNPLTIDL
Sbjct  267  QYLVLDEADQMLAVGFEEDVETIMEKLPPVRQSMLFSATMPSWVKKLARRFMNNPLTIDL  326

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYAIPTT TSKR+IL DL+ VYA
Sbjct  327  VGDQDEKLAEGIKLYAIPTTTTSKRSILGDLVTVYA  362



>ref|XP_003555166.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Glycine max]
Length=736

 Score =   361 bits (926),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEG+DIIARAKTGTGKTLAFGIPI+K +T+D++    +R GRLP+ LVLAPTRELA
Sbjct  125  LVPALEGKDIIARAKTGTGKTLAFGIPILKGLTDDDEQSSHRRSGRLPKALVLAPTRELA  184

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEI+ESAP+L T C+ GGVSYVTQ+ ALS GVDVVVGTPGR+IDL+N NSLKL EV
Sbjct  185  KQVEKEIQESAPYLKTVCVYGGVSYVTQQGALSHGVDVVVGTPGRIIDLVNGNSLKLSEV  244

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEAD+MLAVGFEEDVEVIL+K+P+QRQ+MLFSATMP WVKKL+RKYLNNPLTIDL
Sbjct  245  QYLVLDEADRMLAVGFEEDVEVILDKVPAQRQTMLFSATMPGWVKKLSRKYLNNPLTIDL  304

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG++EEKLAEGIKLYA+  TA+SKRT+LSDLI VYA
Sbjct  305  VGEQEEKLAEGIKLYALSATASSKRTVLSDLITVYA  340



>gb|ACG27839.1| nucleolar RNA helicase 2 [Zea mays]
Length=744

 Score =   360 bits (925),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPALEGRD+IARAKTGTGKTLAFGIP+IK++ E +  + + RRGR PRVLVLAPTRELA
Sbjct  119  LIPALEGRDLIARAKTGTGKTLAFGIPMIKQLIEQDDGRIT-RRGRTPRVLVLAPTRELA  177

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP L T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV
Sbjct  178  KQVEKEIKESAPKLGTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEV  237

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVE IL++LP+ RQSMLFSATMPSWVKKL+R+YLNNPLTIDL
Sbjct  238  QYLVLDEADQMLAVGFEEDVETILQQLPAGRQSMLFSATMPSWVKKLSRRYLNNPLTIDL  297

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYAIP TATSKRT+LSDLI VYA
Sbjct  298  VGDQDEKLAEGIKLYAIPLTATSKRTVLSDLITVYA  333



>gb|AIG56841.1| DEAD-box RNA helicase [Triticum aestivum]
Length=550

 Score =   355 bits (910),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPALEGRD+IARAKTGTGKTLAFGIP+IK+I E ++ + +  RGR+PR LVLAPTRELA
Sbjct  127  LIPALEGRDLIARAKTGTGKTLAFGIPMIKQIIEQDEGR-TPGRGRIPRALVLAPTRELA  185

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEI ESAP L+T C+ GGVSY TQ++ALSRGVDVVVGTPGRLIDLIN  SL+LGEV
Sbjct  186  KQVEKEIMESAPKLSTVCVYGGVSYNTQQNALSRGVDVVVGTPGRLIDLINGGSLQLGEV  245

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVE IL++LP++RQSMLFSATMPSWVKKL+R+YL+NPLTIDL
Sbjct  246  RYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPSWVKKLSRRYLDNPLTIDL  305

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKL+AIP T TSKRTILSDLI VYA
Sbjct  306  VGDQDEKLAEGIKLFAIPLTTTSKRTILSDLITVYA  341



>gb|KHN17840.1| DEAD-box ATP-dependent RNA helicase 3, chloroplastic [Glycine 
soja]
Length=736

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/216 (80%), Positives = 198/216 (92%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEG+DIIARAKTGTGKTLAFGIPI+K +T+D++    +R GRLP+ LVLAPTRELA
Sbjct  125  LVPALEGKDIIARAKTGTGKTLAFGIPILKGLTDDDEQSSHRRSGRLPKALVLAPTRELA  184

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEI+ESAP+L T C+ GGVSYVTQ+ ALS GVDVVVGTPGR+IDL+N NSLKL EV
Sbjct  185  KQVEKEIQESAPYLKTVCVYGGVSYVTQQGALSHGVDVVVGTPGRIIDLVNGNSLKLSEV  244

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEAD+MLAVGFEEDVEVIL+K+P+QRQ++LFSATMP WVKKL+RKYLNNPLTIDL
Sbjct  245  QYLVLDEADRMLAVGFEEDVEVILDKVPAQRQTILFSATMPGWVKKLSRKYLNNPLTIDL  304

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG++EEKLAEGIKLYA+  TATSKRT+LSDLI VYA
Sbjct  305  VGEQEEKLAEGIKLYALSATATSKRTVLSDLITVYA  340



>ref|XP_011039072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Populus euphratica]
Length=776

 Score =   361 bits (926),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 197/218 (90%), Gaps = 2/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR--GRLPRVLVLAPTRE  176
            LIPALEGRD+IARAKTGTGKTLAFGIPIIKR+TED       RR  GRLP+VLVLAPTRE
Sbjct  164  LIPALEGRDLIARAKTGTGKTLAFGIPIIKRLTEDCXXXXLARRRTGRLPKVLVLAPTRE  223

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESA +L+T C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDL+  NSLKLG
Sbjct  224  LAKQVEKEIKESATYLSTVCVYGGVSYVTQQSALSRGVDVVVGTPGRIIDLLKGNSLKLG  283

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQML+ GFEEDVEVILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL I
Sbjct  284  EVEYLVLDEADQMLSFGFEEDVEVILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLQI  343

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD+EEKLAEGIKLYA+  TA SKRTILSDL+ VYA
Sbjct  344  DLVGDQEEKLAEGIKLYALSATAASKRTILSDLVTVYA  381



>ref|XP_009383719.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=776

 Score =   361 bits (926),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 202/217 (93%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITE-DEQSKFSQRRGRLPRVLVLAPTREL  179
            L+PALEGRD+IARAKTGTGKTLAFGIPIIKR++E D   K S++ G LPRVLVLAPTREL
Sbjct  167  LLPALEGRDLIARAKTGTGKTLAFGIPIIKRLSEADLGRKTSRQSGHLPRVLVLAPTREL  226

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEI ESAP+L+T C+ GGVSY  Q+SALSRGVDVVVGTPGR+IDLIN+NSL+LGE
Sbjct  227  AKQVEKEIDESAPYLSTVCVYGGVSYNVQKSALSRGVDVVVGTPGRIIDLINDNSLRLGE  286

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEAD+MLAVGFEEDVE+ILEKLPS+RQSMLFSATMP WVKKLAR++LN+PL +D
Sbjct  287  VEYLVLDEADRMLAVGFEEDVELILEKLPSKRQSMLFSATMPDWVKKLARRHLNDPLIVD  346

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYA+PTT+TSKRTILSDLI VYA
Sbjct  347  LVGDQDEKLAEGIKLYAVPTTSTSKRTILSDLITVYA  383



>ref|NP_001051773.1| Os03g0827700 [Oryza sativa Japonica Group]
 dbj|BAF13687.1| Os03g0827700, partial [Oryza sativa Japonica Group]
Length=723

 Score =   358 bits (920),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPAL+GRD+IARAKTGTGKTLAFGIP+IK++ E++  + S RRGR+PRVLVLAPTRELA
Sbjct  100  LIPALDGRDLIARAKTGTGKTLAFGIPMIKQLMEEDDGR-SVRRGRIPRVLVLAPTRELA  158

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP L+T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV
Sbjct  159  KQVEKEIKESAPKLSTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEV  218

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVE IL++LP++RQSMLFSATMP WVKKL+R+YLNNPLTIDL
Sbjct  219  KYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPGWVKKLSRRYLNNPLTIDL  278

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYAIP T+TSKRT+LSDLI VYA
Sbjct  279  VGDQDEKLAEGIKLYAIPLTSTSKRTVLSDLITVYA  314



>ref|XP_008681151.1| PREDICTED: uncharacterized protein LOC100193526 isoform X1 [Zea 
mays]
 gb|AFW67097.1| putative DEAD-box ATP-dependent RNA helicase family protein [Zea 
mays]
Length=745

 Score =   358 bits (920),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 196/216 (91%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPAL GRD+IARAKTGTGKTLAFGIP+IK++ E +  + S RRGR PRVLVLAPTRELA
Sbjct  119  LIPALGGRDLIARAKTGTGKTLAFGIPMIKQLMEQDDGR-STRRGRTPRVLVLAPTRELA  177

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP L T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV
Sbjct  178  KQVEKEIKESAPKLGTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEV  237

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVE IL++LP+ RQSMLFSATMPSWVKKL+R+YLNNPLTIDL
Sbjct  238  QYLVLDEADQMLAVGFEEDVETILQQLPADRQSMLFSATMPSWVKKLSRRYLNNPLTIDL  297

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKL+AIP TATSKRTILSDLI VYA
Sbjct  298  VGDQDEKLAEGIKLHAIPLTATSKRTILSDLITVYA  333



>ref|XP_008671379.1| PREDICTED: uncharacterized protein LOC100191761 isoform X1 [Zea 
mays]
 tpg|DAA52300.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=743

 Score =   358 bits (920),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 196/216 (91%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPALEGRD+IARAKTGTGKTLAFGIP+IK++ E +  + + RRGR PRVLVLAPTRELA
Sbjct  119  LIPALEGRDLIARAKTGTGKTLAFGIPMIKQLIEQDDGRIT-RRGRTPRVLVLAPTRELA  177

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP L T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV
Sbjct  178  KQVEKEIKESAPKLGTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEV  237

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVE IL++LP+ RQSMLFSATMPSWVKKL+R+YLNNPLTIDL
Sbjct  238  QYLVLDEADQMLAVGFEEDVETILQQLPAGRQSMLFSATMPSWVKKLSRRYLNNPLTIDL  297

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYAIP T TSKRT+LSDLI VYA
Sbjct  298  VGDQDEKLAEGIKLYAIPLTTTSKRTVLSDLITVYA  333



>ref|XP_008681152.1| PREDICTED: uncharacterized protein LOC100193526 isoform X2 [Zea 
mays]
Length=744

 Score =   358 bits (920),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 177/216 (82%), Positives = 196/216 (91%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPAL GRD+IARAKTGTGKTLAFGIP+IK++ E +  + S RRGR PRVLVLAPTRELA
Sbjct  119  LIPALGGRDLIARAKTGTGKTLAFGIPMIKQLMEQDDGR-STRRGRTPRVLVLAPTRELA  177

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP L T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV
Sbjct  178  KQVEKEIKESAPKLGTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEV  237

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEEDVE IL++LP+ RQSMLFSATMPSWVKKL+R+YLNNPLTIDL
Sbjct  238  QYLVLDEADQMLAVGFEEDVETILQQLPADRQSMLFSATMPSWVKKLSRRYLNNPLTIDL  297

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKL+AIP TATSKRTILSDLI VYA
Sbjct  298  VGDQDEKLAEGIKLHAIPLTATSKRTILSDLITVYA  333



>gb|KJB45516.1| hypothetical protein B456_007G309800, partial [Gossypium raimondii]
Length=728

 Score =   357 bits (917),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 193/216 (89%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIK+ITEDE  +  +  GRLPRVLVLAPTRELA
Sbjct  211  LVPALQGRDIIARAKTGTGKTLAFGIPIIKQITEDEGQRTRRMSGRLPRVLVLAPTRELA  270

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESA +LNT C+ GGVSY  Q +ALSRGVDVVVGTPGR+IDLI +  L+LGEV
Sbjct  271  KQVEKEIKESASYLNTVCVYGGVSYNLQRNALSRGVDVVVGTPGRIIDLIESKDLRLGEV  330

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEE VE ILE LPS+RQSMLFSATMPSWVKKLARKYL+NPL IDL
Sbjct  331  EYLVLDEADQMLAVGFEEAVEEILENLPSKRQSMLFSATMPSWVKKLARKYLDNPLNIDL  390

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD +EKLAEGIKLYAI  TATSKRTILSDLI VYA
Sbjct  391  VGDRDEKLAEGIKLYAISATATSKRTILSDLITVYA  426



>ref|XP_010493909.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=623

 Score =   354 bits (909),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPIIKR+TE      + RR GRLP+ LVLAPTREL
Sbjct  8    LVPALEGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYTAFRRSGRLPKFLVLAPTREL  67

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  68   AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  127

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  128  VEYLVLDEADQMLAVGFEEAVESILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLNID  187

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  188  LVGDKDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  224



>sp|Q0DM51.2|RH3_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 3, chloroplastic; 
Flags: Precursor [Oryza sativa Japonica Group]
 gb|AAL79753.1|AC096687_17 putative RNA helicase [Oryza sativa Japonica Group]
Length=758

 Score =   358 bits (919),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPAL+GRD+IARAKTGTGKTLAFGIP+IK++ E++  + S RRGR+PRVLVLAPTRELA
Sbjct  135  LIPALDGRDLIARAKTGTGKTLAFGIPMIKQLMEEDDGR-SVRRGRIPRVLVLAPTRELA  193

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP L+T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV
Sbjct  194  KQVEKEIKESAPKLSTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEV  253

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVE IL++LP++RQSMLFSATMP WVKKL+R+YLNNPLTIDL
Sbjct  254  KYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPGWVKKLSRRYLNNPLTIDL  313

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYAIP T+TSKRT+LSDLI VYA
Sbjct  314  VGDQDEKLAEGIKLYAIPLTSTSKRTVLSDLITVYA  349



>gb|EEC76452.1| hypothetical protein OsI_14162 [Oryza sativa Indica Group]
Length=779

 Score =   358 bits (920),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/216 (81%), Positives = 200/216 (93%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPAL+GRD+IARAKTGTGKTLAFGIP+IK++ E++  + S RRGR+PRVLVLAPTRELA
Sbjct  156  LIPALDGRDLIARAKTGTGKTLAFGIPMIKQLMEEDDGR-SVRRGRIPRVLVLAPTRELA  214

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP L+T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV
Sbjct  215  KQVEKEIKESAPKLSTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEV  274

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVE IL++LP++RQSMLFSATMP WVKKL+R+YLNNPLTIDL
Sbjct  275  KYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPGWVKKLSRRYLNNPLTIDL  334

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYAIP T+TSKRT+LSDLI VYA
Sbjct  335  VGDQDEKLAEGIKLYAIPLTSTSKRTVLSDLITVYA  370



>emb|CDX87045.1| BnaC09g03600D [Brassica napus]
Length=746

 Score =   357 bits (916),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 195/216 (90%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPIIKR+TE +   +S+R GRLP+ LVLAPTRELA
Sbjct  128  LVPALEGRDIIARAKTGTGKTLAFGIPIIKRLTE-QAGDYSERSGRLPKFLVLAPTRELA  186

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+L+T C+ GGVSY  Q+SALSRGVDVVVGTPGR+IDLI   SLKLGE+
Sbjct  187  KQVEKEIKESAPYLSTVCVYGGVSYTIQQSALSRGVDVVVGTPGRIIDLIEGRSLKLGEI  246

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLARKYL+NPL IDL
Sbjct  247  EYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPTWVKKLARKYLDNPLNIDL  306

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYAI  T+TSKRTILSDLI VYA
Sbjct  307  VGDQDEKLAEGIKLYAISATSTSKRTILSDLITVYA  342



>ref|XP_003591285.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=615

 Score =   353 bits (906),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 191/216 (88%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRDIIARAKTGTGKTLAFGIPIIK +TE+EQS   +R GRLP+VLVLAPTRELA
Sbjct  118  LLPALEGRDIIARAKTGTGKTLAFGIPIIKGLTENEQSNMMRRSGRLPKVLVLAPTRELA  177

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+LNT C+ GGVSY  Q +ALSRGVDVVVGTPGRLIDLIN  +LKL E+
Sbjct  178  KQVEKEIKESAPYLNTVCVYGGVSYDIQRNALSRGVDVVVGTPGRLIDLINGGTLKLAEI  237

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QYLVLDEADQMLAVGFEE VE ILE +PSQRQ MLFSATMP WVKKL+RK+LNNPLTIDL
Sbjct  238  QYLVLDEADQMLAVGFEESVEEILESIPSQRQIMLFSATMPGWVKKLSRKHLNNPLTIDL  297

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD EEKLAEGIKLYA+  T+TSKR IL  LI+ YA
Sbjct  298  VGDREEKLAEGIKLYAVSATSTSKRRILYGLISAYA  333



>ref|NP_001190402.1| DEAD-box ATP-dependent RNA helicase 3 [Arabidopsis thaliana]
 gb|AED93566.1| DEAD-box ATP-dependent RNA helicase 3 [Arabidopsis thaliana]
Length=655

 Score =   353 bits (907),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE+     + RR GRLP+ LVLAPTREL
Sbjct  40   LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEEAGDYTAFRRSGRLPKFLVLAPTREL  99

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  100  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  159

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LP++RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  160  VEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNID  219

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  220  LVGDQDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  256



>ref|XP_004495832.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Cicer arietinum]
Length=571

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 196/216 (91%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PA+EGRDIIARAKTGTGKTLAFGIPI+K +TED+Q+   +R GRLP+VLVLAPTRELA
Sbjct  124  LLPAIEGRDIIARAKTGTGKTLAFGIPILKGLTEDQQTNL-RRSGRLPKVLVLAPTRELA  182

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+LNT C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDL+N NSLKL ++
Sbjct  183  KQVEKEIKESAPYLNTICVYGGVSYDIQKNALSRGVDVVVGTPGRIIDLVNGNSLKLSQI  242

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            QY VLDEADQMLAVGFEEDVEVILE++P+QRQ MLFSATMP WVKKL+RK+LNNPLTIDL
Sbjct  243  QYFVLDEADQMLAVGFEEDVEVILERIPTQRQIMLFSATMPGWVKKLSRKHLNNPLTIDL  302

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD+EEKLA+ IKLYA+  TATSKR IL  LI+VYA
Sbjct  303  VGDKEEKLADRIKLYAVSATATSKRRILFGLISVYA  338



>dbj|BAD21122.1| ATP-dependent RNA helicase [Hordeum vulgare subsp. vulgare]
 dbj|BAK05234.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=764

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPALEGRD+IARAKTGTGKTLAFGIP+IK+I E ++ + +  RGR+PR LVLAPTRELA
Sbjct  122  LIPALEGRDLIARAKTGTGKTLAFGIPMIKQIIEQDEGR-TPGRGRIPRALVLAPTRELA  180

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEI ESAP L+T C+ GGVSY TQ++ALSRGVDVVVGTPGRLIDLIN  SL+LGEV
Sbjct  181  KQVEKEIMESAPKLSTVCVYGGVSYNTQQNALSRGVDVVVGTPGRLIDLINGGSLQLGEV  240

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVE IL++LP++RQSMLFSATMPSWVKKL+R+YLNNPLTIDL
Sbjct  241  RYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPSWVKKLSRRYLNNPLTIDL  300

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKL+AIP T TSKRTILSDLI VYA
Sbjct  301  VGDQDEKLAEGIKLFAIPLTTTSKRTILSDLITVYA  336



>ref|XP_003563192.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Brachypodium distachyon]
Length=769

 Score =   356 bits (913),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 176/216 (81%), Positives = 197/216 (91%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPALEGRD+IARAKTGTGKTLAFGIP+IK+I E ++ + S  RGR+PR LVLAPTRELA
Sbjct  125  LIPALEGRDLIARAKTGTGKTLAFGIPMIKQIIEQDEGR-SLGRGRIPRALVLAPTRELA  183

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEI ESAP L+T C+ GGVSY  Q++ALSRGVDVVVGTPGRLIDLIN  SL+LGEV
Sbjct  184  KQVEKEIMESAPKLSTVCVYGGVSYNVQQNALSRGVDVVVGTPGRLIDLINGGSLQLGEV  243

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVE IL++LP++RQSMLFSATMPSWVKKL+R+YLNNPLTIDL
Sbjct  244  RYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPSWVKKLSRRYLNNPLTIDL  303

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKLYAIP T TSKRTILSDLI VYA
Sbjct  304  VGDQDEKLAEGIKLYAIPLTVTSKRTILSDLITVYA  339



>ref|XP_010421509.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Camelina sativa]
Length=747

 Score =   355 bits (910),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 178/217 (82%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPIIKR+TE      + RR GRLP+ LVLAPTREL
Sbjct  133  LVPALEGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYTAFRRSGRLPKFLVLAPTREL  192

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  193  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  252

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  253  VEYLVLDEADQMLAVGFEEAVESILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLNID  312

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  313  LVGDKDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  349



>ref|XP_004165586.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like, 
partial [Cucumis sativus]
Length=726

 Score =   354 bits (908),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRD+IARAKTGTGKTLAFGIPI+K++TED++S+  +RR RLPRVLVL PTRELA
Sbjct  143  LVPALEGRDLIARAKTGTGKTLAFGIPILKKLTEDDESRSLRRRSRLPRVLVLTPTRELA  202

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+LNT C+ GGVSY+TQ++ALSRGVDVVVGTPGRLIDLIN NSL LGEV
Sbjct  203  KQVEKEIKESAPYLNTVCVYGGVSYITQQNALSRGVDVVVGTPGRLIDLINGNSLNLGEV  262

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVEVILEKLPSQRQ+MLFSATMP+WVKKLARKYL+NPLTIDL
Sbjct  263  EYLVLDEADQMLAVGFEEDVEVILEKLPSQRQNMLFSATMPTWVKKLARKYLDNPLTIDL  322

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKL+AI TTATSK+TIL DL+ VYA
Sbjct  323  VGDQDEKLAEGIKLHAILTTATSKQTILRDLVTVYA  358



>gb|KHG19221.1| DEAD-box ATP-dependent RNA helicase 3, chloroplastic -like protein 
[Gossypium arboreum]
Length=765

 Score =   355 bits (911),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 193/216 (89%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIK+ITEDE  +  +  GRLPRVLVLAPTRELA
Sbjct  141  LVPALQGRDIIARAKTGTGKTLAFGIPIIKQITEDEGQRTRRVSGRLPRVLVLAPTRELA  200

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESA +LNT C+ GGVSY  Q +ALSRGVDVVVGTPGR+IDLI +  L+LGEV
Sbjct  201  KQVEKEIKESASYLNTVCVYGGVSYNLQRNALSRGVDVVVGTPGRIIDLIESKDLRLGEV  260

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEE VE ILE LPS+RQSMLFSATMPSWVKKLARKYL+NPL IDL
Sbjct  261  EYLVLDEADQMLAVGFEEAVEEILENLPSKRQSMLFSATMPSWVKKLARKYLDNPLNIDL  320

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD +EKLAEGIKLYAI  TATSKRTILSDLI VYA
Sbjct  321  VGDGDEKLAEGIKLYAISATATSKRTILSDLITVYA  356



>ref|XP_002874312.1| RNA helicase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50571.1| RNA helicase [Arabidopsis lyrata subsp. lyrata]
Length=748

 Score =   354 bits (909),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 177/218 (81%), Positives = 198/218 (91%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE+  + S F +R GRLP+ LVLAPTRE
Sbjct  133  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEEAGDYSAF-RRSGRLPKFLVLAPTRE  191

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLG
Sbjct  192  LAKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLG  251

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LP++RQSMLFSATMP+WVKKLARKYL+NPL I
Sbjct  252  EVEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNI  311

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  312  DLVGDQDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  349



