BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF041N24

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009801460.1|  PREDICTED: pentatricopeptide repeat-containi...    173   1e-46   Nicotiana sylvestris
ref|XP_009601923.1|  PREDICTED: pentatricopeptide repeat-containi...    169   3e-45   Nicotiana tomentosiformis
ref|XP_011090005.1|  PREDICTED: pentatricopeptide repeat-containi...    155   2e-40   Sesamum indicum [beniseed]
ref|XP_004237182.2|  PREDICTED: pentatricopeptide repeat-containi...    147   1e-37   Solanum lycopersicum
emb|CDP07966.1|  unnamed protein product                                139   1e-34   Coffea canephora [robusta coffee]
ref|XP_011021681.1|  PREDICTED: pentatricopeptide repeat-containi...    132   5e-32   Populus euphratica
gb|EYU36097.1|  hypothetical protein MIMGU_mgv1a020159mg                130   8e-32   Erythranthe guttata [common monkey flower]
ref|XP_009351650.1|  PREDICTED: pentatricopeptide repeat-containi...    130   2e-31   Pyrus x bretschneideri [bai li]
ref|XP_008350824.1|  PREDICTED: pentatricopeptide repeat-containi...    128   6e-31   
ref|XP_008340510.1|  PREDICTED: pentatricopeptide repeat-containi...    128   9e-31   Malus domestica [apple tree]
ref|XP_002314741.2|  hypothetical protein POPTR_0010s10900g             127   1e-30   
ref|XP_008220989.1|  PREDICTED: pentatricopeptide repeat-containi...    127   2e-30   Prunus mume [ume]
ref|XP_007015128.1|  Pentatricopeptide repeat superfamily protein...    126   7e-30   
ref|XP_002521865.1|  pentatricopeptide repeat-containing protein,...    123   2e-29   
ref|XP_002269531.1|  PREDICTED: pentatricopeptide repeat-containi...    124   2e-29   Vitis vinifera
ref|XP_002273494.2|  PREDICTED: pentatricopeptide repeat-containi...    124   3e-29   Vitis vinifera
ref|XP_002312498.2|  hypothetical protein POPTR_0008s14240g             124   4e-29   
ref|XP_011025175.1|  PREDICTED: pentatricopeptide repeat-containi...    120   7e-28   Populus euphratica
ref|XP_006420692.1|  hypothetical protein CICLE_v10004581mg             119   1e-27   Citrus clementina [clementine]
gb|KDO57832.1|  hypothetical protein CISIN_1g007461mg                   119   1e-27   Citrus sinensis [apfelsine]
ref|XP_006470889.1|  PREDICTED: pentatricopeptide repeat-containi...    119   1e-27   Citrus sinensis [apfelsine]
ref|XP_010547300.1|  PREDICTED: pentatricopeptide repeat-containi...    117   8e-27   Tarenaya hassleriana [spider flower]
ref|XP_010270795.1|  PREDICTED: pentatricopeptide repeat-containi...    117   1e-26   Nelumbo nucifera [Indian lotus]
ref|XP_004151188.1|  PREDICTED: pentatricopeptide repeat-containi...    114   8e-26   Cucumis sativus [cucumbers]
ref|XP_004172063.1|  PREDICTED: pentatricopeptide repeat-containi...    114   9e-26   
ref|XP_004298632.1|  PREDICTED: pentatricopeptide repeat-containi...    114   2e-25   Fragaria vesca subsp. vesca
gb|AFK45134.1|  unknown                                                 107   1e-24   Lotus japonicus
ref|XP_003529243.2|  PREDICTED: pentatricopeptide repeat-containi...    111   1e-24   Glycine max [soybeans]
ref|XP_007153172.1|  hypothetical protein PHAVU_003G013000g             110   2e-24   Phaseolus vulgaris [French bean]
ref|XP_008778816.1|  PREDICTED: pentatricopeptide repeat-containi...    110   3e-24   Phoenix dactylifera
ref|XP_008465506.1|  PREDICTED: pentatricopeptide repeat-containi...    109   5e-24   Cucumis melo [Oriental melon]
ref|XP_003555735.1|  PREDICTED: pentatricopeptide repeat-containi...    109   5e-24   Glycine max [soybeans]
gb|KEH40726.1|  PPR containing plant-like protein                       108   1e-23   Medicago truncatula
gb|KHN38588.1|  Pentatricopeptide repeat-containing protein, chlo...    108   1e-23   Glycine soja [wild soybean]
ref|XP_010043883.1|  PREDICTED: pentatricopeptide repeat-containi...    107   3e-23   Eucalyptus grandis [rose gum]
ref|XP_010668078.1|  PREDICTED: pentatricopeptide repeat-containi...    102   1e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004498165.1|  PREDICTED: pentatricopeptide repeat-containi...    102   1e-21   Cicer arietinum [garbanzo]
ref|XP_009400607.1|  PREDICTED: pentatricopeptide repeat-containi...  98.6    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS59551.1|  hypothetical protein M569_15254                       93.6    6e-19   Genlisea aurea
ref|XP_004976594.1|  PREDICTED: pentatricopeptide repeat-containi...  89.7    5e-17   Setaria italica
emb|CCI55317.1|  PH01B001I13.13                                       88.2    2e-16   Phyllostachys edulis [kikko-chiku]
ref|XP_006399876.1|  hypothetical protein EUTSA_v10016019mg           87.0    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_002871585.1|  pentatricopeptide repeat-containing protein      86.7    4e-16   Arabidopsis lyrata subsp. lyrata
ref|NP_001174064.1|  Os04g0583150                                     85.5    1e-15   
ref|XP_003580383.1|  PREDICTED: pentatricopeptide repeat-containi...  84.3    2e-15   Brachypodium distachyon [annual false brome]
ref|NP_196881.2|  pentatricopeptide repeat-containing protein         84.0    4e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10598.1|  unnamed protein product                              83.2    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006853735.1|  hypothetical protein AMTR_s00056p00173630        83.2    7e-15   Amborella trichopoda
gb|KFK25604.1|  hypothetical protein AALP_AA8G136200                  82.4    1e-14   Arabis alpina [alpine rockcress]
gb|EAY95290.1|  hypothetical protein OsI_17116                        81.3    3e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_006652694.1|  PREDICTED: pentatricopeptide repeat-containi...  80.5    5e-14   Oryza brachyantha
gb|EMT31983.1|  hypothetical protein F775_29312                       79.7    9e-14   
ref|XP_006387490.1|  hypothetical protein POPTR_0970s00010g           77.0    9e-14   
gb|ACG27989.1|  hypothetical protein                                  77.8    5e-13   Zea mays [maize]
emb|CDX91096.1|  BnaC02g05010D                                        76.6    1e-12   
tpg|DAA36322.1|  TPA: hypothetical protein ZEAMMB73_184989            75.9    2e-12   
ref|XP_007222296.1|  hypothetical protein PRUPE_ppa003348mg           75.9    2e-12   
ref|XP_010453475.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  75.1    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010492155.1|  PREDICTED: pentatricopeptide repeat-containi...  74.7    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006289562.1|  hypothetical protein CARUB_v10003108mg           72.8    2e-11   Capsella rubella
ref|XP_009125945.1|  PREDICTED: pentatricopeptide repeat-containi...  72.8    2e-11   Brassica rapa
emb|CBI27495.3|  unnamed protein product                              72.4    2e-11   Vitis vinifera
emb|CBI24106.3|  unnamed protein product                              69.7    2e-10   Vitis vinifera
ref|XP_008778815.1|  PREDICTED: pentatricopeptide repeat-containi...  57.4    9e-07   
gb|KJB35743.1|  hypothetical protein B456_006G126500                  56.6    4e-06   Gossypium raimondii
ref|XP_009768784.1|  PREDICTED: pentatricopeptide repeat-containi...  50.1    6e-04   Nicotiana sylvestris