>ref|XP_006290010.1| hypothetical protein CARUB_v10003641mg [Capsella rubella]
 gb|EOA22908.1| hypothetical protein CARUB_v10003641mg [Capsella rubella]
Length=746

 Score =   354 bits (909),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 195/217 (90%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPIIKR+TE      + RR GRLP+ LVLAPTREL
Sbjct  132  LVPALEGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYTAFRRSGRLPKFLVLAPTREL  191

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  192  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  251

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LP++RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  252  VEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNID  311

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  312  LVGDQDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  348



>gb|KJB45517.1| hypothetical protein B456_007G309800, partial [Gossypium raimondii]
Length=820

 Score =   356 bits (913),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 178/216 (82%), Positives = 193/216 (89%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIK+ITEDE  +  +  GRLPRVLVLAPTRELA
Sbjct  211  LVPALQGRDIIARAKTGTGKTLAFGIPIIKQITEDEGQRTRRMSGRLPRVLVLAPTRELA  270

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESA +LNT C+ GGVSY  Q +ALSRGVDVVVGTPGR+IDLI +  L+LGEV
Sbjct  271  KQVEKEIKESASYLNTVCVYGGVSYNLQRNALSRGVDVVVGTPGRIIDLIESKDLRLGEV  330

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEE VE ILE LPS+RQSMLFSATMPSWVKKLARKYL+NPL IDL
Sbjct  331  EYLVLDEADQMLAVGFEEAVEEILENLPSKRQSMLFSATMPSWVKKLARKYLDNPLNIDL  390

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD +EKLAEGIKLYAI  TATSKRTILSDLI VYA
Sbjct  391  VGDRDEKLAEGIKLYAISATATSKRTILSDLITVYA  426



>gb|EEE60225.1| hypothetical protein OsJ_13207 [Oryza sativa Japonica Group]
Length=697

 Score =   353 bits (905),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 198/214 (93%), Gaps = 1/214 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPAL+GRD+IARAKTGTGKTLAFGIP+IK++ E++  + S RRGR+PRVLVLAPTRELA
Sbjct  149  LIPALDGRDLIARAKTGTGKTLAFGIPMIKQLMEEDDGR-SVRRGRIPRVLVLAPTRELA  207

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP L+T C+ GGVSY  Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV
Sbjct  208  KQVEKEIKESAPKLSTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGEV  267

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVE IL++LP++RQSMLFSATMP WVKKL+R+YLNNPLTIDL
Sbjct  268  KYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPGWVKKLSRRYLNNPLTIDL  327

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAV  644
            VGD++EKLAEGIKLYAIP T+TSKRT+LSDLI +
Sbjct  328  VGDQDEKLAEGIKLYAIPLTSTSKRTVLSDLITI  361



>ref|XP_008450498.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Cucumis melo]
Length=748

 Score =   354 bits (908),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRD+IARAKTGTGKTLAFGIPI+K++TED++S+  +RR RLPRVLVL PTRELA
Sbjct  143  LVPALEGRDLIARAKTGTGKTLAFGIPILKKLTEDDESRSLRRRSRLPRVLVLTPTRELA  202

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+LNT C+ GGVSYVTQ++ALSRGVDVVVGTPGRLIDLIN NSL LGEV
Sbjct  203  KQVEKEIKESAPYLNTVCVYGGVSYVTQQNALSRGVDVVVGTPGRLIDLINGNSLNLGEV  262

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVEVILEKLPSQRQ+MLFSATMP+WVKKLARKYL+NPLTIDL
Sbjct  263  EYLVLDEADQMLAVGFEEDVEVILEKLPSQRQNMLFSATMPTWVKKLARKYLDNPLTIDL  322

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKL+AI TTATSK+TIL DL+ VYA
Sbjct  323  VGDQDEKLAEGIKLHAILTTATSKQTILRDLVTVYA  358



>ref|NP_680225.2| DEAD-box ATP-dependent RNA helicase 3 [Arabidopsis thaliana]
 gb|AAM26693.1| At5g26743 [Arabidopsis thaliana]
 gb|AAO42779.1| At5g26743 [Arabidopsis thaliana]
 gb|AED93564.1| DEAD-box ATP-dependent RNA helicase 3 [Arabidopsis thaliana]
Length=747

 Score =   353 bits (907),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE+     + RR GRLP+ LVLAPTREL
Sbjct  133  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEEAGDYTAFRRSGRLPKFLVLAPTREL  192

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  193  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  252

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LP++RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  253  VEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNID  312

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  313  LVGDQDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  349



>ref|NP_001031943.1| DEAD-box ATP-dependent RNA helicase 3 [Arabidopsis thaliana]
 sp|Q8L7S8.2|RH3_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 3, chloroplastic; 
AltName: Full=Protein EMBRYO DEFECTIVE 1138; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL85971.1| unknown protein [Arabidopsis thaliana]
 gb|AAM13888.1| unknown protein [Arabidopsis thaliana]
 gb|AAM19851.1| At5g26752 [Arabidopsis thaliana]
 gb|AAM67533.1| unknown protein [Arabidopsis thaliana]
 gb|AAN31856.1| unknown protein [Arabidopsis thaliana]
 gb|AAN72300.1| At5g26752/At5g26752 [Arabidopsis thaliana]
 gb|AAO00816.1| Unknown protein [Arabidopsis thaliana]
 dbj|BAF01652.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED93565.1| DEAD-box ATP-dependent RNA helicase 3 [Arabidopsis thaliana]
Length=748

 Score =   353 bits (907),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE+     + RR GRLP+ LVLAPTREL
Sbjct  133  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEEAGDYTAFRRSGRLPKFLVLAPTREL  192

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  193  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  252

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LP++RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  253  VEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNID  312

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  313  LVGDQDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  349



>gb|AAM91087.1| At5g26740 [Arabidopsis thaliana]
Length=748

 Score =   353 bits (907),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE+     + RR GRLP+ LVLAPTREL
Sbjct  133  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEEAGDYTAFRRSGRLPKFLVLAPTREL  192

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  193  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  252

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LP++RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  253  VEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNID  312

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  313  LVGDQDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  349



>emb|CAA09196.1| RNA helicase [Arabidopsis thaliana]
Length=748

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 176/217 (81%), Positives = 196/217 (90%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE+     + RR GRLP+ LVLAPTREL
Sbjct  133  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEEAGDYTAFRRSGRLPKFLVLAPTREL  192

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  193  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  252

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LP++RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  253  VEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNID  312

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  313  LVGDQDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  349



>ref|XP_004135577.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN66001.1| hypothetical protein Csa_1G560830 [Cucumis sativus]
Length=748

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 182/216 (84%), Positives = 205/216 (95%), Gaps = 0/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PALEGRD+IARAKTGTGKTLAFGIPI+K++TED++S+  +RR RLPRVLVL PTRELA
Sbjct  143  LVPALEGRDLIARAKTGTGKTLAFGIPILKKLTEDDESRSLRRRSRLPRVLVLTPTRELA  202

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEIKESAP+LNT C+ GGVSY+TQ++ALSRGVDVVVGTPGRLIDLIN NSL LGEV
Sbjct  203  KQVEKEIKESAPYLNTVCVYGGVSYITQQNALSRGVDVVVGTPGRLIDLINGNSLNLGEV  262

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVEVILEKLPSQRQ+MLFSATMP+WVKKLARKYL+NPLTIDL
Sbjct  263  EYLVLDEADQMLAVGFEEDVEVILEKLPSQRQNMLFSATMPTWVKKLARKYLDNPLTIDL  322

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKL+AI TTATSK+TIL DL+ VYA
Sbjct  323  VGDQDEKLAEGIKLHAILTTATSKQTILRDLVTVYA  358



>ref|XP_010493908.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=748

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 194/217 (89%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPIIKR+TE      + RR G LP+ LVLAPTREL
Sbjct  133  LVPALEGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYTAFRRSGHLPKFLVLAPTREL  192

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  193  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  252

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  253  VEYLVLDEADQMLAVGFEEAVESILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLNID  312

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  313  LVGDKDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  349



>ref|XP_010455001.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Camelina sativa]
Length=747

 Score =   353 bits (905),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/217 (82%), Positives = 194/217 (89%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPIIKR+TE      + RR G LP+ LVLAPTREL
Sbjct  133  LVPALEGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYTAFRRSGHLPKFLVLAPTREL  192

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  193  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  252

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LPS+RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  253  VEYLVLDEADQMLAVGFEEAVESILENLPSKRQSMLFSATMPTWVKKLARKYLDNPLNID  312

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI TT+TSKRTILSDLI VYA
Sbjct  313  LVGDKDEKLAEGIKLYAIATTSTSKRTILSDLITVYA  349



>ref|XP_007145071.1| hypothetical protein PHAVU_007G207200g [Phaseolus vulgaris]
 gb|ESW17065.1| hypothetical protein PHAVU_007G207200g [Phaseolus vulgaris]
Length=740

 Score =   352 bits (902),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 195/219 (89%), Gaps = 3/219 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDE---QSKFSQRRGRLPRVLVLAPTR  173
            L+PALEGRDIIARAKTGTGKTLAFGIPI+K +T DE   +    +R G LP+ LVLAPTR
Sbjct  125  LLPALEGRDIIARAKTGTGKTLAFGIPILKGLTADEDGHEQNSHRRHGNLPKALVLAPTR  184

Query  174  ELAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKL  353
            ELAKQVEKE++ESAP+L T C+ GGVSYVTQ+SALSRGVDVVVGTPGR+IDL+N  SL L
Sbjct  185  ELAKQVEKEMQESAPYLKTVCVYGGVSYVTQKSALSRGVDVVVGTPGRIIDLVNGGSLNL  244

Query  354  GEVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLT  533
             EVQYLVLDEADQMLAVGFEEDVEVIL+K+P+QRQ+MLFSATMP WVKKL+RK+LNNPLT
Sbjct  245  SEVQYLVLDEADQMLAVGFEEDVEVILDKVPTQRQTMLFSATMPGWVKKLSRKHLNNPLT  304

Query  534  IDLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            IDLVG++EEKLAEGIKLYA+  TATSKR +LSDLI VYA
Sbjct  305  IDLVGEQEEKLAEGIKLYALSATATSKRIVLSDLITVYA  343



>gb|EMS52116.1| DEAD-box ATP-dependent RNA helicase 3, chloroplastic [Triticum 
urartu]
Length=884

 Score =   355 bits (910),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 175/216 (81%), Positives = 198/216 (92%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPALEGRD+IARAKTGTGKTLAFGIP+IK+I E ++ + +  RGR+PR LVLAPTRELA
Sbjct  132  LIPALEGRDLIARAKTGTGKTLAFGIPMIKQIIEQDEGR-TPGRGRIPRALVLAPTRELA  190

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEI ESAP L+T C+ GGVSY TQ++ALSRGVDVVVGTPGRLIDLIN  SL+LGEV
Sbjct  191  KQVEKEIMESAPKLSTVCVYGGVSYNTQQNALSRGVDVVVGTPGRLIDLINGGSLQLGEV  250

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVE IL++LP++RQSMLFSATMPSWVKKL+R+YLNNPLTIDL
Sbjct  251  RYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPSWVKKLSRRYLNNPLTIDL  310

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD++EKLAEGIKL+AIP T TSKRTILSDLI VYA
Sbjct  311  VGDQDEKLAEGIKLFAIPLTTTSKRTILSDLITVYA  346



>gb|KFK26417.1| hypothetical protein AALP_AA8G245800 [Arabis alpina]
Length=746

 Score =   351 bits (900),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 196/218 (90%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L+PALEGRDIIARAKTGTGKTLAFGIPIIKR+TE   + S F +R GRLP+ LVLAPTRE
Sbjct  125  LVPALEGRDIIARAKTGTGKTLAFGIPIIKRLTEQSGDYSAF-RRSGRLPKFLVLAPTRE  183

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLG
Sbjct  184  LAKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLG  243

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LP++RQSMLFSATMP+WVKKLARKYL+NPL I
Sbjct  244  EVEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNI  303

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI  T+T+KRTILSDLI VYA
Sbjct  304  DLVGDQDEKLAEGIKLYAIAATSTTKRTILSDLITVYA  341



>ref|XP_006394884.1| hypothetical protein EUTSA_v10003698mg [Eutrema salsugineum]
 ref|XP_006394885.1| hypothetical protein EUTSA_v10003698mg [Eutrema salsugineum]
 gb|ESQ32170.1| hypothetical protein EUTSA_v10003698mg [Eutrema salsugineum]
 gb|ESQ32171.1| hypothetical protein EUTSA_v10003698mg [Eutrema salsugineum]
Length=751

 Score =   349 bits (895),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 174/217 (80%), Positives = 193/217 (89%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE      + RR GRLP+ LVLAPTREL
Sbjct  135  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEQSGDYSAFRRPGRLPKFLVLAPTREL  194

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  195  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE  254

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  255  VEYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPTWVKKLARKYLDNPLNID  314

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD++EKLAEGIKLYAI  ++TSKRTILSDLI VYA
Sbjct  315  LVGDQDEKLAEGIKLYAISASSTSKRTILSDLITVYA  351



>ref|XP_009111705.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Brassica rapa]
Length=743

 Score =   348 bits (894),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 194/218 (89%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L+PALEGRDIIARAKTGTGKTLAFGIPIIKR+TE   + S F ++ GRLP+ LVLAPTRE
Sbjct  128  LVPALEGRDIIARAKTGTGKTLAFGIPIIKRLTEQSGDYSAF-RKSGRLPKFLVLAPTRE  186

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY  Q+SALSRGVDVVVGTPGR+IDLI   SLKLG
Sbjct  187  LAKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALSRGVDVVVGTPGRIIDLIEGRSLKLG  246

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLARK L+NPL I
Sbjct  247  EVEYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPTWVKKLARKSLDNPLNI  306

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI  T+TSKRTILSDLI VYA
Sbjct  307  DLVGDQDEKLAEGIKLYAISATSTSKRTILSDLITVYA  344



>ref|XP_009129927.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Brassica rapa]
Length=739

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 195/218 (89%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE   + S F ++ GRLP+ LVLAPTRE
Sbjct  118  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYSAF-RKSGRLPKFLVLAPTRE  176

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLG
Sbjct  177  LAKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLG  236

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLARKYL++PL I
Sbjct  237  EVEYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPAWVKKLARKYLDSPLNI  296

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI  T+TSKRTILSDLI VYA
Sbjct  297  DLVGDQDEKLAEGIKLYAISATSTSKRTILSDLITVYA  334



>emb|CDY05524.1| BnaA02g31670D [Brassica napus]
Length=738

 Score =   347 bits (891),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 195/218 (89%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE   + S F ++ GRLP+ LVLAPTRE
Sbjct  118  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYSAF-RKSGRLPKFLVLAPTRE  176

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLG
Sbjct  177  LAKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLG  236

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLARKYL++PL I
Sbjct  237  EVEYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPAWVKKLARKYLDSPLNI  296

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI  T+TSKRTILSDLI VYA
Sbjct  297  DLVGDQDEKLAEGIKLYAISATSTSKRTILSDLITVYA  334



>emb|CDY66725.1| BnaC02g48430D [Brassica napus]
Length=743

 Score =   346 bits (888),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 195/218 (89%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE   + S F ++ GRLP+ LVLAPTRE
Sbjct  124  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYSAF-RKSGRLPKFLVLAPTRE  182

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY  Q+SAL+RGVDVVVGTPGR+IDLI   SLKLG
Sbjct  183  LAKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLG  242

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLARKYL++PL I
Sbjct  243  EVEYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPAWVKKLARKYLDSPLNI  302

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI  T+TSKRTILSDLI +YA
Sbjct  303  DLVGDQDEKLAEGIKLYAISATSTSKRTILSDLITLYA  340



>emb|CDX80564.1| BnaC07g28800D [Brassica napus]
Length=728

 Score =   345 bits (886),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 194/218 (89%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE   + S F +R GRL + LVLAPTRE
Sbjct  110  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYSAF-RRPGRLAKFLVLAPTRE  168

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY  Q++AL+RGVDVVVGTPGR+IDLI   SLKLG
Sbjct  169  LAKQVEKEIKESAPYLSTVCVYGGVSYTIQQNALTRGVDVVVGTPGRIIDLIEGRSLKLG  228

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLARKYL+NPL I
Sbjct  229  EVEYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPTWVKKLARKYLDNPLNI  288

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI  T+TSKRTILSDLI VYA
Sbjct  289  DLVGDQDEKLAEGIKLYAISATSTSKRTILSDLITVYA  326



>emb|CDY19766.1| BnaA09g04190D [Brassica napus]
Length=761

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRR-GRLPRVLVLAPTREL  179
            L+PALEGRDIIARAKTGTGKTLAFGIPIIKR+TE   +  + R+ GRLP+ LVLAPTREL
Sbjct  126  LVPALEGRDIIARAKTGTGKTLAFGIPIIKRLTEQSWNYSAFRKSGRLPKFLVLAPTREL  185

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKEIKESAP+L+T C+ GGVSY  Q+SALSRGVDVVVGTPGR+IDLI   SLKLGE
Sbjct  186  AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALSRGVDVVVGTPGRIIDLIEGRSLKLGE  245

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLARKYL+NPL ID
Sbjct  246  VEYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPTWVKKLARKYLDNPLNID  305

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLI  638
            LVGD++EKLAEGIKLYAI  T+TSKRTILSDLI
Sbjct  306  LVGDQDEKLAEGIKLYAISATSTSKRTILSDLI  338



>ref|XP_009151140.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic 
[Brassica rapa]
Length=748

 Score =   345 bits (884),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 194/218 (89%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE   + S F +R GRL + LVLAPTRE
Sbjct  129  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYSAF-RRPGRLAKFLVLAPTRE  187

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY  Q++AL+RGVDVVVGTPGR+IDLI   SLKLG
Sbjct  188  LAKQVEKEIKESAPYLSTVCVYGGVSYTIQQNALTRGVDVVVGTPGRIIDLIEGRSLKLG  247

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLARKYL+NPL I
Sbjct  248  EVEYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPTWVKKLARKYLDNPLNI  307

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI  T+TSKRTILSDLI VYA
Sbjct  308  DLVGDQDEKLAEGIKLYAISATSTSKRTILSDLITVYA  345



>emb|CDY61108.1| BnaA06g39420D [Brassica napus]
Length=750

 Score =   343 bits (880),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/218 (79%), Positives = 194/218 (89%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+TE   + S F ++ GRL + LVLAPTRE
Sbjct  129  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLTEQAGDYSAF-RKPGRLAKFLVLAPTRE  187

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY  Q++AL+RGVDVVVGTPGR+IDLI   SLKLG
Sbjct  188  LAKQVEKEIKESAPYLSTVCVYGGVSYTIQQNALTRGVDVVVGTPGRIIDLIEGRSLKLG  247

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLARKYL+NPL I
Sbjct  248  EVEYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPTWVKKLARKYLDNPLNI  307

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI  T+TSKRTILSDLI VYA
Sbjct  308  DLVGDQDEKLAEGIKLYAISATSTSKRTILSDLITVYA  345



>gb|ABR16298.1| unknown [Picea sitchensis]
Length=802

 Score =   343 bits (879),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 199/219 (91%), Gaps = 3/219 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED-EQSKFSQRRGRLPRVLVLAPTREL  179
            L+PALEGRD+I RAKTGTGKTLAFGIPII+R+T+D +++K  ++  RLPRVLVLAPTREL
Sbjct  175  LVPALEGRDLIGRAKTGTGKTLAFGIPIIERLTKDNKENKLLRQSRRLPRVLVLAPTREL  234

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKE KESAP L+TACI GGVSYV+Q++AL+RGVDVVVGTPGR+IDL+N+ SLKL E
Sbjct  235  AKQVEKEFKESAPFLSTACIYGGVSYVSQQNALARGVDVVVGTPGRIIDLVNSKSLKLNE  294

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQ+LVLDEADQMLAVGFEEDVE+IL+ LP++RQSMLFSATMP WVKKL+RK+LNNP+TID
Sbjct  295  VQFLVLDEADQMLAVGFEEDVEIILDNLPAERQSMLFSATMPGWVKKLSRKHLNNPMTID  354

Query  540  LVGDEEEKLAEGIKLYAIPTT--ATSKRTILSDLIAVYA  650
            LVG+ EEKLAEGIKLYA+ TT  + SKR+IL DLI V+A
Sbjct  355  LVGENEEKLAEGIKLYAVATTTSSNSKRSILGDLITVFA  393



>gb|AHW45791.1| DEAD-box ATP-dependent RNA helicase 3 [Brassica rapa subsp. chinensis]
Length=751

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 171/218 (78%), Positives = 193/218 (89%), Gaps = 3/218 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITED--EQSKFSQRRGRLPRVLVLAPTRE  176
            L+PAL+GRDIIARAKTGTGKTLAFGIPIIKR+ E   + S F ++ GRL + LVLAPTRE
Sbjct  130  LVPALQGRDIIARAKTGTGKTLAFGIPIIKRLAEQAGDYSAF-RKPGRLAKFLVLAPTRE  188

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKEIKESAP+L+T C+ GGVSY  Q++AL+RGVDVVVGTPGR+IDLI   SLKLG
Sbjct  189  LAKQVEKEIKESAPYLSTVCVYGGVSYTIQQNALTRGVDVVVGTPGRIIDLIEGRSLKLG  248

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EV+YLVLDEADQMLAVGFEE VE ILE LP +RQSMLFSATMP+WVKKLAR+YL+NPL I
Sbjct  249  EVEYLVLDEADQMLAVGFEEAVESILENLPQKRQSMLFSATMPTWVKKLARRYLDNPLNI  308

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD++EKLAEGIKLYAI  T+TSKRTILSDLI VYA
Sbjct  309  DLVGDQDEKLAEGIKLYAISATSTSKRTILSDLITVYA  346



>dbj|BAJ90819.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=231

 Score =   298 bits (762),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            LIPALEGRD+IARAKTGTGKTLAFGIP+IK+I E ++ + +  RGR+PR LVLAPTRELA
Sbjct  21   LIPALEGRDLIARAKTGTGKTLAFGIPMIKQIIEQDEGR-TPGRGRIPRALVLAPTRELA  79

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKEI ESAP L+T C+ GGVSY TQ++ALSRGVDVVVGTPGRLIDLIN  SL+LGEV
Sbjct  80   KQVEKEIMESAPKLSTVCVYGGVSYNTQQNALSRGVDVVVGTPGRLIDLINGGSLQLGEV  139

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +YLVLDEADQMLAVGFEEDVE IL++LP++RQSMLFSATMPSWVKKL+R+YLNNPLTIDL
Sbjct  140  RYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPSWVKKLSRRYLNNPLTIDL  199

Query  543  V  545
            V
Sbjct  200  V  200



>gb|ABF99668.1| DEAD/DEAH box helicase family protein, expressed [Oryza sativa 
Japonica Group]
Length=596

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = +3

Query  84   IIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQVEKEIKESAPHLNTACICGGVSYVT  263
            +IK++ E++  + S RRGR+PRVLVLAPTRELAKQVEKEIKESAP L+T C+ GGVSY  
Sbjct  1    MIKQLMEEDDGR-SVRRGRIPRVLVLAPTRELAKQVEKEIKESAPKLSTVCVYGGVSYNV  59

Query  264  QESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQYLVLDEADQMLAVGFEEDVEVILEKL  443
            Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV+YLVLDEADQMLAVGFEEDVE IL++L
Sbjct  60   QQNALSRGVDVVVGTPGRIIDLINGGSLQLGEVKYLVLDEADQMLAVGFEEDVETILQQL  119