>ref|XP_009801460.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nicotiana sylvestris]
Length=641

 Score =   173 bits (438),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 83/154 (54%), Positives = 108/154 (70%), Gaps = 9/154 (6%)
 Frame = +2

Query  197  ARSSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSP---------LPEPEDFNALIC  349
            A+SSSCS+PVLE ++   P+ +   IELDL+LQD   +          L + +D N LIC
Sbjct  66   AKSSSCSSPVLEEKSQKIPSKNSKIIELDLELQDYTTTTTNGTTTSTCLTDSKDLNGLIC  125

Query  350  TLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHV  529
            +LLKDP T GIG++YYEKAK N  F P++STL LL+RY + S  WGSI  L +D R+  +
Sbjct  126  SLLKDPQTQGIGYDYYEKAKENTDFRPEKSTLKLLIRYLVYSNKWGSIISLCEDLRSSQI  185

Query  530  LPDGSTCCRLISSCVRARKFKIVNSLLESLIDYD  631
            LPD STCC+LI+SC++ARKFKIVN+LLE  I YD
Sbjct  186  LPDSSTCCKLITSCIKARKFKIVNNLLEVFILYD  219



>ref|XP_009601923.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nicotiana tomentosiformis]
Length=619

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 107/150 (71%), Gaps = 5/150 (3%)
 Frame = +2

Query  197  ARSSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLP-----EPEDFNALICTLLK  361
            A+SSSCS+PVLE ++  TP+ +   IELDL+LQD   +P       + +D N LIC+LLK
Sbjct  48   AKSSSCSSPVLEEKSQKTPSKNSKIIELDLELQDYTTTPTTSTCLTDSKDLNGLICSLLK  107

Query  362  DPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDG  541
            DP T GIG++YYEKAK N  F P++STL LL+RY + S  WGSI  L +D R+  +LPD 
Sbjct  108  DPQTQGIGYDYYEKAKENTDFRPEKSTLKLLIRYLVYSNKWGSIISLCEDLRSSQILPDS  167

Query  542  STCCRLISSCVRARKFKIVNSLLESLIDYD  631
            STCC+ I+SC++ARKFKIVN+LLE  I  D
Sbjct  168  STCCKFITSCIKARKFKIVNNLLEVFIISD  197



>ref|XP_011090005.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Sesamum indicum]
Length=621

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 102/148 (69%), Gaps = 12/148 (8%)
 Frame = +2

Query  197  ARSSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDF---NALICTLLKDP  367
            A SS+CS PVLE  A        P IEL L+LQD  P+    PED+   NALIC+LLKD 
Sbjct  57   ADSSACSPPVLEDNA--------PVIELALKLQDFQPAD-HLPEDYKESNALICSLLKDS  107

Query  368  HTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGST  547
             TA +G+EYYEKAKG P F P+R+TL LLVRY + S+NWG +    +D + F VLPD ST
Sbjct  108  ETAHLGYEYYEKAKGKPNFRPRRNTLKLLVRYLIRSKNWGLLFSFCEDLQVFRVLPDRST  167

Query  548  CCRLISSCVRARKFKIVNSLLESLIDYD  631
            CCRLIS+C++ARK ++VN+LLE  +  D
Sbjct  168  CCRLISACLKARKLRVVNNLLEVFLVND  195



>ref|XP_004237182.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Solanum lycopersicum]
Length=642

 Score =   147 bits (372),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 77/145 (53%), Positives = 98/145 (68%), Gaps = 8/145 (6%)
 Frame = +2

Query  221  PVL-EHQASSTPNNSQPTIEL-DL-QLQDLCPS-----PLPEPEDFNALICTLLKDPHTA  376
            PVL E ++  TP+ S   IEL DL Q+QD   +      LP+ +D N +IC+LLKD  T 
Sbjct  75   PVLDEKKSQKTPSKSSQVIELLDLEQIQDFSSTTNGTTSLPDSKDLNGVICSLLKDTQTQ  134

Query  377  GIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCR  556
             IG++YYEKAKG   F P++STL LL+RY ++S  WGS+  L +D R   VLPD STCCR
Sbjct  135  EIGYDYYEKAKGEKDFRPEKSTLKLLIRYLVNSSKWGSVFSLSKDLRTLKVLPDSSTCCR  194

Query  557  LISSCVRARKFKIVNSLLESLIDYD  631
            LISSC+++RKFKIVNS LE  I  D
Sbjct  195  LISSCMKSRKFKIVNSFLELFIVVD  219



>emb|CDP07966.1| unnamed protein product [Coffea canephora]
Length=615

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 102/141 (72%), Gaps = 7/141 (5%)
 Frame = +2

Query  197  ARSSSCSA-PVLEHQASSTPNNSQPTIELDLQLQDLCP--SPLPEPEDFNALICTLLKDP  367
            A+SSSCS+ PVLE  +S+T     P I+LDL+LQDL    S LPE ED N LIC L +D 
Sbjct  51   AKSSSCSSVPVLEDASSTT----SPVIQLDLKLQDLDDQVSSLPETEDLNGLICALFEDS  106

Query  368  HTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGST  547
             T  + ++YYE+AK  P F P++ TL L++RY ++SRNWG +  L +DF++F VLPDGST
Sbjct  107  RTEELAYDYYERAKDKPDFRPKKLTLKLVIRYLINSRNWGLLYSLCEDFKSFQVLPDGST  166

Query  548  CCRLISSCVRARKFKIVNSLL  610
            C RLISSC RARKFK+VN LL
Sbjct  167  CYRLISSCSRARKFKLVNILL  187



>ref|XP_011021681.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like isoform X1 [Populus euphratica]
Length=613

 Score =   132 bits (331),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 94/144 (65%), Gaps = 5/144 (3%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPE-PEDFNALICTLLKDPHTAG  379
            SS C +P+LE +  ST   + P I+LDL+L+D    P+P+ P+  N  +C +L+DP +  
Sbjct  50   SSRCPSPILEEEPIST---NSPVIQLDLKLEDTQRYPIPDHPDKLNDFLCGVLQDPRSEE  106

Query  380  IGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRL  559
            + +EYY+KAK  P F PQR  L LL+RY + S  WG +S +  DF+ ++V PD  T   L
Sbjct  107  LAYEYYKKAKEKPEFRPQRLVLKLLIRYLIQSDKWGLVSSVADDFKKYNVFPDSFTFSTL  166

Query  560  ISSCVRARKFKIVNSLLESLIDYD  631
            +SSC+RAR+FKIV +LLE+   YD
Sbjct  167  VSSCIRARRFKIVENLLENF-KYD  189



>gb|EYU36097.1| hypothetical protein MIMGU_mgv1a020159mg [Erythranthe guttata]
Length=573

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 9/143 (6%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            ++SCS+P++E  A++        IEL L  QD   SP  + +  NALICTL KDP T  +
Sbjct  9    AASCSSPLVEDAAAAV-------IELSLNPQDF-NSP-RDHKQLNALICTLFKDPQTENL  59

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
             H+YY+KAK +P F P+R TL LL+RY   S NW S+    QD   F VLPD  TCCRLI
Sbjct  60   AHDYYQKAKSDPDFRPERYTLKLLIRYLTRSNNWTSLFSFCQDLAQFRVLPDRPTCCRLI  119

Query  563  SSCVRARKFKIVNSLLESLIDYD  631
            ++C++ARK K+V++LL+  +  D
Sbjct  120  TTCMKARKLKLVDNLLDCFLSND  142



>ref|XP_009351650.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Pyrus x bretschneideri]
Length=608

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 89/130 (68%), Gaps = 3/130 (2%)
 Frame = +2

Query  233  HQASSTPNNSQPTIELDLQLQ---DLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEK  403
            H+  +  + + P +ELD++LQ   + CP+P P+ +D N L+C L ++P T    +E YEK
Sbjct  50   HRVFNVNSTNFPVVELDIKLQKSQEKCPAPSPDADDLNNLLCRLFQNPQTEDYAYEEYEK  109

Query  404  AKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRAR  583
            A+    F P +STL  L+R+ + S+ WG  +L+ +DF+ ++V+PDG TC RL++SC+RAR
Sbjct  110  ARKKAEFRPNKSTLEQLIRHLIRSKKWGLFTLVCEDFKNYNVVPDGYTCSRLVTSCIRAR  169

Query  584  KFKIVNSLLE  613
            KFKIV +LL+
Sbjct  170  KFKIVRTLLD  179



>ref|XP_008350824.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like, partial [Malus domestica]
Length=585

 Score =   128 bits (322),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 81/124 (65%), Gaps = 3/124 (2%)
 Frame = +2

Query  266  PTIELDLQLQ---DLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQR  436
            P IELDL+LQ   + CP+P P  ED N  IC L ++P T    +++YEKA+  P F P +
Sbjct  61   PVIELDLKLQNSPEECPAPTPGAEDSNDFICGLFQNPQTEECAYDHYEKARKKPEFRPNK  120

Query  437  STLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLES  616
            STL  L+RY + S  WG    + +DF+ + V+PDG TC RL++SC+RARKFKIV  LL+ 
Sbjct  121  STLEQLIRYLIRSNKWGLFISVFEDFKNYEVVPDGYTCSRLVTSCIRARKFKIVRILLDV  180

Query  617  LIDY  628
              D+
Sbjct  181  FSDH  184



>ref|XP_008340510.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Malus domestica]
Length=608

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 84/119 (71%), Gaps = 3/119 (3%)
 Frame = +2

Query  266  PTIELDLQLQ---DLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQR  436
            P +ELD++LQ   + CP+P P+ +D N L+C L ++P T    +E YEKA+    F P +
Sbjct  61   PVVELDIKLQKSPEECPAPSPDADDLNNLLCRLFQNPQTEDYAYEEYEKARKKAEFRPNK  120