Query  444  PSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVGDEEEKLAEGIKLYAIPTTATSKRTI  623
            P++RQSMLFSATMP WVKKL+R+YLNNPLTIDLVGD++EKLAEGIKLYAIP T+TSKRT+
Sbjct  120  PAERQSMLFSATMPGWVKKLSRRYLNNPLTIDLVGDQDEKLAEGIKLYAIPLTSTSKRTV  179

Query  624  LSDLIAVYA  650
            LSDLI VYA
Sbjct  180  LSDLITVYA  188



>gb|ABF99667.1| DEAD/DEAH box helicase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG89705.1| unnamed protein product [Oryza sativa Japonica Group]
Length=597

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = +3

Query  84   IIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQVEKEIKESAPHLNTACICGGVSYVT  263
            +IK++ E++  + S RRGR+PRVLVLAPTRELAKQVEKEIKESAP L+T C+ GGVSY  
Sbjct  1    MIKQLMEEDDGR-SVRRGRIPRVLVLAPTRELAKQVEKEIKESAPKLSTVCVYGGVSYNV  59

Query  264  QESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQYLVLDEADQMLAVGFEEDVEVILEKL  443
            Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV+YLVLDEADQMLAVGFEEDVE IL++L
Sbjct  60   QQNALSRGVDVVVGTPGRIIDLINGGSLQLGEVKYLVLDEADQMLAVGFEEDVETILQQL  119

Query  444  PSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVGDEEEKLAEGIKLYAIPTTATSKRTI  623
            P++RQSMLFSATMP WVKKL+R+YLNNPLTIDLVGD++EKLAEGIKLYAIP T+TSKRT+
Sbjct  120  PAERQSMLFSATMPGWVKKLSRRYLNNPLTIDLVGDQDEKLAEGIKLYAIPLTSTSKRTV  179

Query  624  LSDLIAVYA  650
            LSDLI VYA
Sbjct  180  LSDLITVYA  188



>ref|NP_001130659.1| uncharacterized protein LOC100191761 [Zea mays]
 gb|ACF78967.1| unknown [Zea mays]
Length=598

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 169/189 (89%), Gaps = 1/189 (1%)
 Frame = +3

Query  84   IIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQVEKEIKESAPHLNTACICGGVSYVT  263
            +IK++ E +  + + RRGR PRVLVLAPTRELAKQVEKEIKESAP L T C+ GGVSY  
Sbjct  1    MIKQLIEQDDGRIT-RRGRTPRVLVLAPTRELAKQVEKEIKESAPKLGTVCVYGGVSYNV  59

Query  264  QESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQYLVLDEADQMLAVGFEEDVEVILEKL  443
            Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEVQYLVLDEADQMLAVGFEEDVE IL++L
Sbjct  60   QQNALSRGVDVVVGTPGRIIDLINGGSLQLGEVQYLVLDEADQMLAVGFEEDVETILQQL  119

Query  444  PSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVGDEEEKLAEGIKLYAIPTTATSKRTI  623
            P+ RQSMLFSATMPSWVKKL+R+YLNNPLTIDLVGD++EKLAEGIKLYAIP T TSKRT+
Sbjct  120  PAGRQSMLFSATMPSWVKKLSRRYLNNPLTIDLVGDQDEKLAEGIKLYAIPLTTTSKRTV  179

Query  624  LSDLIAVYA  650
            LSDLI VYA
Sbjct  180  LSDLITVYA  188



>ref|XP_006650834.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 3, chloroplastic-like 
[Oryza brachyantha]
Length=599

 Score =   306 bits (784),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/189 (79%), Positives = 173/189 (92%), Gaps = 1/189 (1%)
 Frame = +3

Query  84   IIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQVEKEIKESAPHLNTACICGGVSYVT  263
            +IK++ E++  + S RRGR+PRVLVLAPTRELAKQVEKEIKESAP L T C+ GGVSY  
Sbjct  1    MIKQLIEEDDGQ-SVRRGRIPRVLVLAPTRELAKQVEKEIKESAPKLGTVCVYGGVSYNV  59

Query  264  QESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQYLVLDEADQMLAVGFEEDVEVILEKL  443
            Q++ALSRGVDVVVGTPGR+IDLIN  SL+LGEV+YLVLDEADQMLAVGFEEDVE IL++L
Sbjct  60   QQNALSRGVDVVVGTPGRIIDLINGGSLQLGEVKYLVLDEADQMLAVGFEEDVETILQQL  119

Query  444  PSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVGDEEEKLAEGIKLYAIPTTATSKRTI  623
            P++RQSMLFSATMPSWVKKL+R+YLNNPLTIDLVGD++EKLAEGIKL+AIP T+TSKRT+
Sbjct  120  PAERQSMLFSATMPSWVKKLSRRYLNNPLTIDLVGDQDEKLAEGIKLHAIPLTSTSKRTV  179

Query  624  LSDLIAVYA  650
            LSDLI VYA
Sbjct  180  LSDLITVYA  188



>ref|XP_001753075.1| predicted protein [Physcomitrella patens]
 gb|EDQ82116.1| predicted protein [Physcomitrella patens]
Length=793

 Score =   309 bits (791),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRIT-EDEQSKFSQRRGRLPRVLVLAPTREL  179
            L PA++GRD+I RAKTGTGKTLAFGIPII  I  E+E+++ ++R GR PR LVLAPTREL
Sbjct  168  LEPAMQGRDLIGRAKTGTGKTLAFGIPIINNIIRENEENRVARRSGRAPRALVLAPTREL  227

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVE+E  ESAP L+T C+ GGV+  +Q+  L+RGVD+ VGTPGR+IDLIN  SL+L E
Sbjct  228  AKQVEREFMESAPMLSTICVYGGVAISSQQRLLTRGVDIAVGTPGRIIDLINRGSLRLQE  287

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V++LVLDEADQMLAVGFEEDVE ILE++P+QRQSMLFSATMP+WVKKL+RKYL++ LTID
Sbjct  288  VRFLVLDEADQMLAVGFEEDVEQILEQMPNQRQSMLFSATMPTWVKKLSRKYLHDALTID  347

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVG+ +EKLA+ IKLYA+ T   +KR+IL+DLIAVY 
Sbjct  348  LVGESDEKLADRIKLYAVATVPQAKRSILNDLIAVYG  384



>ref|XP_001773524.1| predicted protein [Physcomitrella patens]
 gb|EDQ61724.1| predicted protein, partial [Physcomitrella patens]
Length=619

 Score =   300 bits (768),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 177/216 (82%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+IARAKTGTGKTLAFGIPII+ I  D  ++ + R+GR PR LVLAPTRELA
Sbjct  35   LEPAMKGQDLIARAKTGTGKTLAFGIPIIRHIV-DGNAENAPRQGRSPRALVLAPTRELA  93

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVE+E  ESAP L+T C+ GGV    Q+  L RGVD+ VGTPGR+IDLI+  SLKL +V
Sbjct  94   KQVEREFMESAPMLSTVCVYGGVPISMQQRQLERGVDIAVGTPGRIIDLIDRGSLKLKDV  153

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
             +LVLDEADQMLAVGFEEDVE IL++LP QRQSMLFSATMP WVK+L+RKYLN PLTIDL
Sbjct  154  HFLVLDEADQMLAVGFEEDVERILQQLPKQRQSMLFSATMPKWVKELSRKYLNKPLTIDL  213

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD +EKLA+GIK  AI   A++KR+ILSDLI V+ 
Sbjct  214  VGDSDEKLADGIKNLAIQLPASAKRSILSDLITVHG  249



>ref|XP_001753085.1| predicted protein [Physcomitrella patens]
 gb|EDQ82126.1| predicted protein, partial [Physcomitrella patens]
Length=638

 Score =   291 bits (745),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+IARAKTGTGKTLAFGIPII+ I  D   + + R GR PR LVLAPTRELA
Sbjct  57   LEPAMKGQDLIARAKTGTGKTLAFGIPIIQHII-DAHKESAPRHGRSPRALVLAPTRELA  115

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVE+E  ESAP L+T C+ GGVS   Q+  L RGVD+ VGTPGR+IDLI+  SLKL  V
Sbjct  116  KQVEREFMESAPMLSTVCVYGGVSISMQQRQLERGVDIAVGTPGRIIDLIDRGSLKLQNV  175

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
             +LVLDEADQMLAVGFEEDVE IL++LP  RQSMLFSATMP WVK+L+ KYLN PL I+L
Sbjct  176  NFLVLDEADQMLAVGFEEDVERILQQLPKNRQSMLFSATMPKWVKELSGKYLNRPLMINL  235

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLAEGI   AI   AT+KR+ILSDLI V+A
Sbjct  236  VGDADDKLAEGITNLAIQLPATAKRSILSDLITVHA  271



>ref|XP_001762375.1| predicted protein [Physcomitrella patens]
 gb|EDQ72842.1| predicted protein [Physcomitrella patens]
Length=689

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 175/217 (81%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITE-DEQSKFSQRRGRLPRVLVLAPTREL  179
            L PA++GRD+I RAKTGTGKTLAFGIPII  I +  E  + S+R GR PR LVLAPTREL
Sbjct  78   LDPAMQGRDLIGRAKTGTGKTLAFGIPIIHNILKAHEADRTSRRSGRAPRALVLAPTREL  137

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVE+E  ESAP L+T C+ GGVS  TQ+  L RGVDV VGTPGR+IDLI   SL L +
Sbjct  138  AKQVEREFMESAPMLSTVCVYGGVSITTQQRQLQRGVDVAVGTPGRIIDLIERRSLSLRD  197

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V YLVLDEADQMLAVGFEEDVE ILE++P +RQSMLFSATMP+WVKKL++KYL +PLTID
Sbjct  198  VSYLVLDEADQMLAVGFEEDVERILEQMPEERQSMLFSATMPNWVKKLSKKYLKSPLTID  257

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD  EKLAEGIK+ A+     +KRT+L+DLI+V+ 
Sbjct  258  LVGDSNEKLAEGIKMLAVCIPPAAKRTVLNDLISVHG  294



>gb|AIE38016.1| DEAD-box RNA helicase 1 [Equisetum arvense]
Length=770

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 171/217 (79%), Gaps = 1/217 (0%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKR-ITEDEQSKFSQRRGRLPRVLVLAPTREL  179
            L PA++G+D+I RAKTGTGKTLAFGIPII   I E++ S+  +  G+ P  LVLAPTREL
Sbjct  60   LEPAMKGQDLIGRAKTGTGKTLAFGIPIINHVIKENKGSRGMRPYGKRPLALVLAPTREL  119

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            AKQVEKE KESAP L T C+ GG S + Q+  L RGVD+ VGTPGR+IDL+   SL LGE
Sbjct  120  AKQVEKEFKESAPSLMTVCVYGGTSIIMQQQQLQRGVDIAVGTPGRVIDLLERGSLNLGE  179

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            V+++VLDEADQML VGF EDVE I   LP+ RQSMLFSATMP WVK ++RKYL NP  +D
Sbjct  180  VKFVVLDEADQMLRVGFAEDVEKIAGYLPAVRQSMLFSATMPDWVKNISRKYLKNPTIVD  239

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVG+ +EKLAEGIKL++IPT  ++KR++LSDLIAVY 
Sbjct  240  LVGENDEKLAEGIKLFSIPTVNSAKRSVLSDLIAVYG  276



>gb|KDO64254.1| hypothetical protein CISIN_1g007084mg [Citrus sinensis]
Length=475

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 166/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+++  RGR P  LVLAPTRE
Sbjct  130  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNEKHGRGRNPLCLVLAPTRE  184

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKE  ESAP L+T C+ GG     Q  AL  GVD VVGTPGR+IDLI  N+L L 
Sbjct  185  LAKQVEKEFHESAPSLDTICVYGGTPISHQMRALDYGVDAVVGTPGRVIDLIKRNALNLS  244

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML+VGF EDVEVILE+LP  RQSM+FSATMP W++ L  KYL NPLT+
Sbjct  245  EVQFVVLDEADQMLSVGFAEDVEVILERLPQNRQSMMFSATMPPWIRSLTNKYLKNPLTV  304

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I T+   K +I+  LI  +A
Sbjct  305  DLVGDSDQKLADGISLYSIATSMYEKPSIIGQLITEHA  342



>gb|KDO64255.1| hypothetical protein CISIN_1g007084mg [Citrus sinensis]
Length=475

 Score =   277 bits (709),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 166/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+++  RGR P  LVLAPTRE
Sbjct  130  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNEKHGRGRNPLCLVLAPTRE  184

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKE  ESAP L+T C+ GG     Q  AL  GVD VVGTPGR+IDLI  N+L L 
Sbjct  185  LAKQVEKEFHESAPSLDTICVYGGTPISHQMRALDYGVDAVVGTPGRVIDLIKRNALNLS  244

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML+VGF EDVEVILE+LP  RQSM+FSATMP W++ L  KYL NPLT+
Sbjct  245  EVQFVVLDEADQMLSVGFAEDVEVILERLPQNRQSMMFSATMPPWIRSLTNKYLKNPLTV  304

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I T+   K +I+  LI  +A
Sbjct  305  DLVGDSDQKLADGISLYSIATSMYEKPSIIGQLITEHA  342



>emb|CBI31778.3| unnamed protein product [Vitis vinifera]
Length=568

 Score =   280 bits (716),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 167/216 (77%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ ++    Q      RGR P  LVLAPTRELA
Sbjct  146  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKVI---QYNAKHGRGRNPLALVLAPTRELA  202

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  ESAP+L+T C+ GG     Q ++L  GVDVVVGTPGR+IDLI   +L L EV
Sbjct  203  RQVEKEFCESAPNLDTLCVYGGTPISRQMNSLDYGVDVVVGTPGRIIDLIKRGALNLSEV  262

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGFEEDVE+ILEKLP  RQSM+FSATMPSW++KL +KYL NPLTIDL
Sbjct  263  QFVVLDEADQMLAVGFEEDVEMILEKLPQNRQSMMFSATMPSWIRKLTQKYLKNPLTIDL  322

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLAEGI LY+I +    K +I+  LI  +A
Sbjct  323  VGDSDQKLAEGISLYSIASEMYEKASIVGPLITEHA  358



>emb|CAN60235.1| hypothetical protein VITISV_028850 [Vitis vinifera]
Length=666

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 167/216 (77%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ ++    Q      RGR P  LVLAPTRELA
Sbjct  146  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKVI---QYNAKHGRGRNPLALVLAPTRELA  202

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  ESAP+L+T C+ GG     Q ++L  GVDVVVGTPGR+IDLI   +L L EV
Sbjct  203  RQVEKEFXESAPNLDTLCVYGGTPISRQMNSLDYGVDVVVGTPGRIIDLIKRGALNLSEV  262

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGFEEDVE+ILEKLP  RQSM+FSATMPSW++KL +KYL NPLTIDL
Sbjct  263  QFVVLDEADQMLAVGFEEDVEMILEKLPQNRQSMMFSATMPSWIRKLTQKYLKNPLTIDL  322

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLAEGI LY+I +    K +I+  LI  +A
Sbjct  323  VGDSDQKLAEGISLYSIASEMYEKASIVGPLITEHA  358



>gb|KDO64256.1| hypothetical protein CISIN_1g007084mg [Citrus sinensis]
Length=384

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 159/205 (78%), Gaps = 7/205 (3%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRELA  182
            PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+++  RGR P  LVLAPTRELA
Sbjct  132  PAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNEKHGRGRNPLCLVLAPTRELA  186

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ESAP L+T C+ GG     Q  AL  GVD VVGTPGR+IDLI  N+L L EV
Sbjct  187  KQVEKEFHESAPSLDTICVYGGTPISHQMRALDYGVDAVVGTPGRVIDLIKRNALNLSEV  246

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML+VGF EDVEVILE+LP  RQSM+FSATMP W++ L  KYL NPLT+DL
Sbjct  247  QFVVLDEADQMLSVGFAEDVEVILERLPQNRQSMMFSATMPPWIRSLTNKYLKNPLTVDL  306

Query  543  VGDEEEKLAEGIKLYAIPTTATSKR  617
            VGD ++KLA+GI LY+I T+   ++
Sbjct  307  VGDSDQKLADGISLYSIATSMNMQK  331



>ref|XP_002284103.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Vitis 
vinifera]
Length=666

 Score =   280 bits (715),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 167/216 (77%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ ++    Q      RGR P  LVLAPTRELA
Sbjct  146  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKVI---QYNAKHGRGRNPLALVLAPTRELA  202

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  ESAP+L+T C+ GG     Q ++L  GVDVVVGTPGR+IDLI   +L L EV
Sbjct  203  RQVEKEFCESAPNLDTLCVYGGTPISRQMNSLDYGVDVVVGTPGRIIDLIKRGALNLSEV  262

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGFEEDVE+ILEKLP  RQSM+FSATMPSW++KL +KYL NPLTIDL
Sbjct  263  QFVVLDEADQMLAVGFEEDVEMILEKLPQNRQSMMFSATMPSWIRKLTQKYLKNPLTIDL  322

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLAEGI LY+I +    K +I+  LI  +A
Sbjct  323  VGDSDQKLAEGISLYSIASEMYEKASIVGPLITEHA  358



>ref|XP_010258650.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Nelumbo 
nucifera]
Length=639

 Score =   278 bits (710),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 168/216 (78%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L P+++GRD+I RA+TGTGKTLAFGIPI+ RI    Q      RGR P  LVLAPTRELA
Sbjct  145  LEPSMQGRDLIGRARTGTGKTLAFGIPIMDRII---QFNAKHGRGRNPLALVLAPTRELA  201

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  ESAP+L+T C+ GGV    Q + L  GVDVVVGTPGR+IDL+   +L L EV
Sbjct  202  RQVEKEFHESAPNLDTICVYGGVPISRQMNTLDYGVDVVVGTPGRIIDLLKRGALVLSEV  261

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGF+EDVEVIL+KLP +RQSM+FSATMPSW++KL +KYL +PLTIDL
Sbjct  262  QFVVLDEADQMLAVGFDEDVEVILDKLPQKRQSMMFSATMPSWIRKLTQKYLKDPLTIDL  321

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I +    K +I+  LI  +A
Sbjct  322  VGDSDQKLADGISLYSIASDMYGKASIIGSLITEHA  357



>gb|KDO64251.1| hypothetical protein CISIN_1g007084mg [Citrus sinensis]
 gb|KDO64252.1| hypothetical protein CISIN_1g007084mg [Citrus sinensis]
 gb|KDO64253.1| hypothetical protein CISIN_1g007084mg [Citrus sinensis]
Length=618

 Score =   277 bits (708),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/218 (63%), Positives = 166/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+++  RGR P  LVLAPTRE
Sbjct  130  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNEKHGRGRNPLCLVLAPTRE  184

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKE  ESAP L+T C+ GG     Q  AL  GVD VVGTPGR+IDLI  N+L L 
Sbjct  185  LAKQVEKEFHESAPSLDTICVYGGTPISHQMRALDYGVDAVVGTPGRVIDLIKRNALNLS  244

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML+VGF EDVEVILE+LP  RQSM+FSATMP W++ L  KYL NPLT+
Sbjct  245  EVQFVVLDEADQMLSVGFAEDVEVILERLPQNRQSMMFSATMPPWIRSLTNKYLKNPLTV  304

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I T+   K +I+  LI  +A
Sbjct  305  DLVGDSDQKLADGISLYSIATSMYEKPSIIGQLITEHA  342



>ref|XP_006429692.1| hypothetical protein CICLE_v10013510mg [Citrus clementina]
 ref|XP_006481292.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481293.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Citrus sinensis]
 gb|ESR42932.1| hypothetical protein CICLE_v10013510mg [Citrus clementina]
Length=618

 Score =   275 bits (703),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 165/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+++  RGR P  LVLAPTRE
Sbjct  130  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNEKHGRGRNPLCLVLAPTRE  184

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKE  ESAP L+T C+ GG     Q  AL  GVD VVGTPGR+IDLI  N+L L 
Sbjct  185  LAKQVEKEFHESAPSLDTICVYGGTPISHQMRALDYGVDAVVGTPGRVIDLIKRNALNLS  244

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML+VGF EDVEVILE+LP  RQ M+FSATMP W++ L  KYL NPLT+
Sbjct  245  EVQFVVLDEADQMLSVGFAEDVEVILERLPQNRQGMMFSATMPPWIRSLTNKYLKNPLTV  304

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I T+   K +I+  LI  +A
Sbjct  305  DLVGDSDQKLADGISLYSIATSMYEKPSIIGQLITEHA  342



>ref|XP_002990210.1| hypothetical protein SELMODRAFT_30996, partial [Selaginella moellendorffii]
 gb|EFJ08770.1| hypothetical protein SELMODRAFT_30996, partial [Selaginella moellendorffii]
Length=640

 Score =   275 bits (704),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 165/214 (77%), Gaps = 1/214 (0%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PA++G D+IARAKTGTGKTLAFGIPI+ RI         +     P  LVLAPTRELAKQ
Sbjct  36   PAMKGVDLIARAKTGTGKTLAFGIPIMDRIYRSRSKSQRRSFRG-PAALVLAPTRELAKQ  94

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VE E  ES   L T C+ GGVS ++Q+  LSRGVDV VGTPGR+IDL+    L L +V+ 
Sbjct  95   VETEFMESGKELATVCVYGGVSIMSQKRLLSRGVDVAVGTPGRIIDLLEQGCLDLSQVEC  154

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            +VLDEADQMLAVGFEEDVE I+E+LP +RQ+MLFSATMP WV+KL+RK+LN PLTIDLVG
Sbjct  155  MVLDEADQMLAVGFEEDVEKIMEQLPEKRQNMLFSATMPGWVQKLSRKFLNKPLTIDLVG  214

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            + +EKLAEGIKLYA+ T+  +KR ILSD+I VY 
Sbjct  215  ESDEKLAEGIKLYAVQTSQAAKRKILSDVITVYG  248



>ref|XP_002992481.1| hypothetical protein SELMODRAFT_30997, partial [Selaginella moellendorffii]
 gb|EFJ06419.1| hypothetical protein SELMODRAFT_30997, partial [Selaginella moellendorffii]
Length=641

 Score =   275 bits (704),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 165/214 (77%), Gaps = 1/214 (0%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PA++G D+IARAKTGTGKTLAFGIPI+ RI         +     P  LVLAPTRELAKQ
Sbjct  54   PAMKGVDLIARAKTGTGKTLAFGIPIMDRIYRSRSKSQRRSFRG-PAALVLAPTRELAKQ  112

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VE E  ES   L T C+ GGVS ++Q+  LSRGVDV VGTPGR+IDL+    L L +V+ 
Sbjct  113  VETEFMESGKELATVCVYGGVSIMSQKRLLSRGVDVAVGTPGRIIDLLEQGCLDLSQVEC  172

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            +VLDEADQMLAVGFEEDVE I+E+LP +RQ+MLFSATMP WV+KL+RK+LN PLTIDLVG
Sbjct  173  MVLDEADQMLAVGFEEDVEKIMEQLPEKRQNMLFSATMPGWVQKLSRKFLNKPLTIDLVG  232

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            + +EKLAEGIKLYA+ T+  +KR ILSD+I VY 
Sbjct  233  ESDEKLAEGIKLYAVQTSQAAKRKILSDVITVYG  266



>ref|XP_006836382.1| hypothetical protein AMTR_s00092p00127820 [Amborella trichopoda]
 gb|ERM99235.1| hypothetical protein AMTR_s00092p00127820 [Amborella trichopoda]
Length=622