Query  437  STLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLE  613
            STL  L+R+ + S+ WG  +L+ +DF+ ++V+PDG TC RL++SC+RARKFKIV +LL+
Sbjct  121  STLEQLIRHLIRSKKWGLFTLVCEDFKNYNVVPDGYTCSRLVTSCIRARKFKIVRTLLD  179



>ref|XP_002314741.2| hypothetical protein POPTR_0010s10900g [Populus trichocarpa]
 gb|EEF00912.2| hypothetical protein POPTR_0010s10900g [Populus trichocarpa]
Length=582

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 90/138 (65%), Gaps = 4/138 (3%)
 Frame = +2

Query  209  SCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPE-PEDFNALICTLLKDPHTAGIG  385
            +C +P+LE +  ST   + P I+LDL+L+D    P+P+ P+  N  +C +L+DP +  + 
Sbjct  21   NCPSPILEEEPIST---NFPVIQLDLKLEDTQRYPIPDHPDKLNDFLCGVLQDPKSEELA  77

Query  386  HEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLIS  565
            +EYY+KAK  P F PQR  L LL+RY + S  WG +  L  DF+ ++V PD  T   L+S
Sbjct  78   YEYYKKAKEKPEFRPQRPVLKLLIRYLIQSDKWGLVLSLADDFKKYNVFPDSFTFSTLVS  137

Query  566  SCVRARKFKIVNSLLESL  619
            SC+RAR+FKIV +LLE+ 
Sbjct  138  SCIRARRFKIVENLLENF  155



>ref|XP_008220989.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Prunus mume]
 ref|XP_008220990.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Prunus mume]
Length=615

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 89/143 (62%), Gaps = 14/143 (10%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSP-----LPEPEDFNALICTLLKDP  367
            SS C +P+LE +AS+T     P IELDL+     P P      P+ ++ N  +C L +D 
Sbjct  53   SSGCHSPILEDEASTTL----PVIELDLKF----PDPREEFSTPDADNLNDFLCGLFQDR  104

Query  368  HTAGIGHEYYEKAKGN-PGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGS  544
             T    +E YEKAK   P FIP +ST   L+RY + S+ WGS+  +  DF+ +HVLPD  
Sbjct  105  QTEEFAYEQYEKAKKKRPEFIPNKSTFEHLIRYLIRSKKWGSMLSVCDDFKNYHVLPDSH  164

Query  545  TCCRLISSCVRARKFKIVNSLLE  613
            TC RLI+SC+RARKFK+V +LLE
Sbjct  165  TCSRLIASCIRARKFKMVRTLLE  187



>ref|XP_007015128.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
 gb|EOY32747.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma 
cacao]
Length=608

 Score =   126 bits (316),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 90/137 (66%), Gaps = 5/137 (4%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS C +P+LE  +++ P+      +L+L+ Q      LP+ ++ N+ +  LL+D     +
Sbjct  50   SSGCPSPILEDASTNVPST-----KLELKFQGSQQFSLPDLDNLNSFLRGLLQDTQNERL  104

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
             ++YYEKAK  PGFIP++  L LL+RY + S+ W  +  L +DF+ +HVLPD  TC RLI
Sbjct  105  AYDYYEKAKRRPGFIPEKPMLQLLIRYLVQSKKWDLVMSLSEDFKHYHVLPDSYTCSRLI  164

Query  563  SSCVRARKFKIVNSLLE  613
            ++C+RARKFK+V +LL+
Sbjct  165  NACIRARKFKVVGTLLQ  181



>ref|XP_002521865.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF40501.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=449

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 86/137 (63%), Gaps = 5/137 (4%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            +SSC +P+LE      P+ + P I+LD ++Q+     +P+ +  N  +C +L+DP T  +
Sbjct  51   ASSCPSPILEE-----PSTNFPVIQLDFRVQNSQEYQIPDSKSLNKFLCGILRDPRTEHL  105

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
             +EYY+KA     F P +  L LL+RY M S+NW  I  +  DF  ++VLPD +TC RL+
Sbjct  106  AYEYYKKATERQEFRPDKPMLKLLIRYLMQSKNWDLILPVADDFNKYNVLPDSNTCSRLV  165

Query  563  SSCVRARKFKIVNSLLE  613
             SC++ RKF+IV SLLE
Sbjct  166  YSCIKTRKFRIVESLLE  182



>ref|XP_002269531.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Vitis vinifera]
Length=603

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 87/137 (64%), Gaps = 6/137 (4%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            +SS S+P++  +  ST ++  P IELD++L DL P    + E+ N  +C L +DP +  +
Sbjct  46   NSSYSSPIVAEE--STHDHHLPVIELDVELPDLTP----KDENLNDFLCGLFRDPRSEEL  99

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
              +YY+K K  P F P + TL  ++RY + S+ WG   L+ +DF++F    DG  CCRLI
Sbjct  100  AFDYYQKVKERPEFRPDKETLERIIRYLIRSKKWGLSLLVFEDFKSFDAQLDGDICCRLI  159

Query  563  SSCVRARKFKIVNSLLE  613
            SSC+RARKF+I  SLLE
Sbjct  160  SSCIRARKFRITESLLE  176



>ref|XP_002273494.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Vitis vinifera]
Length=609

 Score =   124 bits (311),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 88/137 (64%), Gaps = 5/137 (4%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            +SS S+P++  + S+  ++  P IELD++L DL P    + E+ N  +C L +DP +  +
Sbjct  46   NSSYSSPIVAEE-STHDHHHLPVIELDVELPDLTP----KDENLNDFLCGLFRDPRSEEL  100

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
              +YY+K K  P F P + TL  ++RY + S+ WG   L+ +DF++F V  DG  CCRLI
Sbjct  101  AFDYYQKVKERPEFRPDKETLERIIRYLIRSKKWGLSLLVFEDFKSFDVQLDGDICCRLI  160

Query  563  SSCVRARKFKIVNSLLE  613
            SSC+RARKF+I  SLLE
Sbjct  161  SSCIRARKFRITESLLE  177



>ref|XP_002312498.2| hypothetical protein POPTR_0008s14240g [Populus trichocarpa]
 gb|EEE89865.2| hypothetical protein POPTR_0008s14240g [Populus trichocarpa]
Length=603

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 88/138 (64%), Gaps = 5/138 (4%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPED-FNALICTLLKDPHTAG  379
            SSSC +P++E ++S+    + P I LDL+L+D    P+P+  D  N  +C +L+DP +  
Sbjct  50   SSSCPSPIIEEESST----NSPVIPLDLRLEDTQHYPIPDHSDKLNDFLCGVLRDPKSEE  105

Query  380  IGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRL  559
            + +EYY+KAK    F P+R  L LL+RY + S  WG +  +  DF+ + VLPD  T   L
Sbjct  106  LAYEYYKKAKEKQEFRPKRPMLKLLIRYLIQSEKWGLVLPVADDFKKYSVLPDSYTFSTL  165

Query  560  ISSCVRARKFKIVNSLLE  613
            +SSC+RARKFKIV  LLE
Sbjct  166  VSSCIRARKFKIVEGLLE  183



>ref|XP_011025175.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Populus euphratica]
Length=603

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 87/138 (63%), Gaps = 5/138 (4%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPED-FNALICTLLKDPHTAG  379
            SSS  +P++E ++S+    + P I LDL+L+D    P+P+  D  N  +C +L+DP +  
Sbjct  50   SSSFPSPIIEEESST----NSPVIPLDLRLEDTQHYPIPDHSDKLNDFLCGVLRDPKSEE  105

Query  380  IGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRL  559
            + +EYY+KAK    F P+R  L LL+RY + S  WG I  +  DF+ + VLPD  T   L
Sbjct  106  LAYEYYKKAKEKQEFRPERPMLKLLIRYLIQSEKWGLILSVADDFKKYSVLPDSYTFSTL  165

Query  560  ISSCVRARKFKIVNSLLE  613
            +SSC+RARKFK+V  LLE
Sbjct  166  VSSCIRARKFKVVEGLLE  183



>ref|XP_006420692.1| hypothetical protein CICLE_v10004581mg [Citrus clementina]
 gb|ESR33932.1| hypothetical protein CICLE_v10004581mg [Citrus clementina]
Length=603

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 81/119 (68%), Gaps = 2/119 (2%)
 Frame = +2

Query  266  PTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTL  445
            PTIEL+        + +P+ + F++ +  +LKDP T  + ++YY +AK  P F P++STL
Sbjct  63   PTIELNRDSHH--QTAVPDAKKFDSFLHGMLKDPQTQELAYDYYNEAKKLPEFRPEKSTL  120

Query  446  NLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLESLI  622
             LL+RY + S+ W SI  L +DF+ ++VLPD  TC RL++SCVRARKFKI N+LL+  I
Sbjct  121  KLLIRYLVQSKKWDSIVSLSEDFKIYNVLPDAHTCSRLVASCVRARKFKIANTLLQVFI  179