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 166/214 (78%), Gaps = 3/214 (1%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PA++GRD+I RA+TGTGKTLAFG+PI+ +I    Q      RGR P  LVLAPTRELA+Q
Sbjct  139  PAMQGRDMIGRARTGTGKTLAFGMPIMDKII---QFNAKHGRGRNPLALVLAPTRELARQ  195

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VEKE KESAP L+T C+ GGV   +Q + L  GVDVVVGTPGR+IDL+   +L L EVQ+
Sbjct  196  VEKEFKESAPVLDTICVYGGVPISSQMNTLDYGVDVVVGTPGRIIDLLKRGALNLSEVQF  255

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            +VLDEADQMLAVGFEE VE+IL+KLP +RQSM+FSATMPSW++ L +KYL  PLT+DLVG
Sbjct  256  VVLDEADQMLAVGFEEAVEIILDKLPPKRQSMMFSATMPSWIRTLTQKYLKAPLTVDLVG  315

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            D E+KLAEGIKLY+I +    K +IL  LI  +A
Sbjct  316  DSEQKLAEGIKLYSILSDIYGKASILGPLITEHA  349



>emb|CDY37406.1| BnaC05g30240D [Brassica napus]
Length=510

 Score =   270 bits (690),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 166/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIP+I +I      KF+ +  RG+ P  LVLAPTRE
Sbjct  145  LEPAMQGRDMIGRARTGTGKTLAFGIPVIDKII-----KFNAKHGRGKNPLCLVLAPTRE  199

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ GVDV VGTPGR+IDL+   +L L 
Sbjct  200  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGVDVAVGTPGRIIDLMKRGALNLS  259

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVEVIL+KLP +RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  260  EVQFIVLDEADQMLQVGFAEDVEVILQKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTI  319

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI +Y+I   +  K +I+  L+  + 
Sbjct  320  DLVGDSDQKLADGITMYSISADSYGKASIIGPLVEAHG  357



>ref|XP_010466510.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like [Camelina 
sativa]
Length=605

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA+EGRD+I RA+TGTGKTLAFGIPII +I      KF+ +  RG+ P+ LVLAPTRE
Sbjct  149  LEPAMEGRDMIGRARTGTGKTLAFGIPIIDKII-----KFNAKHGRGKNPQCLVLAPTRE  203

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ G+DV VGTPGR+IDL+   +L L 
Sbjct  204  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGIDVAVGTPGRIIDLMKRGALNLS  263

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE+IL+KLP++RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  264  EVQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFSATMPSWIRSLTKKYLNNPLTI  323

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLI  638
            DLVGD ++KLA+GI +Y+I   +  + +I+  L+
Sbjct  324  DLVGDSDQKLADGITMYSIAADSYGRASIIGPLV  357



>ref|XP_002973699.1| hypothetical protein SELMODRAFT_99603, partial [Selaginella moellendorffii]
 ref|XP_002975750.1| hypothetical protein SELMODRAFT_103888, partial [Selaginella 
moellendorffii]
 gb|EFJ23379.1| hypothetical protein SELMODRAFT_103888, partial [Selaginella 
moellendorffii]
 gb|EFJ25359.1| hypothetical protein SELMODRAFT_99603, partial [Selaginella moellendorffii]
Length=445

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 163/214 (76%), Gaps = 0/214 (0%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PA++GRD IARAKTGTGKTLAFG+PI+  IT + +   S+ +   PR +V+APTRELAKQ
Sbjct  38   PAMKGRDFIARAKTGTGKTLAFGLPILHTITVERREATSRTQPGCPRCIVMAPTRELAKQ  97

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VEKE+  +APHL   CI GGVS  +Q  +L R +DVVVGTPGR+ID++   SL L  V++
Sbjct  98   VEKELTSTAPHLTLVCIYGGVSIESQRRSLERPIDVVVGTPGRVIDMLQRGSLLLNRVKF  157

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            +VLDEADQMLA GF EDVE I+E+LP QRQ+M+FSATMPSWVK L R+++ +PL +DLVG
Sbjct  158  MVLDEADQMLATGFAEDVEKIMERLPKQRQTMMFSATMPSWVKNLLRRFMQDPLVVDLVG  217

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            D +EKLAEGIKLY+   +  +K  +L +L+  Y 
Sbjct  218  DNDEKLAEGIKLYSCEASDYNKGPLLKELVNSYG  251



>ref|XP_006382235.1| hypothetical protein POPTR_0005s00210g [Populus trichocarpa]
 gb|ERP60032.1| hypothetical protein POPTR_0005s00210g [Populus trichocarpa]
Length=377

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 150/186 (81%), Gaps = 5/186 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKF-----SQRRGRLPRVLVLAP  167
            L+PALEGRDIIAR K  TGK LAFGIPIIKR+TE   S+          GRLPRVLVL P
Sbjct  104  LVPALEGRDIIARVKNRTGKALAFGIPIIKRLTEQTSSQILIMPHIMPNGRLPRVLVLTP  163

Query  168  TRELAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSL  347
            TR LAKQVEKE+K SAP+LNT C  GGVSY+ Q++ALSRGVD+VVGTPGR I+L+  NSL
Sbjct  164  TRVLAKQVEKEMKRSAPYLNTVCAYGGVSYIIQQNALSRGVDIVVGTPGRTIELLKGNSL  223

Query  348  KLGEVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNP  527
            KLGEV+YLVLDEADQML+ GFEEDVE+I   LPS+ QSM FSAT+ SWVKKLARKYL++ 
Sbjct  224  KLGEVEYLVLDEADQMLSFGFEEDVEIIFGNLPSKHQSMFFSATLTSWVKKLARKYLDSL  283

Query  528  LTIDLV  545
            L IDLV
Sbjct  284  LQIDLV  289



>ref|NP_188870.1| DEAD-box ATP-dependent RNA helicase [Arabidopsis thaliana]
 sp|Q9LUW6.1|RH9_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 9 [Arabidopsis 
thaliana]
 dbj|BAB01768.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAM14042.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AEE76620.1| DEAD-box ATP-dependent RNA helicase [Arabidopsis thaliana]
Length=610

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA+EGRD+I RA+TGTGKTLAFGIPII +I      KF+ +  RG+ P+ LVLAPTRE
Sbjct  147  LEPAMEGRDMIGRARTGTGKTLAFGIPIIDKII-----KFNAKHGRGKNPQCLVLAPTRE  201

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ G+DV VGTPGR+IDL+   +L L 
Sbjct  202  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGIDVAVGTPGRIIDLMKRGALNLS  261

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE+IL+KLP++RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  262  EVQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFSATMPSWIRSLTKKYLNNPLTI  321

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLI  638
            DLVGD ++KLA+GI +Y+I   +  + +I+  L+
Sbjct  322  DLVGDSDQKLADGITMYSIAADSYGRASIIGPLV  355



>ref|XP_004149532.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Cucumis 
sativus]
Length=593

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ ++    Q      RGR P  LVLAPTRELA
Sbjct  138  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKLI---QFNAKNGRGRNPLALVLAPTRELA  194

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +E+AP L+T C+ GG     Q   L  GVD+ VGTPGRLIDL+N  SL L EV
Sbjct  195  RQVEKEFQEAAPSLDTICVYGGAPISQQMRQLDYGVDIAVGTPGRLIDLLNRGSLNLSEV  254

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+EDVE ILE+LP +RQSM+FSATMPSW+ KL+R YLNNPLTIDL
Sbjct  255  QFVVLDEADQMLQVGFQEDVEKILERLPQKRQSMMFSATMPSWILKLSRNYLNNPLTIDL  314

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI L+++ +    K +I+  LI  + 
Sbjct  315  VGDSDQKLADGISLFSVVSETYGKASIIGPLITEHG  350



>gb|KJB75399.1| hypothetical protein B456_012G039900 [Gossypium raimondii]
Length=467

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RAKTGTGKTLAFGIPI+ +I    +      RGR P  LVLAPTRELA
Sbjct  128  LEPAMQGRDMIGRAKTGTGKTLAFGIPIMDKII---RYNAKHGRGRNPMCLVLAPTRELA  184

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ESAP+L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  185  KQVEKEFHESAPNLDTICVYGGTPISRQMRQLDYGVDVAVGTPGRIIDLLKRGALNLSEV  244

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q+LVLDEADQML VGF EDVE ILE+LP+ RQSM+FSATMP+W++ L +K+L NPLTIDL
Sbjct  245  QFLVLDEADQMLQVGFAEDVETILERLPANRQSMMFSATMPNWIRSLTQKHLKNPLTIDL  304

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG+ ++KLAEGI LY+I      K  IL  LI  +A
Sbjct  305  VGENDQKLAEGISLYSIAADMRGKAGILGPLITEHA  340



>ref|XP_009145390.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9 [Brassica rapa]
Length=602

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 166/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIP+I +I      KF+ +  RG+ P  LVLAPTRE
Sbjct  146  LEPAMQGRDMIGRARTGTGKTLAFGIPVIDKII-----KFNAKHGRGKNPLCLVLAPTRE  200

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ GVDV VGTPGR+IDL+   +L L 
Sbjct  201  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGVDVAVGTPGRIIDLMKRGALNLS  260

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVEVIL+KLP +RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  261  EVQFIVLDEADQMLQVGFAEDVEVILQKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTI  320

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI +Y+I   +  K +I+  L+  + 
Sbjct  321  DLVGDSDQKLADGITMYSISADSYGKASIIGPLVEAHG  358



>ref|XP_010036054.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Eucalyptus 
grandis]
 gb|KCW47578.1| hypothetical protein EUGRSUZ_K01327 [Eucalyptus grandis]
Length=624

 Score =   271 bits (692),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 165/216 (76%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+IARAKTGTGKTLAFGIP++ +I    Q      RGR P  ++LAPTRELA
Sbjct  149  LEPAMQGRDMIARAKTGTGKTLAFGIPVMDKII---QFNAKHGRGRNPLAIILAPTRELA  205

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L+T C+ GG    +Q   L  GVDVVVGTPGR+IDL+   +L L EV
Sbjct  206  RQVEKEFAETAPNLDTICVYGGTPIGSQMRQLDYGVDVVVGTPGRVIDLLKRGALNLSEV  265

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGFEEDVE IL+KLP  RQSM+FSATMP+W++ L +KYL +PLTIDL
Sbjct  266  QFVVLDEADQMLAVGFEEDVETILQKLPQNRQSMMFSATMPNWIRSLTKKYLKDPLTIDL  325

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLAEGI LY+I +    K +I+  LI  +A
Sbjct  326  VGDSDQKLAEGISLYSIASDMYGKASIIGPLITEHA  361



>gb|KFK39521.1| hypothetical protein AALP_AA3G255300 [Arabis alpina]
Length=606

 Score =   270 bits (691),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 167/218 (77%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPII +I      KF+ +  RG+ P+ LVLAPTRE
Sbjct  150  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII-----KFNAKHGRGKNPQCLVLAPTRE  204

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ GVDV VGTPGR+IDL+   +L L 
Sbjct  205  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGVDVAVGTPGRIIDLMKRGALNLS  264

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVEVIL+KLP +RQSM+FSATMPSW+K L +KYLNNPLTI
Sbjct  265  EVQFVVLDEADQMLQVGFAEDVEVILQKLPEKRQSMMFSATMPSWIKSLTKKYLNNPLTI  324

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI +++I   +  + +I+  L+  + 
Sbjct  325  DLVGDSDQKLADGITMFSIAADSYGRASIIGPLVTEHG  362



>emb|CDY10634.1| BnaA05g17280D [Brassica napus]
Length=602

 Score =   270 bits (690),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 166/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIP+I +I      KF+ +  RG+ P  LVLAPTRE
Sbjct  146  LEPAMQGRDMIGRARTGTGKTLAFGIPVIDKII-----KFNAKHGRGKNPLCLVLAPTRE  200

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ GVDV VGTPGR+IDL+   +L L 
Sbjct  201  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGVDVAVGTPGRIIDLMKRGALNLS  260

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVEVIL+KLP +RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  261  EVQFIVLDEADQMLQVGFAEDVEVILQKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTI  320

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI +Y+I   +  K +I+  L+  + 
Sbjct  321  DLVGDSDQKLADGITMYSISADSYGKASIIGPLVEAHG  358



>ref|XP_010511242.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9 [Camelina sativa]
Length=591

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 167/214 (78%), Gaps = 7/214 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIP+I +I      KF+ +  RG+ P+ LVLAPTRE
Sbjct  149  LEPAMQGRDMIGRARTGTGKTLAFGIPVIDKII-----KFNAKHGRGKNPQCLVLAPTRE  203

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ G+DV VGTPGR+IDL+   +L L 
Sbjct  204  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGIDVAVGTPGRIIDLMKRGALNLS  263

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE+IL+KLP++RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  264  EVQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFSATMPSWIRSLTKKYLNNPLTI  323

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLI  638
            DLVGD ++KLA+GI +Y+I   +  + +I+  L+
Sbjct  324  DLVGDSDQKLADGITMYSIAADSYGRASIIGPLV  357



>emb|CDY37408.1| BnaC05g30220D [Brassica napus]
Length=601

 Score =   270 bits (689),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 166/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIP+I +I      KF+ +  RG+ P  LVLAPTRE
Sbjct  145  LEPAMQGRDMIGRARTGTGKTLAFGIPVIDKII-----KFNAKHGRGKNPLCLVLAPTRE  199

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ GVDV VGTPGR+IDL+   +L L 
Sbjct  200  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGVDVAVGTPGRIIDLMKRGALNLS  259

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVEVIL+KLP +RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  260  EVQFIVLDEADQMLQVGFAEDVEVILQKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTI  319

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI +Y+I   +  K +I+  L+  + 
Sbjct  320  DLVGDSDQKLADGITMYSISADSYGKASIIGPLVEAHG  357



>gb|KHN38369.1| DEAD-box ATP-dependent RNA helicase 53 [Glycine soja]
Length=486

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 164/216 (76%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ ++    Q      RGR P  LVLAPTRELA
Sbjct  14   LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKVI---QFNAKHGRGRDPLALVLAPTRELA  70

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVE E  ESAP+L+T C+ GG     Q   L  GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  71   RQVESEFCESAPNLDTICVYGGTPISQQMRQLDYGVDIAVGTPGRIIDLLNRGALNLKDV  130

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+EDVE ILE+LP +RQ+++FSATMPSW+K+++R YLNNPLTIDL
Sbjct  131  QFVVLDEADQMLQVGFQEDVEKILERLPPKRQTLMFSATMPSWIKQISRNYLNNPLTIDL  190

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I T    K  IL+ LI  +A
Sbjct  191  VGDSDQKLADGISLYSIATDLYVKAGILAPLITEHA  226



>gb|KGN54960.1| hypothetical protein Csa_4G616790 [Cucumis sativus]
Length=640

 Score =   271 bits (692),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ ++    Q      RGR P  LVLAPTRELA
Sbjct  138  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKLI---QFNAKNGRGRNPLALVLAPTRELA  194

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +E+AP L+T C+ GG     Q   L  GVD+ VGTPGRLIDL+N  SL L EV
Sbjct  195  RQVEKEFQEAAPSLDTICVYGGAPISQQMRQLDYGVDIAVGTPGRLIDLLNRGSLNLSEV  254

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+EDVE ILE+LP +RQSM+FSATMPSW+ KL+R YLNNPLTIDL
Sbjct  255  QFVVLDEADQMLQVGFQEDVEKILERLPQKRQSMMFSATMPSWILKLSRNYLNNPLTIDL  314

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI L+++ +    K +I+  LI  + 
Sbjct  315  VGDSDQKLADGISLFSVVSETYGKASIIGPLITEHG  350



>ref|XP_010916633.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Elaeis 
guineensis]
Length=604

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 166/216 (77%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA+EGRD++ RA TG+GKTLAFGIPI+  I   +      RR ++P  L+LAPTRELA
Sbjct  101  LEPAMEGRDMVGRAITGSGKTLAFGIPILDNIIRHQSQ---HRRNQVPSALILAPTRELA  157

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QV++E K SAP L++ C+ GG+  + Q  +L  G+DVVVGTPGR+IDL+   +L L EV
Sbjct  158  RQVQREFKASAPSLSSTCLYGGIPIMNQVRSLRFGMDVVVGTPGRIIDLVQRGALDLSEV  217

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQMLA+GF+EDVE IL  LP+++Q MLFSATMPSWV  L+RKYLN+PL IDL
Sbjct  218  KFVVLDEADQMLAIGFQEDVECILSYLPARKQCMLFSATMPSWVNVLSRKYLNDPLVIDL  277

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLAEGI LY+I TTA +K  +L  LI+ YA
Sbjct  278  VGDSDQKLAEGISLYSIATTAPNKHNLLPTLISRYA  313



>ref|XP_004162573.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Cucumis 
sativus]
Length=611

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ ++    Q      RGR P  LVLAPTRELA
Sbjct  138  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKLI---QFNAKNGRGRNPLALVLAPTRELA  194

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +E+AP L+T C+ GG     Q   L  GVD+ VGTPGRLIDL+N  SL L EV
Sbjct  195  RQVEKEFQEAAPSLDTICVYGGAPISQQMRQLDYGVDIAVGTPGRLIDLLNRGSLNLSEV  254

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+EDVE ILE+LP +RQSM+FSATMPSW+ KL+R YLNNPLTIDL
Sbjct  255  QFVVLDEADQMLQVGFQEDVEKILERLPQKRQSMMFSATMPSWILKLSRNYLNNPLTIDL  314

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI L+++ +    K +I+  LI  + 
Sbjct  315  VGDSDQKLADGISLFSVVSETYGKASIIGPLITEHG  350



>ref|XP_010488255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X2 [Camelina sativa]
Length=594

 Score =   269 bits (688),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 168/218 (77%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIP+I +I      KF+ +  RG+ P+ LVLAPTRE
Sbjct  150  LEPAMQGRDMIGRARTGTGKTLAFGIPVIDKII-----KFNAKHGRGKNPQCLVLAPTRE  204

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ G+DV VGTPGR+IDL+   +L L 
Sbjct  205  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGIDVAVGTPGRIIDLMKRGALNLS  264

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE+IL+KLP++RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  265  EVQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFSATMPSWIRSLTKKYLNNPLTI  324

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI +Y+I   +  + +I+  L+  + 
Sbjct  325  DLVGDSDQKLADGITMYSIAADSYGRASIIGPLVTEHG  362



>emb|CDY46329.1| BnaC01g31630D [Brassica napus]
Length=549

 Score =   268 bits (685),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 165/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPII +I      KF+ +  RGR P  LVLAPTRE
Sbjct  135  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII-----KFNAKHGRGRNPLCLVLAPTRE  189

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDLI   +L L 
Sbjct  190  LARQVEKEFRESAPSLDTICVYGGTPIGQQMRQLDYGVDVAVGTPGRIIDLIKRGALNLS  249

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE+ILE+LP +RQSM+FSATMPSW++ L +KYLN+PLTI
Sbjct  250  EVQFVVLDEADQMLQVGFAEDVEIILERLPEKRQSMMFSATMPSWIRSLTKKYLNDPLTI  309

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  310  DLVGDSDQKLADGITTYSIMADSYGRASIIGPLVTEHA  347



>ref|XP_002883355.1| hypothetical protein ARALYDRAFT_479746 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59614.1| hypothetical protein ARALYDRAFT_479746 [Arabidopsis lyrata subsp. 
lyrata]
Length=612

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA+EGRD+I RA+TGTGKTLAFGIPII +I    +      RGR P  LVLAPTRELA
Sbjct  132  LEPAMEGRDMIGRARTGTGKTLAFGIPIIDKII---KYNAKHGRGRNPLCLVLAPTRELA  188

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  189  RQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSEV  248

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF EDVE+ILEKLP +RQSM+FSATMPSW++ L +KYLNNPLTIDL
Sbjct  249  QFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTIDL  308

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  309  VGDSDQKLADGITTYSILADSYGRASIIGPLVTEHA  344



>ref|XP_010488254.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X1 [Camelina sativa]
Length=606

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 168/218 (77%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIP+I +I      KF+ +  RG+ P+ LVLAPTRE
Sbjct  150  LEPAMQGRDMIGRARTGTGKTLAFGIPVIDKII-----KFNAKHGRGKNPQCLVLAPTRE  204

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ G+DV VGTPGR+IDL+   +L L 
Sbjct  205  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGIDVAVGTPGRIIDLMKRGALNLS  264

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE+IL+KLP++RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  265  EVQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFSATMPSWIRSLTKKYLNNPLTI  324

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI +Y+I   +  + +I+  L+  + 
Sbjct  325  DLVGDSDQKLADGITMYSIAADSYGRASIIGPLVTEHG  362



>ref|XP_008464653.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 [Cucumis melo]
 ref|XP_008464654.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 [Cucumis melo]
Length=624

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I    Q      RGR P  LVLAPTRELA
Sbjct  138  LEPAIQGRDMIGRARTGTGKTLAFGIPILDKII---QFNAKNGRGRNPLALVLAPTRELA  194

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +E+AP L+T C+ GG     Q   L  GVD+ VGTPGRLIDL+N  SL L EV
Sbjct  195  RQVEKEFQEAAPSLDTICVYGGAPISQQMRQLDYGVDIAVGTPGRLIDLLNRGSLNLSEV  254

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+EDVE ILE+LP +RQSM+FSATMPSW+ KL+R YL NPLTIDL
Sbjct  255  QFIVLDEADQMLQVGFQEDVEKILERLPQKRQSMMFSATMPSWILKLSRNYLTNPLTIDL  314

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI L++I +    K +I+  LI  + 
Sbjct  315  VGDSDQKLADGISLFSIVSETYGKASIIGPLITEHG  350



>ref|NP_188872.2| putative mitochondrial RNA helicase 2 [Arabidopsis thaliana]
 sp|Q9LUW5.1|RH53_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 53 [Arabidopsis 
thaliana]
 dbj|BAB01770.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAL32580.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AAM13255.1| DEAD-Box RNA helicase-like protein [Arabidopsis thaliana]
 gb|AEE76622.1| putative mitochondrial RNA helicase 2 [Arabidopsis thaliana]
Length=616

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA+EGRD+I RA+TGTGKTLAFGIPII +I    +      RGR P  LVLAPTRELA
Sbjct  135  LEPAMEGRDMIGRARTGTGKTLAFGIPIIDKII---KYNAKHGRGRNPLCLVLAPTRELA  191

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  192  RQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSEV  251

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF EDVE+ILEKLP +RQSM+FSATMPSW++ L +KYLNNPLT+DL
Sbjct  252  QFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTVDL  311

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  312  VGDSDQKLADGITTYSIIADSYGRASIIGPLVTEHA  347



>ref|XP_006297246.1| hypothetical protein CARUB_v10013251mg [Capsella rubella]
 gb|EOA30144.1| hypothetical protein CARUB_v10013251mg [Capsella rubella]
Length=609

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 167/218 (77%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIP+I +I      KF+ +  RG+ P+ LVLAPTRE
Sbjct  149  LEPAMQGRDMIGRARTGTGKTLAFGIPVIDKII-----KFNAKHGRGKNPQCLVLAPTRE  203

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ G+DV VGTPGR+IDL+   +L L 
Sbjct  204  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGIDVAVGTPGRIIDLMKRGALNLS  263

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE+IL+KLP +RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  264  EVQFVVLDEADQMLQVGFAEDVEIILQKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTI  323

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI +Y+I   +  + +I+  L+  + 
Sbjct  324  DLVGDSDQKLADGITMYSIAADSYGRASIIGPLVTEHG  361



>ref|XP_010112885.1| DEAD-box ATP-dependent RNA helicase 53 [Morus notabilis]
 gb|EXC35020.1| DEAD-box ATP-dependent RNA helicase 53 [Morus notabilis]
Length=702

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD++ RA+TGTGKTLAFGIPI+ +I    Q      RGR P  LVLAPTRELA
Sbjct  133  LEPAMQGRDMVGRARTGTGKTLAFGIPILDKII---QYNAKHGRGRNPLALVLAPTRELA  189

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVD+ VGTPGR+IDL+N  +L L EV
Sbjct  190  RQVEKEFQESAPSLDTICVYGGTPISQQMRQLDYGVDIAVGTPGRIIDLLNRGALNLSEV  249

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q+LVLDEADQML VGF+EDVE ILEK+P +RQ+M+FSATMP W+++L R YLNNP+ IDL
Sbjct  250  QFLVLDEADQMLQVGFQEDVEKILEKMPQKRQTMMFSATMPQWIRQLVRNYLNNPVNIDL  309

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD  +KLA+GI LYAI +   +K +I+  LI  +A
Sbjct  310  VGDSNQKLADGISLYAIASDTCAKASIIGPLITEHA  345



>ref|XP_010511251.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Camelina sativa]
Length=616

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPII +I    +      RGR P  LVLAPTRELA
Sbjct  129  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII---KYNAKHGRGRNPLCLVLAPTRELA  185

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  186  RQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSEV  245

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF EDVE+ILEKLP +RQSM+FSATMPSW++ L +KYLNNPLTIDL
Sbjct  246  QFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTIDL  305

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  306  VGDSDQKLADGITTYSIIADSYGRASIIGPLVTEHA  341



>ref|XP_010906630.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Elaeis 
guineensis]
Length=661

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 170/218 (78%), Gaps = 8/218 (4%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      +F+ +  RGR P  +VLAPTRE
Sbjct  144  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII-----RFNAKHGRGRNPLAIVLAPTRE  198

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GGV    Q   L  GVDVVVGTPGR+IDL+N  +L L 
Sbjct  199  LARQVEKEFRESAP-LDTLCVYGGVPIQRQMRTLDYGVDVVVGTPGRIIDLLNRGALNLS  257

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQMLAVGF+EDVE+ILEKLP  RQSM+FSATMPSW+++L +KYL +P+TI
Sbjct  258  EVQFVVLDEADQMLAVGFDEDVEIILEKLPPNRQSMMFSATMPSWIRRLTQKYLKDPVTI  317

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KL EGI LY+I +   +K +IL  LI  +A
Sbjct  318  DLVGDSDQKLPEGITLYSIASDNYAKPSILGSLIKEHA  355



>ref|XP_010488258.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 isoform X2 
[Camelina sativa]
Length=628

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPII +I    +      RGR P  LVLAPTRELA
Sbjct  132  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII---KYNAKHGRGRNPLCLVLAPTRELA  188

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  189  RQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSEV  248

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF EDVE+ILEKLP +RQSM+FSATMPSW++ L +KYLNNPLTIDL
Sbjct  249  QFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTIDL  308

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  309  VGDSDQKLADGITTYSIIADSYGRASIIGPLVTEHA  344



>ref|XP_002883354.1| hypothetical protein ARALYDRAFT_479744 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59613.1| hypothetical protein ARALYDRAFT_479744 [Arabidopsis lyrata subsp. 
lyrata]
Length=615

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 166/214 (78%), Gaps = 7/214 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIP+I +I      KF+ +  RG+ P+ LVLAPTRE
Sbjct  151  LEPAMQGRDMIGRARTGTGKTLAFGIPVIDKII-----KFNAKHGRGKNPQCLVLAPTRE  205

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ G+DV VGTPGR+IDL+   +L L 
Sbjct  206  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGIDVAVGTPGRIIDLMKRGALNLS  265

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE+IL+KLP +RQSM+FSATMPSW++ L +KYLNNPLTI
Sbjct  266  EVQFVVLDEADQMLQVGFAEDVEIILQKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTI  325

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLI  638
            DLVGD ++KLA+GI +Y+I   +  + +I+  L+
Sbjct  326  DLVGDSDQKLADGITMYSIAADSYGRASIIGPLV  359



>ref|XP_006406184.1| hypothetical protein EUTSA_v10020296mg [Eutrema salsugineum]
 gb|ESQ47637.1| hypothetical protein EUTSA_v10020296mg [Eutrema salsugineum]
Length=628

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 164/214 (77%), Gaps = 7/214 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPII +I      KF+ +  RG+ P  LVLAPTRE
Sbjct  154  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII-----KFNAKHGRGKNPLCLVLAPTRE  208

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L+ GVDV VGTPGR+IDL+   +L L 
Sbjct  209  LARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGVDVAVGTPGRIIDLMKRGALNLS  268

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVEVILEKLP +RQSM+FSATMPSW++ L +KYLNNPLT+
Sbjct  269  EVQFVVLDEADQMLQVGFAEDVEVILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTV  328

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLI  638
            DLVGD  +KLA+GI +Y+I   +  K +I+  L+
Sbjct  329  DLVGDSSQKLADGITMYSISADSYGKASIIGPLV  362



>ref|XP_010488257.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 isoform X1 
[Camelina sativa]
Length=638

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPII +I    +      RGR P  LVLAPTRELA
Sbjct  132  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII---KYNAKHGRGRNPLCLVLAPTRELA  188

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  189  RQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSEV  248

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF EDVE+ILEKLP +RQSM+FSATMPSW++ L +KYLNNPLTIDL
Sbjct  249  QFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTIDL  308

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  309  VGDSDQKLADGITTYSIIADSYGRASIIGPLVTEHA  344



>ref|XP_010466515.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X3 [Camelina sativa]
Length=631

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPII +I    +      RGR P  LVLAPTRELA
Sbjct  132  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII---KYNAKHGRGRNPLCLVLAPTRELA  188

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  189  RQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSEV  248

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF EDVE+ILEKLP +RQSM+FSATMPSW++ L +KYLNNPLTIDL
Sbjct  249  QFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTIDL  308

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  309  VGDSDQKLADGITTYSIIADSYGRASIIGPLVTEHA  344



>ref|XP_010466514.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Camelina sativa]
Length=635

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPII +I    +      RGR P  LVLAPTRELA
Sbjct  132  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII---KYNAKHGRGRNPLCLVLAPTRELA  188

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  189  RQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSEV  248

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF EDVE+ILEKLP +RQSM+FSATMPSW++ L +KYLNNPLTIDL
Sbjct  249  QFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTIDL  308

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  309  VGDSDQKLADGITTYSIIADSYGRASIIGPLVTEHA  344



>ref|XP_010511255.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Camelina sativa]
Length=640

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPII +I    +      RGR P  LVLAPTRELA
Sbjct  129  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII---KYNAKHGRGRNPLCLVLAPTRELA  185

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  186  RQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSEV  245

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF EDVE+ILEKLP +RQSM+FSATMPSW++ L +KYLNNPLTIDL
Sbjct  246  QFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTIDL  305

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  306  VGDSDQKLADGITTYSIIADSYGRASIIGPLVTEHA  341



>ref|XP_010904642.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Elaeis guineensis]
Length=658

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 170/218 (78%), Gaps = 8/218 (4%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      +F+ +  RGR P  +VLAPTRE
Sbjct  141  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKIM-----RFNAKHGRGRNPLAIVLAPTRE  195

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GGV    Q   L  GVDV+VGTPGR+IDL+   +L L 
Sbjct  196  LARQVEKEFRESAP-LDTLCVYGGVPIQQQMRTLDYGVDVIVGTPGRIIDLLKRGALNLS  254

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQMLAVGF+EDVE+ILEKLP  RQSM+FSATMPSW++KL +KYL +P+TI
Sbjct  255  EIQFVVLDEADQMLAVGFDEDVEIILEKLPPNRQSMMFSATMPSWIRKLTQKYLKDPVTI  314

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLAEGI LY+I +   SK +IL  LI  +A
Sbjct  315  DLVGDSDQKLAEGITLYSIASDNYSKPSILGPLIREHA  352



>ref|XP_006406182.1| hypothetical protein EUTSA_v10020290mg [Eutrema salsugineum]
 gb|ESQ47635.1| hypothetical protein EUTSA_v10020290mg [Eutrema salsugineum]
Length=632

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 165/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPII +I      KF+ +  RGR P  LVLAPTRE
Sbjct  146  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII-----KFNAKHGRGRNPLCLVLAPTRE  200

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDLI   +L L 
Sbjct  201  LARQVEKEFRESAPSLDTICVYGGTPIGQQMRQLDYGVDVAVGTPGRIIDLIKRGALNLS  260

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVEVILE+LP +RQSM+FSATMPSW++ L +KYLN+PLTI
Sbjct  261  EVQFVVLDEADQMLQVGFAEDVEVILERLPEKRQSMMFSATMPSWIRSLTKKYLNDPLTI  320

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  321  DLVGDSDQKLADGITTYSIMAESYGRASIIGPLVTEHA  358



>ref|XP_010904640.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010904641.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Elaeis guineensis]
Length=669

 Score =   269 bits (688),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 135/218 (62%), Positives = 170/218 (78%), Gaps = 8/218 (4%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      +F+ +  RGR P  +VLAPTRE
Sbjct  141  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKIM-----RFNAKHGRGRNPLAIVLAPTRE  195

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GGV    Q   L  GVDV+VGTPGR+IDL+   +L L 
Sbjct  196  LARQVEKEFRESAP-LDTLCVYGGVPIQQQMRTLDYGVDVIVGTPGRIIDLLKRGALNLS  254

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQMLAVGF+EDVE+ILEKLP  RQSM+FSATMPSW++KL +KYL +P+TI
Sbjct  255  EIQFVVLDEADQMLAVGFDEDVEIILEKLPPNRQSMMFSATMPSWIRKLTQKYLKDPVTI  314

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLAEGI LY+I +   SK +IL  LI  +A
Sbjct  315  DLVGDSDQKLAEGITLYSIASDNYSKPSILGPLIREHA  352



>ref|XP_010466512.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Camelina sativa]
Length=645

 Score =   268 bits (686),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPII +I    +      RGR P  LVLAPTRELA
Sbjct  132  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII---KYNAKHGRGRNPLCLVLAPTRELA  188

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  189  RQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSEV  248

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF EDVE+ILEKLP +RQSM+FSATMPSW++ L +KYLNNPLTIDL
Sbjct  249  QFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTIDL  308

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  309  VGDSDQKLADGITTYSIIADSYGRASIIGPLVTEHA  344



>ref|XP_007141482.1| hypothetical protein PHAVU_008G199700g [Phaseolus vulgaris]
 gb|ESW13476.1| hypothetical protein PHAVU_008G199700g [Phaseolus vulgaris]
Length=619

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 166/216 (77%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I    Q      RGR P  LVLAPTRELA
Sbjct  110  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII---QFNAKHGRGRDPLALVLAPTRELA  166

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ESAP+L+T C+ GG     Q   L  GVD+ VGTPGR+IDL+N  +L L EV
Sbjct  167  KQVEKEFYESAPNLDTICVYGGTPISKQMRQLDYGVDIAVGTPGRIIDLLNRGALNLKEV  226

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+E+VE ILE+LP +RQ+++FSATMPSW+K+++R YLN+PLTIDL
Sbjct  227  QFVVLDEADQMLQVGFQEEVEKILERLPLKRQTLMFSATMPSWIKQISRNYLNDPLTIDL  286

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + +  K  IL+ LI  +A
Sbjct  287  VGDSDQKLADGISLYSIASDSYVKAGILAQLITEHA  322



>ref|XP_008776036.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X2 [Phoenix dactylifera]
Length=676

 Score =   269 bits (687),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 170/218 (78%), Gaps = 8/218 (4%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      +F+ +  RGR P  +VLAPTRE
Sbjct  141  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII-----RFNAKHGRGRNPLAIVLAPTRE  195

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GGVS   Q   L  GVDVVVGTPGR+IDL+   +L L 
Sbjct  196  LARQVEKEFRESAP-LDTLCVYGGVSIQQQIRTLDYGVDVVVGTPGRIIDLLKRGALNLS  254

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQMLAVGF+EDVE+ILEKLPS+RQSM+FSATMP W+++L +KYL +P+TI
Sbjct  255  EVQFVVLDEADQMLAVGFDEDVEIILEKLPSKRQSMMFSATMPGWIRRLTQKYLKDPVTI  314

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD  +KL EGI LY+I +   SK +IL  LI  +A
Sbjct  315  DLVGDSNQKLPEGIMLYSIASDNYSKSSILGPLIREHA  352



>ref|XP_009108947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Brassica 
rapa]
Length=617

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 164/218 (75%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA +GRD+I RA+TGTGKTLAFGIPII +I      KF+ +  RGR P  LVLAPTRE
Sbjct  131  LEPATQGRDMIGRARTGTGKTLAFGIPIIDKII-----KFNAKHGRGRNPLCLVLAPTRE  185

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDLI   +L L 
Sbjct  186  LARQVEKEFRESAPSLDTICVYGGTPIGQQMRQLDYGVDVAVGTPGRIIDLIKRGALNLS  245

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE+ILE+LP +RQSM+FSATMPSW++ L +KYLN+PLTI
Sbjct  246  EVQFVVLDEADQMLQVGFAEDVEIILERLPEKRQSMMFSATMPSWIRSLTKKYLNDPLTI  305

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  306  DLVGDSDQKLADGITTYSIMADSYGRASIIGPLVTEHA  343



>ref|XP_008776030.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008776031.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008776032.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008776033.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008776034.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008776035.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Phoenix dactylifera]
Length=687

 Score =   269 bits (687),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 170/218 (78%), Gaps = 8/218 (4%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      +F+ +  RGR P  +VLAPTRE
Sbjct  141  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII-----RFNAKHGRGRNPLAIVLAPTRE  195

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GGVS   Q   L  GVDVVVGTPGR+IDL+   +L L 
Sbjct  196  LARQVEKEFRESAP-LDTLCVYGGVSIQQQIRTLDYGVDVVVGTPGRIIDLLKRGALNLS  254

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQMLAVGF+EDVE+ILEKLPS+RQSM+FSATMP W+++L +KYL +P+TI
Sbjct  255  EVQFVVLDEADQMLAVGFDEDVEIILEKLPSKRQSMMFSATMPGWIRRLTQKYLKDPVTI  314

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD  +KL EGI LY+I +   SK +IL  LI  +A
Sbjct  315  DLVGDSNQKLPEGIMLYSIASDNYSKSSILGPLIREHA  352



>ref|XP_003518490.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53 [Glycine max]
Length=595

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 164/216 (76%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ ++    Q      RGR P  LVLAPTRELA
Sbjct  119  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKVI---QFNAKHGRGRDPLALVLAPTRELA  175

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVE E  ESAP+L+T C+ GG     Q   L  GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  176  RQVESEFCESAPNLDTICVYGGTPISQQMRQLDYGVDIAVGTPGRIIDLLNRGALNLKDV  235

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+EDVE ILE+LP +RQ+++FSATMPSW+K+++R YLNNPLTIDL
Sbjct  236  QFVVLDEADQMLQVGFQEDVEKILERLPPKRQTLMFSATMPSWIKQISRNYLNNPLTIDL  295

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I T    K  IL+ LI  +A
Sbjct  296  VGDSDQKLADGISLYSIATDLYVKAGILAPLITEHA  331



>gb|KFK39522.1| hypothetical protein AALP_AA3G255500 [Arabis alpina]
Length=622

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 164/218 (75%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+ +  RGR P  LVLAPTRE
Sbjct  131  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNAKHGRGRNPLCLVLAPTRE  185

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDLI   +L L 
Sbjct  186  LARQVEKEFRESAPSLDTICVYGGTPIAQQMRQLDYGVDVAVGTPGRIIDLIKRGALNLS  245

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE+ILE+LP +RQSM+FSATMP W++ L +KYLNNP+TI
Sbjct  246  EVQFVVLDEADQMLQVGFAEDVEIILERLPEKRQSMMFSATMPGWIRSLTKKYLNNPVTI  305

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI  Y+I   +  + +I+  L+  +A
Sbjct  306  DLVGDSDQKLADGITTYSIIADSYGRGSIIGPLVTEHA  343



>gb|KHG04586.1| DEAD-box ATP-dependent RNA helicase 53 -like protein [Gossypium 
arboreum]
Length=643

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RAKTGTGKTLAFGIPI+ +I    +      RGR P  LVLAPTRELA
Sbjct  128  LEPAMQGRDMIGRAKTGTGKTLAFGIPIMDKII---RYNAKHGRGRNPLCLVLAPTRELA  184

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ESAP+L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  185  KQVEKEFHESAPNLDTICVYGGTPISRQMRQLDYGVDVAVGTPGRIIDLLKRGALNLSEV  244

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q+LVLDEADQML VGF EDVE ILE+LP+ RQSM+FSATMP+W++ L +K+L NPLTIDL
Sbjct  245  QFLVLDEADQMLQVGFAEDVETILERLPANRQSMMFSATMPNWIRSLTQKHLKNPLTIDL  304

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG+ ++KLAEGI LY+I      K  IL  LI  +A
Sbjct  305  VGENDQKLAEGISLYSIAADMHGKAAILGPLITEHA  340



>ref|XP_003545384.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Glycine 
max]
 gb|KHN12014.1| DEAD-box ATP-dependent RNA helicase 9 [Glycine soja]
Length=610

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 164/216 (76%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I    Q      RGR P  LVLAPTRELA
Sbjct  114  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII---QFNAKHGRGRDPLALVLAPTRELA  170

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVE E  ESAP+L+T C+ GG     Q   L  GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  171  RQVETEFCESAPNLDTICVYGGTPISRQMRELDYGVDIAVGTPGRIIDLLNRGALNLKDV  230

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+EDVE ILE+LP +RQ+++FSATMPSW+K+++R YLNNPLTIDL
Sbjct  231  QFVVLDEADQMLQVGFQEDVEKILERLPPKRQTLMFSATMPSWIKQISRNYLNNPLTIDL  290

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I T    K  IL+ LI  +A
Sbjct  291  VGDSDQKLADGISLYSIATDLYVKAGILAPLITEHA  326



>gb|KJB75398.1| hypothetical protein B456_012G039900 [Gossypium raimondii]
 gb|KJB75400.1| hypothetical protein B456_012G039900 [Gossypium raimondii]
Length=643

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RAKTGTGKTLAFGIPI+ +I    +      RGR P  LVLAPTRELA
Sbjct  128  LEPAMQGRDMIGRAKTGTGKTLAFGIPIMDKII---RYNAKHGRGRNPMCLVLAPTRELA  184

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ESAP+L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  185  KQVEKEFHESAPNLDTICVYGGTPISRQMRQLDYGVDVAVGTPGRIIDLLKRGALNLSEV  244

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q+LVLDEADQML VGF EDVE ILE+LP+ RQSM+FSATMP+W++ L +K+L NPLTIDL
Sbjct  245  QFLVLDEADQMLQVGFAEDVETILERLPANRQSMMFSATMPNWIRSLTQKHLKNPLTIDL  304

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG+ ++KLAEGI LY+I      K  IL  LI  +A
Sbjct  305  VGENDQKLAEGISLYSIAADMRGKAGILGPLITEHA  340



>ref|XP_008804703.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Phoenix 
dactylifera]
Length=679

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 171/218 (78%), Gaps = 8/218 (4%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++G+D+I RA+TGTGKTLAFGIPI+ +I      +F+ +  RGR P  +VLAPTRE
Sbjct  144  LEPAMQGQDMIGRARTGTGKTLAFGIPIMDKIV-----RFNAKHGRGRNPLAIVLAPTRE  198

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE +ES+P L+T C+ GGV   +Q   L  GVDVVVGTPGR+IDL+   +L L 
Sbjct  199  LARQVEKEFRESSP-LDTLCVYGGVPIQSQMRTLDYGVDVVVGTPGRIIDLLKRGALNLS  257

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQMLAVGF+EDVE+ILEKLP  RQSM+FSATMPSW+++L +KYL +P+TI
Sbjct  258  EVQFVVLDEADQMLAVGFDEDVEIILEKLPPNRQSMMFSATMPSWIRRLTQKYLKDPVTI  317

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLAEGI LY+I +   SK +IL  LI  +A
Sbjct  318  DLVGDSDQKLAEGITLYSIASDNYSKPSILGPLIKEHA  355



>ref|XP_008805257.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Phoenix 
dactylifera]
 ref|XP_008805258.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Phoenix 
dactylifera]
Length=627

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA+EGRD+I RA TG+GKTLAFGIPI+  I   +      RR ++P  L+LAPTRELA
Sbjct  127  LEPAMEGRDMIGRAITGSGKTLAFGIPILDNIIRHQNH---HRRKQVPSALILAPTRELA  183

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QV++E K SAP L++ C+ GG+  + Q  AL  G+DVVVGTPGR+IDL+   +L L EV
Sbjct  184  RQVQREFKASAPSLSSTCLYGGIPIMNQVRALGFGMDVVVGTPGRIIDLVQRGALDLSEV  243

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQMLA+GF+EDVE IL  LPS++Q MLFSATMPSWV  L+RKYL +P  IDL
Sbjct  244  KFVVLDEADQMLAIGFQEDVECILSYLPSRKQCMLFSATMPSWVNGLSRKYLKDPFVIDL  303

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLAEGI LY+I TT  +K  +L  LI+ YA
Sbjct  304  VGDSDQKLAEGISLYSIATTTPNKHNLLPTLISRYA  339



>ref|XP_006829732.1| hypothetical protein AMTR_s00126p00110160 [Amborella trichopoda]
 gb|ERM97148.1| hypothetical protein AMTR_s00126p00110160 [Amborella trichopoda]
Length=654

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 167/216 (77%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L+PA++GRD+I RA TG+GKTLAFGIPI+ +I      +   R+ R+P  LVLAPTRELA
Sbjct  110  LVPAMDGRDMIGRAITGSGKTLAFGIPILDKIIRHNTHR---RQKRVPSALVLAPTRELA  166

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QV+KE KESAP+L +AC+ GG+  + Q   LS G D+VVGTPGR+IDLI   +L L EV
Sbjct  167  RQVQKEFKESAPNLISACLYGGIPIMNQVRVLSFGTDIVVGTPGRIIDLIERGALDLSEV  226

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEAD+MLAVGF+E VE I+  LPS++Q MLFSATMPSWV +LA+KYL +PL IDL
Sbjct  227  KFVVLDEADEMLAVGFQEAVECIMNYLPSKKQCMLFSATMPSWVNELAKKYLRDPLVIDL  286

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD E+KLAEGI LY++ +T   K+++L  LI  +A
Sbjct  287  VGDSEQKLAEGISLYSVASTTYRKQSVLQSLITKFA  322



>ref|XP_006297190.1| hypothetical protein CARUB_v10013195mg [Capsella rubella]
 gb|EOA30088.1| hypothetical protein CARUB_v10013195mg [Capsella rubella]
Length=636

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPII +I    +      RGR P  LVLAPTRELA
Sbjct  133  LEPAMQGRDMIGRARTGTGKTLAFGIPIIDKII---KYNAKHGRGRNPLCLVLAPTRELA  189

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  190  RQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSEV  249