>gb|KDO57832.1| hypothetical protein CISIN_1g007461mg [Citrus sinensis]
Length=603

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 81/119 (68%), Gaps = 2/119 (2%)
 Frame = +2

Query  266  PTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTL  445
            PTIEL+        + +P+ + F++ +  +LKDP T  + ++YY +AK  P F P++STL
Sbjct  63   PTIELNRDSHH--QTAVPDAKKFDSFLHGMLKDPQTQELAYDYYNEAKKLPEFRPEKSTL  120

Query  446  NLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLESLI  622
             LL+RY + S+ W SI  L +DF+ ++VLPD  TC RL++SCVRARKFKI N+LL+  I
Sbjct  121  KLLIRYLVQSKKWDSIVSLSEDFKIYNVLPDAHTCSRLVASCVRARKFKIANTLLQVFI  179



>ref|XP_006470889.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Citrus sinensis]
Length=603

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 81/119 (68%), Gaps = 2/119 (2%)
 Frame = +2

Query  266  PTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTL  445
            PTIEL+        + +P+ + F++ +  +LKDP T  + ++YY +AK  P F P++STL
Sbjct  63   PTIELNRDSHH--QTAVPDAKKFDSFLHGMLKDPQTQELAYDYYNEAKKLPEFRPEKSTL  120

Query  446  NLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLESLI  622
             LL+RY + S+ W SI  L +DF+ ++VLPD  TC RL++SCVRARKFKI N+LL+  I
Sbjct  121  KLLIRYLVQSKKWDSIVSLSEDFKIYNVLPDAHTCSRLVASCVRARKFKIANTLLQVFI  179



>ref|XP_010547300.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Tarenaya hassleriana]
Length=632

 Score =   117 bits (294),  Expect = 8e-27, Method: Composition-based stats.
 Identities = 60/147 (41%), Positives = 87/147 (59%), Gaps = 24/147 (16%)
 Frame = +2

Query  203  SSSCSAPVLEHQA---------SSTPNN--SQPTIELDLQLQDLCPSPLPEPEDFNALIC  349
            SS CS+PVL+ +          S+ P+N  S+P  E             P P+D N ++ 
Sbjct  50   SSRCSSPVLDEEEKKPMNPLRISTVPDNEDSRPLFE-------------PGPDDLNRVLT  96

Query  350  TLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHV  529
            +LL+DP T  + + YYEKAK +  F P+  T+  L+RY M+S NW S+  L +D + ++V
Sbjct  97   SLLRDPETRELAYSYYEKAKESEEFRPRTETMKHLIRYLMNSNNWDSVLSLCEDLKKYNV  156

Query  530  LPDGSTCCRLISSCVRARKFKIVNSLL  610
             PDG TC +LISSCVRA+KF+I + LL
Sbjct  157  FPDGYTCSKLISSCVRAKKFRIASHLL  183



>ref|XP_010270795.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Nelumbo nucifera]
Length=636

 Score =   117 bits (293),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 62/138 (45%), Positives = 82/138 (59%), Gaps = 5/138 (4%)
 Frame = +2

Query  206  SSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIG  385
            S C +P+LE  ++S       TIE   +  DL     P+ E+ N  +  LL D  T  + 
Sbjct  50   SFCPSPLLEDDSTSVK-----TIEPQQKFPDLEQCRGPKLENPNVFLRGLLNDRRTEALA  104

Query  386  HEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLIS  565
             EYY+KAK  P F P+ STL LL+RY + S+ W SISL+ +DF+AF V PD  T  RL+ 
Sbjct  105  FEYYQKAKIQPEFRPESSTLQLLIRYLLRSKKWSSISLISEDFKAFSVFPDRITSSRLVG  164

Query  566  SCVRARKFKIVNSLLESL  619
            SC+RARKFK   +LLES 
Sbjct  165  SCIRARKFKTAKALLESF  182



>ref|XP_004151188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cucumis sativus]
 gb|KGN49761.1| hypothetical protein Csa_5G114580 [Cucumis sativus]
Length=608

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 81/137 (59%), Gaps = 5/137 (4%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS C +P+LE      P+ + P I  +  L D     LP  +D N  +C L ++P T  +
Sbjct  46   SSGCPSPILEQ-----PSIALPDIHSNSNLHDFQLPSLPNVQDLNDFLCGLSQNPGTEDL  100