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF EDVE+ILEKLP +RQSM+FSATMPSW++ L +KYLN+PLTIDL
Sbjct  250  QFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNDPLTIDL  309

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI  Y+I   +  + +++  L+  +A
Sbjct  310  VGDSDQKLADGITTYSIIADSYGRASVIGPLVTEHA  345



>ref|XP_002976111.1| hypothetical protein SELMODRAFT_10661, partial [Selaginella moellendorffii]
 gb|EFJ23016.1| hypothetical protein SELMODRAFT_10661, partial [Selaginella moellendorffii]
Length=597

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PA++G D+IARAKTGTGKTLAFGIPI+  I+  E+S    R    PR ++LAPTRELAKQ
Sbjct  37   PAMQGLDLIARAKTGTGKTLAFGIPILDNISR-EKSSMQFRPAGTPRAIILAPTRELAKQ  95

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VE E+  +APHL+  CI GGVS   Q   L+  V+VVVGTPGR+ID++    L+L EV++
Sbjct  96   VENELVLAAPHLSVVCIYGGVSIEGQRRQLASSVEVVVGTPGRVIDMLERGDLRLNEVKF  155

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
             +LDEADQMLAVGF E+VE I++KLP QR +MLFSATMPSW++ L  KYL NP  IDLVG
Sbjct  156  AILDEADQMLAVGFAEEVERIMQKLPLQRHTMLFSATMPSWIRNLTSKYLKNPTMIDLVG  215

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            + E+K+AEGIKLYA+ T   +K  +L+DL+ VYA
Sbjct  216  ENEDKVAEGIKLYAVSTNDLAKNKLLADLLTVYA  249



>sp|Q0D8N0.2|RH53_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 53 [Oryza sativa 
Japonica Group]
 gb|EEC81508.1| hypothetical protein OsI_24871 [Oryza sativa Indica Group]
 gb|EEE66553.1| hypothetical protein OsJ_23067 [Oryza sativa Japonica Group]
Length=602

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 164/216 (76%), Gaps = 4/216 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+I RA+TGTGKTLAFGIPI+ RI    +   S   GR P  ++LAPTRELA
Sbjct  115  LDPAMQGKDMIGRARTGTGKTLAFGIPIMDRILRHNEKNGS---GRNPLAIILAPTRELA  171

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE KESAP L++ C+ GGV    Q  AL+ GVDVVVGTPGR+IDL+    L L E+
Sbjct  172  RQVEKEFKESAP-LDSLCVYGGVPISHQMRALNYGVDVVVGTPGRIIDLLRRGVLNLSEI  230

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGF+EDVEVI+E LP  RQSMLFSATMPSW++K+  KYL +P+ IDL
Sbjct  231  QFVVLDEADQMLAVGFDEDVEVIMENLPQNRQSMLFSATMPSWIRKITSKYLKDPIIIDL  290

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGDE++KL EGI LY+I +    K +IL  LI  +A
Sbjct  291  VGDEDQKLPEGISLYSIASEHYGKPSILGPLIKEHA  326



>ref|XP_002968267.1| hypothetical protein SELMODRAFT_10677, partial [Selaginella moellendorffii]
 gb|EFJ30521.1| hypothetical protein SELMODRAFT_10677, partial [Selaginella moellendorffii]
Length=614

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PA++G D+IARAKTGTGKTLAFGIPI+  I+  E+S    R    PR ++LAPTRELAKQ
Sbjct  37   PAMQGLDLIARAKTGTGKTLAFGIPILDNISR-EKSSMQFRPAGTPRAIILAPTRELAKQ  95

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VE E+  +APHL+  CI GGVS   Q   L+  V+VVVGTPGR+ID++    L+L EV++
Sbjct  96   VENELVLAAPHLSVVCIYGGVSIEGQRRQLASSVEVVVGTPGRVIDMLERGDLRLNEVKF  155

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
             +LDEADQMLAVGF E+VE I++KLP QR +MLFSATMPSW++ L  KYL NP  IDLVG
Sbjct  156  AILDEADQMLAVGFAEEVERIMQKLPLQRHTMLFSATMPSWIRNLTSKYLKNPTMIDLVG  215

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            + E+K+AEGIKLYA+ T   +K  +L+DL+ VYA
Sbjct  216  ENEDKVAEGIKLYAVSTNDLAKNKLLADLLTVYA  249



>gb|AET00260.2| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=590

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 164/216 (76%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I    Q      RG+ P  LVLAPTRELA
Sbjct  111  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII---QFNAKHGRGKDPLALVLAPTRELA  167

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  E+AP+L+T C+ GG     Q   L  GVD+ VGTPGR+IDL+N  +L L EV
Sbjct  168  KQVEKEFYEAAPNLDTICVYGGTPISQQMRQLDYGVDIAVGTPGRIIDLLNRGALNLKEV  227

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q+++LDEADQML VGF+EDVE ILE+LP++RQ+++FSATMP+W+K+L R YL NPLTIDL
Sbjct  228  QFVILDEADQMLQVGFQEDVEKILERLPAERQTLMFSATMPTWIKQLTRNYLKNPLTIDL  287

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + A  K  I+  LI  +A
Sbjct  288  VGDSDQKLADGISLYSILSDAYVKAGIIVPLIKEHA  323



>ref|XP_004491264.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Cicer 
arietinum]
Length=592

 Score =   264 bits (674),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 164/216 (76%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I    Q      RGR P  LVLAPTRELA
Sbjct  114  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII---QFNAKHGRGRDPLALVLAPTRELA  170

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  E+AP+L+T C+ GG     Q   L  GVD+ VGTPGR+IDL+N  +L L EV
Sbjct  171  KQVEKEFYEAAPNLDTICVYGGTPISQQMRQLDYGVDIAVGTPGRIIDLLNRGALNLKEV  230

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q+++LDEADQML VGF+EDVE ILE+LP++RQ+++FSATMP+W+K+L R YL +PLTIDL
Sbjct  231  QFVILDEADQMLQVGFQEDVEKILERLPAKRQTLMFSATMPTWIKQLTRNYLKDPLTIDL  290

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY++ + +  K  IL  LI  +A
Sbjct  291  VGDSDQKLADGISLYSVASDSYVKAGILVPLIKEHA  326



>ref|XP_004499961.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Cicer 
arietinum]
Length=557

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 167/218 (77%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRG--RLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I +     F+ + G  R P  LVLAPTRE
Sbjct  117  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKIIQ-----FNAKHGKRRDPLALVLAPTRE  171

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE  E+AP+L T C+ GG+    Q   L  GV++VVGTPGR+IDL+   SLKL 
Sbjct  172  LARQVEKEFNEAAPNLETVCLYGGMPIQQQIRQLDGGVEIVVGTPGRVIDLLKRGSLKLK  231

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            +V+++VLDEADQML VGF+E VE IL+K+P++RQ+++FSATMPSW+K L R YLNNPLTI
Sbjct  232  DVKFVVLDEADQMLQVGFQEAVETILQKMPTKRQTLMFSATMPSWIKNLTRNYLNNPLTI  291

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I +   +K  IL+ LI  +A
Sbjct  292  DLVGDSDQKLADGISLYSIASNGNAKAGILAPLITEHA  329



>gb|KEH33610.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=558

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 165/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRG--RLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+ + G  R P  LVLAPTRE
Sbjct  120  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNAKNGKRRDPLALVLAPTRE  174

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE K++AP+L    + GG+    Q S L  GVD+VVGTPGR+IDL+   SLKL 
Sbjct  175  LARQVEKEFKDAAPNLEIISLYGGMPIQQQISKLGSGVDIVVGTPGRVIDLLKRGSLKLK  234

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            +V Y+VLDEADQML VGF+E VE IL+KLPS+RQ+++FSATMPSW+K L R YLN PLTI
Sbjct  235  DVNYVVLDEADQMLQVGFQEAVETILQKLPSKRQTLMFSATMPSWIKNLTRNYLNKPLTI  294

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I + A SK  IL  LI  +A
Sbjct  295  DLVGDSDQKLADGISLYSIASNAYSKAGILVPLITEHA  332



>ref|XP_007048882.1| DEAD-box ATP-dependent RNA helicase 53 isoform 1 [Theobroma cacao]
 ref|XP_007048883.1| DEAD-box ATP-dependent RNA helicase 53 isoform 1 [Theobroma cacao]
 gb|EOX93039.1| DEAD-box ATP-dependent RNA helicase 53 isoform 1 [Theobroma cacao]
 gb|EOX93040.1| DEAD-box ATP-dependent RNA helicase 53 isoform 1 [Theobroma cacao]
Length=631

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RAKTGTGKTLAFG+PI+ +I    +      RGR P  LVLAPTRELA
Sbjct  132  LEPAMQGRDMIGRAKTGTGKTLAFGMPIMDKII---RYNAQHGRGRNPLCLVLAPTRELA  188

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ESAP+L+T C+ GG     Q   L  GVD+ VGTPGR+IDL+   +L L EV
Sbjct  189  KQVEKEFHESAPNLDTICVYGGTPISRQMRQLDFGVDIAVGTPGRIIDLLKRGALNLSEV  248

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q+LVLDEADQML VGF E+VE ILE+LP  RQSM+FSATMP+W+K+L +K+L NPLTIDL
Sbjct  249  QFLVLDEADQMLHVGFVEEVETILERLPENRQSMMFSATMPNWIKRLTQKHLKNPLTIDL  308

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG+ ++KLAEGI LY+I      K +IL  LI  +A
Sbjct  309  VGESDQKLAEGISLYSIAADMHGKASILGPLITEHA  344



>ref|XP_007048884.1| DEAD-box ATP-dependent RNA helicase 53 isoform 3 [Theobroma cacao]
 gb|EOX93041.1| DEAD-box ATP-dependent RNA helicase 53 isoform 3 [Theobroma cacao]
Length=635

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 159/214 (74%), Gaps = 3/214 (1%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PA++GRD+I RAKTGTGKTLAFG+PI+ +I    +      RGR P  LVLAPTRELAKQ
Sbjct  134  PAMQGRDMIGRAKTGTGKTLAFGMPIMDKII---RYNAQHGRGRNPLCLVLAPTRELAKQ  190

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VEKE  ESAP+L+T C+ GG     Q   L  GVD+ VGTPGR+IDL+   +L L EVQ+
Sbjct  191  VEKEFHESAPNLDTICVYGGTPISRQMRQLDFGVDIAVGTPGRIIDLLKRGALNLSEVQF  250

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            LVLDEADQML VGF E+VE ILE+LP  RQSM+FSATMP+W+K+L +K+L NPLTIDLVG
Sbjct  251  LVLDEADQMLHVGFVEEVETILERLPENRQSMMFSATMPNWIKRLTQKHLKNPLTIDLVG  310

Query  549  DEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            + ++KLAEGI LY+I      K +IL  LI  +A
Sbjct  311  ESDQKLAEGISLYSIAADMHGKASILGPLITEHA  344



>gb|KEH33609.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=579

 Score =   262 bits (669),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 165/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRG--RLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+ + G  R P  LVLAPTRE
Sbjct  120  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNAKNGKRRDPLALVLAPTRE  174

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE K++AP+L    + GG+    Q S L  GVD+VVGTPGR+IDL+   SLKL 
Sbjct  175  LARQVEKEFKDAAPNLEIISLYGGMPIQQQISKLGSGVDIVVGTPGRVIDLLKRGSLKLK  234

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            +V Y+VLDEADQML VGF+E VE IL+KLPS+RQ+++FSATMPSW+K L R YLN PLTI
Sbjct  235  DVNYVVLDEADQMLQVGFQEAVETILQKLPSKRQTLMFSATMPSWIKNLTRNYLNKPLTI  294

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I + A SK  IL  LI  +A
Sbjct  295  DLVGDSDQKLADGISLYSIASNAYSKAGILVPLITEHA  332



>ref|XP_003557638.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Brachypodium 
distachyon]
Length=604

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 165/216 (76%), Gaps = 4/216 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+I RA+TGTGKTLAFGIPI+ RI    +   +   GR P  ++LAPTRELA
Sbjct  115  LEPAMQGKDMIGRARTGTGKTLAFGIPIMDRILRHNEKNGT---GRNPLAIILAPTRELA  171

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE KESAP L+T C+ GGV    Q   L+ GVDVVVGTPGR+IDL+   +L L E+
Sbjct  172  RQVEKEFKESAP-LDTLCVYGGVPINQQMRTLNYGVDVVVGTPGRIIDLLRRGNLNLSEI  230

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGF+EDVEVI+EKLP  RQSMLFSATMPSW++KL+ +YL +P+ IDL
Sbjct  231  QFVVLDEADQMLAVGFDEDVEVIMEKLPQNRQSMLFSATMPSWIRKLSNQYLKDPVIIDL  290

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG+ ++KL EGI LY+I +    K +IL  LI  +A
Sbjct  291  VGESDQKLPEGISLYSIASENYGKSSILGTLIKEHA  326



>gb|KHN28526.1| DEAD-box ATP-dependent RNA helicase 53, partial [Glycine soja]
Length=530

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RIT   Q      +GR P  LVLAPTRELA
Sbjct  36   LEPAMQGRDMIGRARTGTGKTLAFGIPILDRIT---QFNAKHGQGRNPLALVLAPTRELA  92

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  93   RQVEKEFNEAAPNLATICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKDV  152

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  153  KFVVLDEADQMLRVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  212

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  213  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  248



>ref|XP_002308835.2| hypothetical protein POPTR_0006s02500g [Populus trichocarpa]
 gb|EEE92358.2| hypothetical protein POPTR_0006s02500g [Populus trichocarpa]
Length=556

 Score =   260 bits (664),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 161/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+  RA+TGTGKTLAFGIPI+ +I E  +      +GR P  +V+APTRELA
Sbjct  98   LEPAMQGKDMFGRARTGTGKTLAFGIPILDKIIEFNKQ---HGKGRNPLAMVMAPTRELA  154

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QV+KE  +SAP L+T C+ GGV   +Q   L  GVDVVVGTPGR+IDL+   SL L E+
Sbjct  155  RQVQKEFHDSAPSLDTICLYGGVPISSQMRELEYGVDVVVGTPGRIIDLMKRGSLNLSEI  214

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +Y+VLDEADQML VGF +D+E IL +LP +R SM FSATMPSW+K+L RKYL +PLTIDL
Sbjct  215  KYVVLDEADQMLGVGFVDDIETILSRLPKKRHSMCFSATMPSWIKQLVRKYLKDPLTIDL  274

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD + KLA+GI LY+I +   +K +IL  LI  +A
Sbjct  275  VGDSDRKLADGITLYSIASDMYAKASILGPLITEHA  310



>ref|XP_007217634.1| hypothetical protein PRUPE_ppa002643mg [Prunus persica]
 gb|EMJ18833.1| hypothetical protein PRUPE_ppa002643mg [Prunus persica]
Length=649

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 161/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I    +      RGR P  LVLAPTRELA
Sbjct  143  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKIL---KYNAKHGRGRNPLALVLAPTRELA  199

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ESAP L+T C+ GG    +Q   L  GVDV VGTPGR+IDLIN  +L L EV
Sbjct  200  KQVEKEFHESAPGLDTICVYGGTPISSQMRQLDYGVDVAVGTPGRVIDLINRGALNLSEV  259

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+E VE+ILEKLP +RQ+++FSATMP W+KKL + YL NP  IDL
Sbjct  260  QFVVLDEADQMLQVGFQEAVEIILEKLPKKRQTLMFSATMPGWIKKLTQNYLKNPEVIDL  319

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG+ ++KLA+GI L++I + +  K +I+  LI  +A
Sbjct  320  VGESDQKLADGISLFSISSDSYGKASIIGPLITAHA  355



>ref|XP_008380050.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Malus 
domestica]
Length=508

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+I RA+TGTGKTLAFGIPI+ +I +    K    RG+ P  LVLAPTRELA
Sbjct  143  LEPAMQGQDMIGRARTGTGKTLAFGIPILDKIFKHNAIK---GRGKXPLALVLAPTRELA  199

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ++AP L T C+ GG    +Q  AL  GVDV VGTPGR+IDLIN  +L LGEV
Sbjct  200  KQVEKEFHDAAPGLETICVYGGTPISSQMRALDYGVDVAVGTPGRVIDLINRGALNLGEV  259

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+E VE ILE++P +RQ++LFSATMP+W++KL + YL +P  IDL
Sbjct  260  QFIVLDEADQMLQVGFQEAVETILERVPKKRQTLLFSATMPNWIRKLTQNYLKDPAVIDL  319

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + +  + +I+  LI  +A
Sbjct  320  VGDSDQKLADGISLYSIVSDSYGRASIIGPLITEHA  355



>ref|XP_011040644.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Populus 
euphratica]
Length=593

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+  RA+TGTGKTLAFGIPI+ +I E  +      +GR P  +V+APTRELA
Sbjct  135  LEPAMQGKDMFGRARTGTGKTLAFGIPILDKIIEFNKQ---HGKGRNPLAMVMAPTRELA  191

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QV+KE  +SAP L+T C+ GGV   +Q   L  GVDVVVGTPGR+IDL+   SL L E+
Sbjct  192  RQVQKEFHDSAPSLDTICLYGGVPISSQMRELEYGVDVVVGTPGRIIDLMKRGSLNLSEI  251

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +Y+VLDEADQML VGF +D+E IL +LP +R SM FSATMPSW+K+L RKYL +PLTIDL
Sbjct  252  KYVVLDEADQMLGVGFVDDIETILSRLPKKRHSMCFSATMPSWIKQLVRKYLKDPLTIDL  311

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I +   +K +IL  LI  +A
Sbjct  312  VGDSDKKLADGITLYSIASDMYAKASILGPLITEHA  347



>ref|XP_006602288.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X11 [Glycine max]
Length=592

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RIT   Q      +GR P  LVLAPTRELA
Sbjct  118  LEPAMQGRDMIGRARTGTGKTLAFGIPILDRIT---QFNAKHGQGRNPLALVLAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  175  RQVEKEFNEAAPNLATICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKDV  234

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  235  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  294

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  295  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  330



>ref|XP_011004482.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Populus 
euphratica]
Length=593

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 162/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+  RA+TGTGKTLAFGIPI+ +I E  +      +GR P  +V+APTRELA
Sbjct  135  LEPAMQGKDMFGRARTGTGKTLAFGIPILDKIIEFNKQ---HGKGRNPLAMVMAPTRELA  191

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QV+KE  +SAP L+T C+ GGV   +Q   L  GVDVVVGTPGR+IDL+   SL L E+
Sbjct  192  RQVQKEFHDSAPSLDTICLYGGVPISSQMRELEYGVDVVVGTPGRIIDLMKRGSLNLSEI  251

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +Y+VLDEADQML VGF +D+E IL +LP +R SM FSATMPSW+K+L RKYL +PLTIDL
Sbjct  252  KYVVLDEADQMLGVGFVDDIETILSRLPKKRHSMCFSATMPSWIKQLVRKYLKDPLTIDL  311

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I +   +K +IL  LI  +A
Sbjct  312  VGDSDKKLADGITLYSIASDMYAKASILGPLITEHA  347



>ref|XP_006380943.1| hypothetical protein POPTR_0006s02500g [Populus trichocarpa]
 gb|ERP58740.1| hypothetical protein POPTR_0006s02500g [Populus trichocarpa]
Length=593

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 161/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+  RA+TGTGKTLAFGIPI+ +I E  +      +GR P  +V+APTRELA
Sbjct  135  LEPAMQGKDMFGRARTGTGKTLAFGIPILDKIIEFNKQ---HGKGRNPLAMVMAPTRELA  191

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QV+KE  +SAP L+T C+ GGV   +Q   L  GVDVVVGTPGR+IDL+   SL L E+
Sbjct  192  RQVQKEFHDSAPSLDTICLYGGVPISSQMRELEYGVDVVVGTPGRIIDLMKRGSLNLSEI  251

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +Y+VLDEADQML VGF +D+E IL +LP +R SM FSATMPSW+K+L RKYL +PLTIDL
Sbjct  252  KYVVLDEADQMLGVGFVDDIETILSRLPKKRHSMCFSATMPSWIKQLVRKYLKDPLTIDL  311

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD + KLA+GI LY+I +   +K +IL  LI  +A
Sbjct  312  VGDSDRKLADGITLYSIASDMYAKASILGPLITEHA  347



>ref|XP_002461445.1| hypothetical protein SORBIDRAFT_02g002790 [Sorghum bicolor]
 gb|EER97966.1| hypothetical protein SORBIDRAFT_02g002790 [Sorghum bicolor]
Length=602

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 166/216 (77%), Gaps = 4/216 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+I RA+TGTGKTLAFGIPI+ +I    +   +   GR P  +VLAPTRELA
Sbjct  117  LEPAMQGKDMIGRARTGTGKTLAFGIPIMDKILSHNEKNGN---GRNPLAIVLAPTRELA  173

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GGV    Q   L+ GVD+VVGTPGR+IDL+    L L ++
Sbjct  174  RQVEKEFRESAP-LDTLCVYGGVPINQQMRVLNYGVDIVVGTPGRIIDLLRRGVLNLSQI  232

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGF+EDVEVI+E+LP  RQSMLFSATMPSW++K++ KYLN+P+ IDL
Sbjct  233  QFVVLDEADQMLAVGFDEDVEVIMEQLPQNRQSMLFSATMPSWIRKISNKYLNDPVIIDL  292

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KL EGI LY+I +    K++IL  LI  +A
Sbjct  293  VGDSDQKLPEGISLYSIASDNFGKQSILGPLIKEHA  328



>ref|XP_008229751.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Prunus 
mume]
Length=640

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 161/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I    +      RGR P  LVLAPTRELA
Sbjct  143  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKIL---KYNAKHGRGRNPLALVLAPTRELA  199

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ESAP L+T C+ GG    +Q   L  GVDV VGTPGR+IDLIN  +L L EV
Sbjct  200  KQVEKEFHESAPGLDTICVYGGTPISSQMRQLDYGVDVAVGTPGRVIDLINRGALNLSEV  259

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+E VE+ILEKLP +RQ+++FSATMP W+KKL + YL NP  IDL
Sbjct  260  QFVVLDEADQMLQVGFQEAVEIILEKLPKKRQTLMFSATMPGWIKKLTQNYLKNPEVIDL  319

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG+ ++KLA+GI L++I + +  K +I+  LI  +A
Sbjct  320  VGESDQKLADGISLFSISSDSYGKASIIGPLITEHA  355



>ref|XP_006602287.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X10 [Glycine max]
Length=601

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RIT   Q      +GR P  LVLAPTRELA
Sbjct  118  LEPAMQGRDMIGRARTGTGKTLAFGIPILDRIT---QFNAKHGQGRNPLALVLAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  175  RQVEKEFNEAAPNLATICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKDV  234

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  235  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  294

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  295  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  330



>ref|XP_006602283.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X6 [Glycine max]
Length=625

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RIT   Q      +GR P  LVLAPTRELA
Sbjct  118  LEPAMQGRDMIGRARTGTGKTLAFGIPILDRIT---QFNAKHGQGRNPLALVLAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  175  RQVEKEFNEAAPNLATICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKDV  234

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  235  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  294

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  295  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  330



>ref|XP_006602286.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X9 [Glycine max]
Length=612

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RIT   Q      +GR P  LVLAPTRELA
Sbjct  118  LEPAMQGRDMIGRARTGTGKTLAFGIPILDRIT---QFNAKHGQGRNPLALVLAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  175  RQVEKEFNEAAPNLATICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKDV  234

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  235  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  294

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  295  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  330



>ref|XP_006602279.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X2 [Glycine max]
 ref|XP_006602280.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X3 [Glycine max]
Length=634

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RIT   Q      +GR P  LVLAPTRELA
Sbjct  118  LEPAMQGRDMIGRARTGTGKTLAFGIPILDRIT---QFNAKHGQGRNPLALVLAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  175  RQVEKEFNEAAPNLATICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKDV  234

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  235  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  294

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  295  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  330



>dbj|BAJ89481.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=623

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 162/216 (75%), Gaps = 4/216 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+I RA+TGTGKTLAFGIPI+ RI    +   S   GR P  ++LAPTRELA
Sbjct  118  LEPAMQGKDMIGRARTGTGKTLAFGIPIMDRILRHNEKNGS---GRNPLAIILAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GGV    Q   L+ GVDVVVGTPGR+IDL+    L L E+
Sbjct  175  RQVEKEFRESAP-LDTLCVYGGVPISQQMRTLNYGVDVVVGTPGRVIDLLRRGVLNLSEI  233

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGF+E VEVI+EKLP  RQSMLFSATMPSW++KL  +YL +P+ IDL
Sbjct  234  QFMVLDEADQMLAVGFDEAVEVIMEKLPQNRQSMLFSATMPSWIRKLTNQYLKDPVIIDL  293

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD E+KL EGI LY+I +    K +IL  LI  +A
Sbjct  294  VGDSEQKLPEGISLYSIVSENYGKSSILGPLIKEHA  329



>ref|XP_006602284.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X7 [Glycine max]
 ref|XP_006602285.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X8 [Glycine max]
Length=623

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RIT   Q      +GR P  LVLAPTRELA
Sbjct  118  LEPAMQGRDMIGRARTGTGKTLAFGIPILDRIT---QFNAKHGQGRNPLALVLAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  175  RQVEKEFNEAAPNLATICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKDV  234

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  235  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  294

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  295  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  330



>ref|XP_003553167.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X1 [Glycine max]
Length=643

 Score =   260 bits (665),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RIT   Q      +GR P  LVLAPTRELA
Sbjct  118  LEPAMQGRDMIGRARTGTGKTLAFGIPILDRIT---QFNAKHGQGRNPLALVLAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  175  RQVEKEFNEAAPNLATICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKDV  234

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  235  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  294

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  295  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  330



>ref|XP_004955446.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
53-like [Setaria italica]
Length=609

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 168/219 (77%), Gaps = 4/219 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRI-TEDEQSKFSQ--RRGRLPRVLVLAPTR  173
            L PA++G+D+I RA+TGTGKTLAFGIPI+ RI + +E++      R GR P  +VLAPTR
Sbjct  115  LEPAMQGKDMIGRARTGTGKTLAFGIPIMDRIISYNEKNGLCDACRSGRNPLAIVLAPTR  174

Query  174  ELAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKL  353
            ELA+QVEKE +ESAP L+T C+ GGV    Q   L+ GVD+VVGTPGR+IDL+    L L
Sbjct  175  ELARQVEKEFRESAP-LDTLCVYGGVPINQQMRVLNYGVDIVVGTPGRVIDLLRRGVLNL  233

Query  354  GEVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLT  533
             E+Q++VLDEADQMLAVGF+EDVEVI+E+LP  RQSMLFSATMPSW++K++ KYL +P+ 
Sbjct  234  SEIQFVVLDEADQMLAVGFDEDVEVIMEQLPQNRQSMLFSATMPSWIRKISNKYLKDPVI  293

Query  534  IDLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            IDLVGD ++KL EGI LY+I +    K +IL  LI  +A
Sbjct  294  IDLVGDSDQKLPEGISLYSIASDNFGKPSILGPLIKEHA  332



>ref|XP_006602282.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X5 [Glycine max]
Length=632

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RIT   Q      +GR P  LVLAPTRELA
Sbjct  118  LEPAMQGRDMIGRARTGTGKTLAFGIPILDRIT---QFNAKHGQGRNPLALVLAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  175  RQVEKEFNEAAPNLATICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKDV  234

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  235  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  294

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  295  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  330



>ref|XP_011467638.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Fragaria 
vesca subsp. vesca]
Length=649

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I    Q      RGR P  LVLAPTRELA
Sbjct  130  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII---QYNAKHGRGRNPLALVLAPTRELA  186

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQV+KE  E+AP L+T C+ GG     Q   L  GVDV VGTPGR+IDL+   +L L EV
Sbjct  187  KQVDKEFYETAPSLDTICVYGGTPIGRQMGQLDHGVDVAVGTPGRVIDLLKRGALNLLEV  246

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF+EDVE+ILE+LP +RQ++LFSATMP+W+K L R YL NP+ IDL
Sbjct  247  QFVVLDEADQMLQVGFQEDVEIILERLPKKRQTLLFSATMPTWIKNLTRNYLTNPVVIDL  306

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KL +GI LY+I   +  K +I+  LI  +A
Sbjct  307  VGDSDQKLPDGISLYSIAADSYGKASIIGPLITEHA  342



>ref|XP_006602281.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like isoform 
X4 [Glycine max]
Length=632

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 163/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RIT   Q      +GR P  LVLAPTRELA
Sbjct  118  LEPAMQGRDMIGRARTGTGKTLAFGIPILDRIT---QFNAKHGQGRNPLALVLAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  175  RQVEKEFNEAAPNLATICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKDV  234

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  235  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  294

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  295  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  330



>gb|EMS54347.1| DEAD-box ATP-dependent RNA helicase 53 [Triticum urartu]
Length=619

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 162/216 (75%), Gaps = 4/216 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+I RA+TGTGKTLAFGIPI+ RI    +   S   GR P  ++LAPTRELA
Sbjct  118  LEPAMQGKDMIGRARTGTGKTLAFGIPIMDRILRHNEKNGS---GRNPLAIILAPTRELA  174

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE KESAP L+T C+ GGV    Q   L+ GVDVVVGTPGR+IDL+    L L E+
Sbjct  175  RQVEKEFKESAP-LDTLCVYGGVPISQQMRTLNYGVDVVVGTPGRVIDLLRRGVLNLSEI  233

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGF+E VEVI+EKLP  RQSMLFSATMPSW++KL  +YL +P+ IDL
Sbjct  234  QFVVLDEADQMLAVGFDEAVEVIMEKLPQNRQSMLFSATMPSWIRKLTNQYLKDPVIIDL  293

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD E+KL EGI LY+I +    K +IL  LI  +A
Sbjct  294  VGDSEQKLPEGISLYSIVSENYGKSSILGPLIKEHA  329



>ref|XP_003617301.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=802

 Score =   263 bits (672),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 164/216 (76%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I    Q      RG+ P  LVLAPTRELA
Sbjct  111  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII---QFNAKHGRGKDPLALVLAPTRELA  167

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  E+AP+L+T C+ GG     Q   L  GVD+ VGTPGR+IDL+N  +L L EV
Sbjct  168  KQVEKEFYEAAPNLDTICVYGGTPISQQMRQLDYGVDIAVGTPGRIIDLLNRGALNLKEV  227

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q+++LDEADQML VGF+EDVE ILE+LP++RQ+++FSATMP+W+K+L R YL NPLTIDL
Sbjct  228  QFVILDEADQMLQVGFQEDVEKILERLPAERQTLMFSATMPTWIKQLTRNYLKNPLTIDL  287

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + A  K  I+  LI  +A
Sbjct  288  VGDSDQKLADGISLYSILSDAYVKAGIIVPLIKEHA  323



>ref|XP_008348328.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like, partial 
[Malus domestica]
Length=512

 Score =   256 bits (655),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 161/216 (75%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G D+I RA+TGTGKTLAFGIPI+ +I +    K    RG+ P  LVLAPTRELA
Sbjct  143  LEPAMQGXDMIGRARTGTGKTLAFGIPILDKIFKHNAIK---GRGKXPLALVLAPTRELA  199

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVEKE  ++AP L T C+ GG    +Q  AL  GVDV VGTPGR+IDLIN  +L LGEV
Sbjct  200  KQVEKEFHDAAPGLETICVYGGTPISSQMRALDYGVDVAVGTPGRVIDLINRGALNLGEV  259

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q+ VLDEADQML VGF+E VE ILE++P +RQ++LFSATMP+W++KL + YL +P  IDL
Sbjct  260  QFXVLDEADQMLQVGFQEAVETILERVPKKRQTLLFSATMPNWIRKLTQNYLKDPAVIDL  319

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + +  + +I+  LI  +A
Sbjct  320  VGDSDQKLADGISLYSIVSDSYGRASIIGPLITEHA  355



>ref|XP_008342283.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Malus 
domestica]
Length=627

 Score =   259 bits (663),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 165/218 (76%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFS--QRRGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      K++    RG+ P  LVLAPTRE
Sbjct  143  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKIF-----KYNAIHGRGKNPLALVLAPTRE  197

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKE  ++AP L+T C+ GG    +Q  AL  GVDV VGTPGR+IDLIN  +L L 
Sbjct  198  LAKQVEKEFHDTAPGLDTICVYGGTPISSQMRALDYGVDVAVGTPGRVIDLINRGALNLE  257

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF+EDVE+ILE++P +RQ++LFSATMP W++KL + YL +P  I
Sbjct  258  EVQFVVLDEADQMLQVGFQEDVEIILERVPKKRQTLLFSATMPGWIRKLTQNYLKDPAVI  317

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I + +  + +I+  LI  +A
Sbjct  318  DLVGDSDQKLADGISLYSIASDSYGRASIIGPLITEHA  355



>ref|XP_006664735.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like, partial 
[Oryza brachyantha]
Length=570

 Score =   258 bits (659),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 167/216 (77%), Gaps = 4/216 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D++ RAKTGTGKTLAFGIPI+  I    +     + GR P  +VLAPTRELA
Sbjct  69   LEPAMQGKDMVGRAKTGTGKTLAFGIPILDAIIRHNEK---HQPGRFPLAIVLAPTRELA  125

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVE+E  ES+ ++ T C+ GG     Q   L+ GVDVVVGTPGR+IDL+   +L L EV
Sbjct  126  KQVEREFSESS-NVETICVYGGSPINQQIRQLNYGVDVVVGTPGRVIDLLKRGALNLAEV  184

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML+VGF+EDVE ILE++PSQRQ+++FSATMPSW++KL +KYL NP+TIDL
Sbjct  185  QFVVLDEADQMLSVGFDEDVETILERVPSQRQTLMFSATMPSWIRKLTQKYLKNPVTIDL  244

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG++++KLAEGI LY+I + + +K  +L +LI  +A
Sbjct  245  VGEDDQKLAEGISLYSISSESHAKPAVLGELIKEHA  280



>ref|XP_010532528.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Tarenaya 
hassleriana]
Length=611

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/218 (61%), Positives = 163/218 (75%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+ +  RGR P  LVLAPTRE
Sbjct  141  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNAKHGRGRNPLCLVLAPTRE  195

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE  ESAP L+T CI GG     Q   L  GVDVVVGTPGR+IDL+   +L L 
Sbjct  196  LARQVEKEFHESAPSLDTICIYGGTPIGRQMQQLGYGVDVVVGTPGRVIDLLKRGALILS  255

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE ILEKLP +RQ+M+FSATMP+W++ L +KYL + LTI
Sbjct  256  EVQFVVLDEADQMLQVGFAEDVETILEKLPVKRQTMMFSATMPNWIRGLTQKYLKDFLTI  315

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI L++I T    K +I+  LI  +A
Sbjct  316  DLVGDSDQKLADGITLFSIVTEMYGKASIIGPLITEHA  353



>ref|XP_010551735.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X3 [Tarenaya hassleriana]
Length=915

 Score =   264 bits (675),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 131/214 (61%), Positives = 159/214 (74%), Gaps = 7/214 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRL--PRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+ + GR   P  LVLAPTRE
Sbjct  153  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNSKHGRRRNPLCLVLAPTRE  207

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE  ESAP L T C+ GG    +Q   L  GVDV VGTPGR+IDL+   +L L 
Sbjct  208  LARQVEKEFHESAPTLATICLYGGTPISSQMRELDYGVDVAVGTPGRIIDLMKRGALNLS  267

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE ILEKLP  RQSM+FSATMPSW++ L +KYL +PLTI
Sbjct  268  EVQFMVLDEADQMLQVGFAEDVETILEKLPLNRQSMMFSATMPSWIRGLTQKYLKDPLTI  327

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLI  638
            DLVGD ++KLA+GI LY+I T    K +I+  L+
Sbjct  328  DLVGDSDQKLADGITLYSIVTDMYGKASIIGPLV  361



>ref|XP_010551734.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X2 [Tarenaya hassleriana]
Length=938

 Score =   264 bits (675),  Expect = 1e-78, Method: Composition-based stats.
 Identities = 131/214 (61%), Positives = 159/214 (74%), Gaps = 7/214 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRL--PRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+ + GR   P  LVLAPTRE
Sbjct  153  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNSKHGRRRNPLCLVLAPTRE  207

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE  ESAP L T C+ GG    +Q   L  GVDV VGTPGR+IDL+   +L L 
Sbjct  208  LARQVEKEFHESAPTLATICLYGGTPISSQMRELDYGVDVAVGTPGRIIDLMKRGALNLS  267

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE ILEKLP  RQSM+FSATMPSW++ L +KYL +PLTI
Sbjct  268  EVQFMVLDEADQMLQVGFAEDVETILEKLPLNRQSMMFSATMPSWIRGLTQKYLKDPLTI  327

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLI  638
            DLVGD ++KLA+GI LY+I T    K +I+  L+
Sbjct  328  DLVGDSDQKLADGITLYSIVTDMYGKASIIGPLV  361



>ref|XP_010551733.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X1 [Tarenaya hassleriana]
Length=980

 Score =   264 bits (675),  Expect = 2e-78, Method: Composition-based stats.
 Identities = 131/214 (61%), Positives = 159/214 (74%), Gaps = 7/214 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRL--PRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+ + GR   P  LVLAPTRE
Sbjct  153  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----KFNSKHGRRRNPLCLVLAPTRE  207

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE  ESAP L T C+ GG    +Q   L  GVDV VGTPGR+IDL+   +L L 
Sbjct  208  LARQVEKEFHESAPTLATICLYGGTPISSQMRELDYGVDVAVGTPGRIIDLMKRGALNLS  267

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF EDVE ILEKLP  RQSM+FSATMPSW++ L +KYL +PLTI
Sbjct  268  EVQFMVLDEADQMLQVGFAEDVETILEKLPLNRQSMMFSATMPSWIRGLTQKYLKDPLTI  327

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLI  638
            DLVGD ++KLA+GI LY+I T    K +I+  L+
Sbjct  328  DLVGDSDQKLADGITLYSIVTDMYGKASIIGPLV  361



>ref|XP_010688871.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Beta 
vulgaris subsp. vulgaris]
Length=614

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 162/217 (75%), Gaps = 6/217 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRIT-EDEQSKFSQRRGRLPRVLVLAPTREL  179
            L PA +GRD+I RA+TGTGKTLAFGIPI+ +IT ++E++      GR P  LVLAPTREL
Sbjct  134  LEPAFQGRDMIGRARTGTGKTLAFGIPIMDKITRQNEKNGV----GRDPLALVLAPTREL  189

Query  180  AKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGE  359
            A+QVEKE  ES+  L+T C+ GG     Q SALSRGVDVV GTPGR+IDLI   +L L  
Sbjct  190  ARQVEKEFYESS-KLDTLCVYGGTPIARQMSALSRGVDVVAGTPGRVIDLIKRGALDLSR  248

Query  360  VQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTID  539
            VQ++VLDEADQML VGFEEDVEVILEKLP  RQ+M+FSATMP+W+ KL +KYL +PL ID
Sbjct  249  VQFVVLDEADQMLNVGFEEDVEVILEKLPKNRQTMMFSATMPNWIMKLTKKYLKDPLMID  308

Query  540  LVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            LVGD ++KLAEGI L ++     +K  ++  L   YA
Sbjct  309  LVGDSDQKLAEGISLCSVVVDRRAKAGVIGPLFTEYA  345



>gb|KDP21988.1| hypothetical protein JCGZ_02878 [Jatropha curcas]
Length=645

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 158/218 (72%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITE--DEQSKFSQRRGRLPRVLVLAPTRE  176
            L PA++GRD+  RA+TGTGKTLAFGIPI+ +I +  D+  K     GR P  LV+APTRE
Sbjct  149  LEPAMKGRDLFGRARTGTGKTLAFGIPIMDQIIQFNDKHGK-----GRNPLALVMAPTRE  203

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QV KE  ESAP+L+T C+ GG   V Q   L  G DVVVGTPGR+IDL+   SL L 
Sbjct  204  LARQVAKEFTESAPNLDTICLYGGTPLVRQMKELDYGTDVVVGTPGRIIDLMKRGSLNLS  263

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF +D+E I ++LP  RQSMLFSATMPSW+K L R YL +PLTI
Sbjct  264  EVQFVVLDEADQMLGVGFVDDIETIFQRLPKNRQSMLFSATMPSWIKNLVRNYLKDPLTI  323

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD + KLA+GI LY + +   +K +IL  LI  +A
Sbjct  324  DLVGDSDRKLADGITLYRVASDMYAKASILGPLITEHA  361



>ref|XP_006658271.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like, partial 
[Oryza brachyantha]
Length=602

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 161/216 (75%), Gaps = 4/216 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+I RA+TGTGKTLAFGIPI+ RI    +   S   GR P  ++LAPTRELA
Sbjct  112  LEPAMQGKDMIGRARTGTGKTLAFGIPIMDRIIRYNEKNGS---GRNPLAIILAPTRELA  168

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE KESAP L++ C+ GGV    Q   L+ GVDVVVGTPGR+IDL+    L L E+
Sbjct  169  RQVEKEFKESAP-LDSLCVYGGVPISHQMRVLNYGVDVVVGTPGRIIDLLRRGVLNLSEI  227

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDE DQMLAVGF+EDVEVI+E LP  RQSMLFSATMPSW++K+  KYL +P+ IDL
Sbjct  228  QFVVLDEVDQMLAVGFDEDVEVIMENLPQNRQSMLFSATMPSWIRKITNKYLKDPVIIDL  287

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KL EGI LY+I +    K +IL  LI  +A
Sbjct  288  VGDADQKLPEGISLYSIASEHYGKPSILGPLIKEHA  323



>ref|XP_002502509.1| DEAD/DEAH box RNA helicase [Micromonas sp. RCC299]
 gb|ACO63767.1| DEAD/DEAH box RNA helicase [Micromonas sp. RCC299]
Length=790

 Score =   260 bits (665),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PAL+GRD++ RA+TGTGKTL F +PII+ +  +  ++    R R PR +VLAPTRELA
Sbjct  164  LEPALQGRDVVGRARTGTGKTLGFSLPIIESLLSNPSNRTD--RSRNPRCIVLAPTRELA  221

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
             QVEKEI+ + P L T C+ GGV+   QE  L RGVD+VVGTPGRLIDLI   SL L ++
Sbjct  222  NQVEKEIQATVPSLRTLCVYGGVAISNQERPLRRGVDIVVGTPGRLIDLIQRGSLNLHDI  281

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +Y VLDEADQMLAVGFEEDVE I+E++P QRQ+ LFSATMPSWV ++ +KYL + +TIDL
Sbjct  282  EYCVLDEADQMLAVGFEEDVERIMEEIPEQRQTFLFSATMPSWVTRITQKYLADHVTIDL  341

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG +E+K+A+ I + +   + TS+ TIL+DL+ VY 
Sbjct  342  VGSQEQKVADTIDVMSCACSHTSRTTILADLVTVYG  377



>ref|XP_010323935.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
53-like [Solanum lycopersicum]
Length=611

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 162/218 (74%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++G D+I RA+TGTGKTLAFGIPI+ +I      +F+++  RGR P  L+LAPTRE
Sbjct  128  LEPAMQGSDMIGRARTGTGKTLAFGIPIMDKII-----RFNEKHGRGRNPLALILAPTRE  182

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQV+KE  ESAP L+T C+ GGV    Q S+L RGVDVVVGTPGR+IDL+   +L L 
Sbjct  183  LAKQVDKEFFESAPGLDTLCVYGGVPISRQMSSLDRGVDVVVGTPGRIIDLLKRGALNLA  242

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQML VGF EDVE ILE +P + Q+++FSATMPSW+ K+  K+L NP+ I
Sbjct  243  EIQFVVLDEADQMLNVGFAEDVETILENVPQKHQTLMFSATMPSWILKITNKFLKNPVHI  302

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI L++I      K  IL  LI  +A
Sbjct  303  DLVGDSDQKLADGISLFSIACDMHQKPAILGPLITEHA  340



>ref|NP_001147777.1| nucleolar RNA helicase 2 [Zea mays]
 gb|ACG28689.1| nucleolar RNA helicase 2 [Zea mays]
Length=613

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 165/216 (76%), Gaps = 4/216 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+I RA+TGTGKTLAFGIPI+ +I    +   +   GR P  ++LAPTRELA
Sbjct  126  LEPAMQGKDMIGRARTGTGKTLAFGIPIMDKILSYNEKNGN---GRNPLAIILAPTRELA  182

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +ESAP L+T C+ GGV    Q  AL+ GVD+VVGTPGR+IDL+    L L ++
Sbjct  183  RQVEKEFRESAP-LDTLCVYGGVPINQQMRALNYGVDIVVGTPGRVIDLLRRGVLNLSQI  241

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQMLAVGF+EDVEVI+E+LP  RQSMLFSATMPSW++K++ KYL +P+ IDL
Sbjct  242  QFVVLDEADQMLAVGFDEDVEVIMEQLPQNRQSMLFSATMPSWIRKISNKYLKDPVIIDL  301

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KL EGI LY+I +    K +I+  LI  +A
Sbjct  302  VGDSDQKLPEGISLYSIASDNFGKPSIIGPLIKEHA  337



>emb|CDP16079.1| unnamed protein product [Coffea canephora]
Length=653

 Score =   257 bits (656),  Expect = 1e-77, Method: Composition-based stats.
 Identities = 128/218 (59%), Positives = 162/218 (74%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      +F+++  RGR P  +VLAPTRE
Sbjct  150  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII-----RFNEKHGRGRNPLAIVLAPTRE  204

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QV+KE  ESAP L+T C+ GG     Q S L RGVDVVVGTPGR+IDLI   +L L 
Sbjct  205  LARQVDKEFYESAPSLDTLCVYGGTPISRQMSTLDRGVDVVVGTPGRVIDLIKRGALNLS  264

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQML VGF EDVE ILE +  + Q+M+FSATMP W+ K+ RK+L NP+ I
Sbjct  265  EIQFVVLDEADQMLNVGFAEDVETILENIRQEHQTMMFSATMPGWIMKITRKFLKNPVEI  324

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLAEGI L+AI +    K +IL  LI  +A
Sbjct  325  DLVGDSDQKLAEGISLFAIASEMHQKPSILGPLITEHA  362



>ref|XP_007146300.1| hypothetical protein PHAVU_006G028900g [Phaseolus vulgaris]
 gb|ESW18294.1| hypothetical protein PHAVU_006G028900g [Phaseolus vulgaris]
Length=577

 Score =   253 bits (647),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 160/216 (74%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ RI    Q      RG+ P  +VLAPTRELA
Sbjct  122  LEPAMQGRDMIGRARTGTGKTLAFGIPILDRII---QLNAKHGRGKDPLAMVLAPTRELA  178

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L+T C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L +V
Sbjct  179  RQVEKEFNEAAPNLDTICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRRALNLKDV  238

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMP W+K + R YLNNPLTIDL
Sbjct  239  KFVVLDEADQMLQVGFQEAVEKILENLSPNRQTLMFSATMPPWIKTITRNYLNNPLTIDL  298

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I +   +K  IL  LI  +A
Sbjct  299  VGDSDQKLADGISLYSIVSDMRTKAGILVPLITEHA  334



>gb|EYU43163.1| hypothetical protein MIMGU_mgv1a003141mg [Erythranthe guttata]
Length=569

 Score =   253 bits (646),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 162/218 (74%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+++  +G+ P  L+LAPTRE
Sbjct  131  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII-----KFNEKHGQGKNPLALILAPTRE  185

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQV+KE  E+AP L+T C+ GGV    Q S L  GVD++VGTPGR+IDLI   SL L 
Sbjct  186  LAKQVDKEFAEAAPKLDTLCVYGGVPISRQMSTLDHGVDIIVGTPGRVIDLIKRGSLNLK  245

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ+LVLDEADQML VGF +DVE IL  +  + Q+M+FSATMP+W+ +L +K+L NPLT+
Sbjct  246  EVQFLVLDEADQMLNVGFADDVETILGFITQKHQTMMFSATMPNWILRLTQKFLKNPLTV  305

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I      K+ I+  LI  +A
Sbjct  306  DLVGDSDQKLADGISLYSIAADMREKQAIIGSLITEHA  343



>ref|XP_002323192.2| hypothetical protein POPTR_0016s02340g [Populus trichocarpa]
 gb|EEF04953.2| hypothetical protein POPTR_0016s02340g [Populus trichocarpa]
Length=624

 Score =   254 bits (649),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+  RA+TGTGKTLAFGIPI+ +I    Q      RGR P  +V+APTRELA
Sbjct  132  LEPAMQGKDMFGRARTGTGKTLAFGIPILDKIL---QFNAQHGRGRYPLGIVMAPTRELA  188

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +E+AP L+  C+ GG     Q   L  GVDVVVGTPGR+IDL+   SL L EV
Sbjct  189  RQVEKEFREAAPSLDITCLYGGTPISQQMRDLEYGVDVVVGTPGRIIDLMKRGSLVLSEV  248

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF +D+E IL  +P +R SM FSATMPSW+++L RKYL +PLTIDL
Sbjct  249  QHVVLDEADQMLGVGFVDDIETILSSVPQKRHSMCFSATMPSWIRELVRKYLKDPLTIDL  308

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLAEGI LY+I +   +K +IL  LI  +A
Sbjct  309  VGDSDKKLAEGITLYSIASDLYAKASILGPLITEHA  344



>ref|XP_011085434.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Sesamum 
indicum]
Length=647

 Score =   254 bits (649),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 126/218 (58%), Positives = 163/218 (75%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+++  +GR P  ++LAPTRE
Sbjct  128  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII-----KFNEKHGQGRNPLAIILAPTRE  182

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QV+KE  ESAP L+T C+ GGV    Q S L RGVDV+VGTPGR+IDLI   +L L 
Sbjct  183  LARQVDKEFAESAPRLDTLCVYGGVPISRQMSTLDRGVDVIVGTPGRVIDLIKRGALNLS  242

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF +DVE IL  +  + Q+M+FSATMPSW+ KL RK+L +P+TI
Sbjct  243  EVQFVVLDEADQMLNVGFADDVETILGYITQKHQTMMFSATMPSWIVKLTRKFLKDPVTI  302

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVG+ ++KLA+GI LYAI +    K  I+  LI  +A
Sbjct  303  DLVGESDQKLADGISLYAITSDIREKPAIIGPLITEHA  340



>gb|EYU43162.1| hypothetical protein MIMGU_mgv1a003141mg [Erythranthe guttata]
Length=605

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 162/218 (74%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+++  +G+ P  L+LAPTRE
Sbjct  131  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII-----KFNEKHGQGKNPLALILAPTRE  185

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQV+KE  E+AP L+T C+ GGV    Q S L  GVD++VGTPGR+IDLI   SL L 
Sbjct  186  LAKQVDKEFAEAAPKLDTLCVYGGVPISRQMSTLDHGVDIIVGTPGRVIDLIKRGSLNLK  245

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ+LVLDEADQML VGF +DVE IL  +  + Q+M+FSATMP+W+ +L +K+L NPLT+
Sbjct  246  EVQFLVLDEADQMLNVGFADDVETILGFITQKHQTMMFSATMPNWILRLTQKFLKNPLTV  305

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I      K+ I+  LI  +A
Sbjct  306  DLVGDSDQKLADGISLYSIAADMREKQAIIGSLITEHA  343



>ref|XP_011010099.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Populus 
euphratica]
 ref|XP_011010100.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Populus 
euphratica]
Length=613

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D+  RA+TGTGKTLAFGIPI+ +I    Q      RGR P  +V+APTRELA
Sbjct  132  LEPAMQGKDMFGRARTGTGKTLAFGIPILDKIL---QFNAQHGRGRYPLGMVMAPTRELA  188

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE +E+AP L+  C+ GG     Q   L  GVDVVVGTPGR+IDL+   SL L EV
Sbjct  189  RQVEKEFREAAPSLDITCLYGGTPISRQMRDLEYGVDVVVGTPGRMIDLMKRGSLVLSEV  248

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEADQML VGF +D+E IL  +P +R SM FSATMPSW+++L RKYL +PLTIDL
Sbjct  249  QHVVLDEADQMLGVGFVDDIETILLSVPRKRHSMCFSATMPSWIRELVRKYLKDPLTIDL  308

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLAEGI LY+I +   +K +IL  LI  +A
Sbjct  309  VGDSDKKLAEGITLYSIASDLYAKASILGPLITEHA  344



>ref|XP_003530710.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Glycine 
max]
Length=605

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+  I    Q      +GR P  LVLAPTRELA
Sbjct  119  LEPAMQGRDMIGRARTGTGKTLAFGIPILDSII---QFNAKHGQGRHPLALVLAPTRELA  175

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L   C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L  V
Sbjct  176  RQVEKEFNEAAPNLAMICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKNV  235

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  236  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  295

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  296  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  331



>gb|KHM99686.1| DEAD-box ATP-dependent RNA helicase 53 [Glycine soja]
Length=605

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 159/216 (74%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+  I    Q      +GR P  LVLAPTRELA
Sbjct  119  LEPAMQGRDMIGRARTGTGKTLAFGIPILDSII---QFNAKHGQGRHPLALVLAPTRELA  175

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            +QVEKE  E+AP+L   C+ GG+    Q   L+ GVD+ VGTPGR+IDL+N  +L L  V
Sbjct  176  RQVEKEFNEAAPNLAMICLYGGMPIQQQMRQLNYGVDIAVGTPGRIIDLLNRGALNLKNV  235

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML VGF+E VE ILE L   RQ+++FSATMPSW+K + R YLNNPLTIDL
Sbjct  236  KFVVLDEADQMLQVGFQEAVEKILEGLSPNRQTLMFSATMPSWIKNITRNYLNNPLTIDL  295

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I + + +K  IL+ LI  +A
Sbjct  296  VGDSDQKLADGISLYSIVSDSYTKAGILAPLITEHA  331



>ref|XP_006352957.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006352958.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like isoform 
X2 [Solanum tuberosum]
Length=630

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 161/218 (74%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++G D+I RA+TGTGKTLAFGIPI+ +I      +F+++  RGR P  L+LAPTRE
Sbjct  128  LEPAMQGSDMIGRARTGTGKTLAFGIPIMDKII-----RFNEKHGRGRNPLALILAPTRE  182

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQVEKE  ESAP L+T C+ GGV    Q S+L RGVDVVVGTPGR+IDL+   +L L 
Sbjct  183  LAKQVEKEFFESAPGLDTLCVYGGVPISRQMSSLDRGVDVVVGTPGRIIDLLKRGALNLA  242

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQML VGF EDVE ILE +P + Q+++FSATMPSW+ K+  K+L N + I
Sbjct  243  EIQFVVLDEADQMLNVGFAEDVETILESVPQKHQTLMFSATMPSWILKITNKFLKNAVHI  302

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI L++I      K  +L  LI  +A
Sbjct  303  DLVGDSDQKLADGISLFSIACDMHQKPAVLGPLITEHA  340



>ref|XP_003056927.1| DEAD/DEAH box RNA helicase [Micromonas pusilla CCMP1545]
 gb|EEH58572.1| DEAD/DEAH box RNA helicase [Micromonas pusilla CCMP1545]
Length=803

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 158/215 (73%), Gaps = 4/215 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PALEGRDI+ RA+TGTGKTL F +PII+ +     S  S  R R PR +VLAPTRELA
Sbjct  175  LAPALEGRDIVGRARTGTGKTLGFSLPIIESLL----SNPSDARNRRPRCIVLAPTRELA  230

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
             QVE EI+ + P + T C+ GGV+   QE AL  GVD VVGTPGRLIDLI   SL+L ++
Sbjct  231  NQVEAEIQLTVPSMRTVCVYGGVAITNQERALRNGVDFVVGTPGRLIDLIQRGSLQLQDI  290

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +Y VLDEADQMLAVGFEEDVE I++++P +RQ+ LFSATMPSWVK+L RKYL   + IDL
Sbjct  291  EYCVLDEADQMLAVGFEEDVERIMQEIPEERQTFLFSATMPSWVKQLTRKYLKEHVNIDL  350

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVY  647
            VGD ++K+A+ I + +   +  S+  IL+DL+ VY
Sbjct  351  VGDSKQKVADTIDILSCACSHQSRTMILADLVTVY  385



>ref|XP_009787018.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Nicotiana 
sylvestris]
Length=632

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 158/218 (72%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++G D+I RA+TGTGKTLAFGIPI+ +I      KF+ +  RGR P  L+LAPTRE
Sbjct  136  LEPAMQGSDMIGRARTGTGKTLAFGIPIMDKII-----KFNNKKGRGRNPLALILAPTRE  190

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE  ESAP L+T C+ GGV    Q S L RG D+VVGTPGR+IDL+   SL L 
Sbjct  191  LARQVEKEFYESAPGLDTLCVYGGVPIQRQMSTLQRGADIVVGTPGRIIDLLKRRSLNLS  250

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQML VGF EDVE ILE +  + Q+M+FSATMPSW+ K+  K+L  P+ I
Sbjct  251  EIQFVVLDEADQMLNVGFAEDVETILENVRQKHQTMMFSATMPSWIMKITNKFLKKPIHI  310

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I      K  +L  LI+ +A
Sbjct  311  DLVGDSDQKLADGISLYSIACEMRQKPAVLGPLISEHA  348



>ref|XP_009593230.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like [Nicotiana 
tomentosiformis]
Length=633

 Score =   252 bits (644),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 158/218 (72%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++G D+I RA+TGTGKTLAFGIPI+ +I      KF+ +  RGR P  L+LAPTRE
Sbjct  137  LEPAMQGSDMIGRARTGTGKTLAFGIPIMDKII-----KFNNKKGRGRNPLALILAPTRE  191

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE  ESAP L+T C+ GGV    Q S L RG D+VVGTPGR+IDL+   SL L 
Sbjct  192  LARQVEKEFYESAPVLDTLCVYGGVPIQRQMSTLQRGADIVVGTPGRIIDLLKRGSLNLS  251

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQML VGF EDVE ILE +  + Q+M+FSATMPSW+ K+  K+L  P+ I
Sbjct  252  EIQFVVLDEADQMLNVGFAEDVETILENVRQKHQTMMFSATMPSWIMKITNKFLKKPIHI  311

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI LY+I      K  +L  LI+ +A
Sbjct  312  DLVGDSDQKLADGISLYSIACEMRQKPAVLGPLISEHA  349



>ref|XP_009591168.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Nicotiana 
tomentosiformis]
Length=646

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 161/218 (74%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++G D+I RA+TGTGKTLAFGIPI+ +I      +F+++  RGR P  +VLAPTRE
Sbjct  130  LEPAMQGSDMIGRARTGTGKTLAFGIPIMDKII-----RFNEKHGRGRNPLAIVLAPTRE  184

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQV+KE  ESAP L+T C+ GGV    Q S+L RGVD++VGTPGR+IDL+   +L L 
Sbjct  185  LAKQVDKEFFESAPGLDTLCVYGGVPISRQMSSLDRGVDIIVGTPGRVIDLLKRGALNLS  244

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQML VGF EDVE ILE +  + Q+M+FSATMPSW+ K+  K+L NP+ I
Sbjct  245  EIQFVVLDEADQMLNVGFAEDVETILENVRQKHQTMMFSATMPSWILKITNKFLKNPIHI  304

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI L++I      K  +L  LI  +A
Sbjct  305  DLVGDSDQKLADGISLFSIACEMHQKPAVLGPLITEHA  342



>ref|XP_004963159.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like [Setaria 
italica]
Length=618

 Score =   251 bits (640),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 165/216 (76%), Gaps = 4/216 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++G+D++ RAKTGTGKTLAFGIPI+  I      K+  + G+ P  +VLAPTRELA
Sbjct  128  LEPAMQGKDMVGRAKTGTGKTLAFGIPIMDAIIR-HNDKY--KPGKFPLAIVLAPTRELA  184

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVE+E  ES+P L T C+ GG     Q   L  GVDVV+GTPGR+IDL+   SL L E+
Sbjct  185  KQVEREFIESSP-LETLCVYGGTPISQQIRKLGYGVDVVIGTPGRVIDLLKRGSLSLAEI  243

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML+VGF++DVE IL+++P QRQ+++FSATMP+W++KL +KYLNNP+T+DL
Sbjct  244  RFVVLDEADQMLSVGFDQDVETILQQVPQQRQTLMFSATMPTWIRKLTQKYLNNPVTVDL  303

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG++++KLAEGI L++I T    K  +L +LI  +A
Sbjct  304  VGEDDQKLAEGISLFSIATENREKPAVLGELIKEHA  339



>ref|XP_009771005.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Nicotiana 
sylvestris]
Length=643

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 161/218 (74%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQR--RGRLPRVLVLAPTRE  176
            L PA++G D+I RA+TGTGKTLAFGIPI+ +I      +F+++  RGR P  +VLAPTRE
Sbjct  130  LEPAMQGSDMIGRARTGTGKTLAFGIPIMDKII-----RFNEKHGRGRNPLAIVLAPTRE  184

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LAKQV+KE  ESAP L+T C+ GGV    Q S+L RGVD++VGTPGR+IDL+   +L L 
Sbjct  185  LAKQVDKEFFESAPGLDTLCVYGGVPISRQMSSLDRGVDIIVGTPGRVIDLLKRGALNLS  244

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQML VGF EDVE ILE +  + Q+M+FSATMPSW+ K+  K+L NP+ I
Sbjct  245  EIQFVVLDEADQMLNVGFAEDVETILENVRQKHQTMMFSATMPSWILKITNKFLKNPIHI  304

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLA+GI L++I      K  +L  LI  +A
Sbjct  305  DLVGDSDQKLADGISLFSIVCEMHQKPAVLGPLITEHA  342



>ref|XP_009388962.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Musa 
acuminata subsp. malaccensis]
Length=644

 Score =   251 bits (641),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 165/218 (76%), Gaps = 8/218 (4%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRG--RLPRVLVLAPTRE  176
            L PA++G+D+I RA+TGTGKTLAFGIPI+ +I      +F  + G  R P  +VLAPTRE
Sbjct  139  LEPAMQGQDMIGRARTGTGKTLAFGIPIMDKII-----RFQAKHGCGRNPLAMVLAPTRE  193

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE KES+  L T C+ GG     Q  AL+ GVDVVVGTPGR+IDL+N  +L L 
Sbjct  194  LARQVEKEFKESS-KLYTLCVYGGSPINEQMRALNYGVDVVVGTPGRIIDLLNRGALNLS  252

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQML VGF EDVE IL+K+P +RQ+M+FSATMP+W++KL R+YL +P+ I
Sbjct  253  EIQFVVLDEADQMLNVGFAEDVERILDKMPPKRQTMMFSATMPTWIRKLTRRYLKDPVNI  312

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLAEGI LY+I +   +K +IL  LI  +A
Sbjct  313  DLVGDSDQKLAEGITLYSIVSDNYAKPSILGPLIKEHA  350



>gb|EPS73227.1| hypothetical protein M569_01530, partial [Genlisea aurea]
Length=583

 Score =   248 bits (634),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/218 (56%), Positives = 160/218 (73%), Gaps = 7/218 (3%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRG--RLPRVLVLAPTRE  176
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I      KF+++ G  R P  LVLAPTRE
Sbjct  122  LEPAMQGRDMIGRARTGTGKTLAFGIPIMDKII-----KFNEKHGSGRNPLALVLAPTRE  176

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE  ESAP L+T C+ GGV    Q S L RGVD V+GTPGR+IDLI   +L L 
Sbjct  177  LARQVEKEFAESAPKLDTLCVYGGVPISRQMSTLDRGVDAVIGTPGRVIDLIKRGALNLS  236

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            EVQ++VLDEADQML VGF +DVE IL  +  + Q+++FSATMP+W+ +L +K+L NP+TI
Sbjct  237  EVQFVVLDEADQMLNVGFADDVETILGFMKQKHQTLMFSATMPNWILRLTQKFLKNPVTI  296

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVG+ ++KLA+GI L++I +    K  I+  L   +A
Sbjct  297  DLVGESDQKLADGISLFSIASDVREKPAIIGPLFTAHA  334



>ref|XP_008647316.1| PREDICTED: uncharacterized protein LOC100501766 isoform X1 [Zea 
mays]
 ref|XP_008647322.1| PREDICTED: uncharacterized protein LOC100501766 isoform X1 [Zea 
mays]
 tpg|DAA47481.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
isoform 1 [Zea mays]
 tpg|DAA47482.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
isoform 2 [Zea mays]
Length=611

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 164/216 (76%), Gaps = 4/216 (2%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD++ RAKTGTGKTLAFGIPI+  I    +     + G+ P  +VLAPTRELA
Sbjct  125  LEPAMQGRDMVGRAKTGTGKTLAFGIPIMDAIIRHNEK---YKPGKFPLAIVLAPTRELA  181

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQVE+E  +S+P L T C+ GG   + Q   L+ GVDVV+GTPGR+IDL+   SL L E+
Sbjct  182  KQVEREFLDSSP-LETLCVYGGTPIMQQIRKLNYGVDVVIGTPGRVIDLLKRGSLSLAEI  240

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            +++VLDEADQML+VGF+ DVE ILE++P QRQ+++FSATMP+W++KL +KYLNNP+T+DL
Sbjct  241  RFVVLDEADQMLSVGFDLDVETILERVPPQRQTLMFSATMPTWIRKLTQKYLNNPVTVDL  300

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VG++++KLAEGI L A+ +    K  +L +LI  +A
Sbjct  301  VGEDDQKLAEGISLLAVSSENREKPAVLGELIKEHA  336



>ref|XP_004303914.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 53-like [Fragaria 
vesca subsp. vesca]
Length=606

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/216 (57%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELA  182
            L PA++GRD+I RA+TGTGKTLAFGIPI+ +I    +      RGR P  LV+APTRELA
Sbjct  125  LEPAMQGRDMIGRARTGTGKTLAFGIPILDKII---RYNAKHGRGRNPLALVMAPTRELA  181

Query  183  KQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEV  362
            KQV+KE +E+AP L+T C+ GG    +Q   L  G DV VGTPGR+IDLI+  +L L EV
Sbjct  182  KQVDKEFQEAAPGLDTICLYGGTPIGSQIGQLGYGTDVAVGTPGRIIDLIDRGALNLSEV  241

Query  363  QYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDL  542
            Q++VLDEAD+ML VGF+E VE IL  +P QRQ++LFSATMP +++ L +KYLNNP  IDL
Sbjct  242  QFIVLDEADEMLKVGFQEAVEQILRSVPKQRQTLLFSATMPPFIRSLTQKYLNNPAVIDL  301

Query  543  VGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            VGD ++KLA+GI LY+I   +  K +IL  LI  +A
Sbjct  302  VGDNDQKLADGITLYSIAADSYGKGSILGPLITEHA  337



>ref|XP_009388961.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 9-like [Musa acuminata 
subsp. malaccensis]
Length=654

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 163/218 (75%), Gaps = 8/218 (4%)
 Frame = +3

Query  3    LIPALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRG--RLPRVLVLAPTRE  176
            L PA++G+D+I RA+TGTGKTLAFGIPI+ +I      +F  + G  R P  +VLAPTRE
Sbjct  138  LEPAMQGQDMIGRARTGTGKTLAFGIPIMDKII-----RFQAKHGCGRNPLAMVLAPTRE  192

Query  177  LAKQVEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLG  356
            LA+QVEKE KES+  L T C+ GG     Q  AL  GVDVVVGTPGR+IDL+N  +L L 
Sbjct  193  LARQVEKEFKESS-KLYTLCVYGGSLISQQMRALDSGVDVVVGTPGRIIDLLNRGALNLS  251

Query  357  EVQYLVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTI  536
            E+Q++VLDEADQML VGF EDVE ILEK+P + Q+++FSATMP+W++KL RKYL +P+ I
Sbjct  252  EIQFVVLDEADQMLNVGFAEDVERILEKMPPKHQTLMFSATMPTWIQKLTRKYLKDPVNI  311

Query  537  DLVGDEEEKLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            DLVGD ++KLAEGI LY+I +   +K +IL  LI  +A
Sbjct  312  DLVGDSDQKLAEGITLYSIVSDNYAKASILGPLIKEHA  349



>ref|XP_005642988.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE18444.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=674

 Score =   250 bits (638),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/215 (56%), Positives = 159/215 (74%), Gaps = 2/215 (1%)
 Frame = +3

Query  9    PALEGRDIIARAKTGTGKTLAFGIPIIKRITEDEQSKFSQRRGRLPRVLVLAPTRELAKQ  188
            PA  GRD+I RA+TG+GKTLAF +P+++ + + E S+   +RGR PR ++LAPTRELAKQ
Sbjct  82   PARAGRDLIGRARTGSGKTLAFALPVLENLLK-ENSQSPPQRGRSPRCIILAPTRELAKQ  140

Query  189  VEKEIKESAPHLNTACICGGVSYVTQESALSRGVDVVVGTPGRLIDLINNNSLKLGEVQY  368
            VEKE +ESAP LN  C  GGV    Q   L  GVDV VGTPGR+IDLIN N L L   ++
Sbjct  141  VEKEFQESAPGLNVGCFYGGVDIGGQIRQLRSGVDVAVGTPGRVIDLINRNCLDLSLTRF  200

Query  369  LVLDEADQMLAVGFEEDVEVILEKLPSQRQSMLFSATMPSWVKKLARKYLNNPLTIDLVG  548
            ++LDEAD ML++GF EDVE+IL+ +P++RQ+MLFSATMPSWVK + RK+L NP  +DLVG
Sbjct  201  VILDEADMMLSMGFSEDVEIILDSVPAERQTMLFSATMPSWVKNITRKHLKNPALVDLVG  260

Query  549  DEEE-KLAEGIKLYAIPTTATSKRTILSDLIAVYA  650
            D +  K+ + IK  A+  T  ++R+IL DLI V+A
Sbjct  261  DAQSGKMPDAIKTMAVHVTQEARRSILVDLITVHA  295



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250