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
             ++YY KAK   GF PQ+STL  L+RY +  + W  I L+ +DF  F V PD  TC +L+
Sbjct  101  IYDYYVKAKETAGFRPQKSTLRHLIRYLVRLKKWDLILLVSRDFVDFGVCPDRDTCSKLV  160

Query  563  SSCVRARKFKIVNSLLE  613
            SSCVR RKFK+V SLLE
Sbjct  161  SSCVRGRKFKVVKSLLE  177



>ref|XP_004172063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cucumis sativus]
Length=608

 Score =   114 bits (286),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 81/137 (59%), Gaps = 5/137 (4%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS C +P+LE      P+ + P I  +  L D     LP  +D N  +C L ++P T  +
Sbjct  46   SSGCPSPILEQ-----PSIALPDIHSNSNLHDFQLPSLPNVQDLNDFLCGLSQNPGTEDL  100

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
             ++YY KAK   GF PQ+STL  L+RY +  + W  I L+ +DF  F V PD  TC +L+
Sbjct  101  IYDYYVKAKETAGFRPQKSTLRHLIRYLVRLKKWDLILLVSRDFVDFGVCPDRDTCSKLV  160

Query  563  SSCVRARKFKIVNSLLE  613
            SSCVR RKFK+V SLLE
Sbjct  161  SSCVRGRKFKVVKSLLE  177



>ref|XP_004298632.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Fragaria vesca subsp. vesca]
Length=604

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 9/137 (7%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SSSC +P+LE Q+S+  +       +DL+LQ       P+    N  +C L +DP    +
Sbjct  52   SSSCPSPILEDQSSTNLS------LIDLKLQQ---HQTPDAGKLNEFLCELFQDPEKEAM  102

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
            G+E YEKAK    F P +STL  + RY + S+ W SI  +  DF+ + +LPD  TC RL+
Sbjct  103  GYEQYEKAKKVAEFRPNKSTLEHVTRYLVRSKKWDSILSVCTDFKTYDLLPDRYTCSRLV  162

Query  563  SSCVRARKFKIVNSLLE  613
            +SC+RARKFK+V +LL+
Sbjct  163  TSCIRARKFKVVRTLLQ  179



>gb|AFK45134.1| unknown [Lotus japonicus]
Length=208

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 85/145 (59%), Gaps = 9/145 (6%)
 Frame = +2

Query  197  ARSSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPL----PEPEDFNALICTLLKD  364
            A SS+   P+LE  +    N++ P +++D  + ++  S      P  E+ N  +C L +D
Sbjct  46   ANSSASPTPILEEAS----NSNTPMLDVD-NVNNIAGSHQQYSNPGTENLNEFLCGLFQD  100

Query  365  PHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGS  544
            P T  +  +YY++ K  P F P++STL  ++RY M  + W  I  + +DF+ +HVLPDG+
Sbjct  101  PKTEELAFDYYQRLKDRPVFRPEKSTLKHVIRYLMRFKKWDFILSVSEDFKIYHVLPDGA  160

Query  545  TCCRLISSCVRARKFKIVNSLLESL  619
            TC +LI  C+R RKFKI  +LL + 
Sbjct  161  TCSKLIEFCIRQRKFKIAETLLNAF  185



>ref|XP_003529243.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
Length=631

 Score =   111 bits (278),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 53/140 (38%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  197  ARSSSCSAPVLEHQASS-TPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHT  373
            A  S+   P+LE + SS TP      +  D+Q Q       PEPE+ N  +C L +DP T
Sbjct  70   ANFSASPTPILEEEPSSNTPIIHVVDVNFDVQQQ----YSKPEPENLNEFLCGLFEDPKT  125

Query  374  AGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCC  553
              +  +YY++ K  P F P++ TL  ++RY +S ++W SI  +  DF+ +HVLPD +TC 
Sbjct  126  KELAFDYYQRLKERPEFRPEKPTLKHVIRYLVSLKSWDSILSVSDDFKVYHVLPDRATCS  185

Query  554  RLISSCVRARKFKIVNSLLE  613
            RL+  C+  RKF++  +LL+
Sbjct  186  RLVKFCIEHRKFRVAEALLD  205



>ref|XP_007153172.1| hypothetical protein PHAVU_003G013000g [Phaseolus vulgaris]
 gb|ESW25166.1| hypothetical protein PHAVU_003G013000g [Phaseolus vulgaris]
Length=609

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 81/139 (58%), Gaps = 5/139 (4%)
 Frame = +2

Query  206  SSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIG  385
            S+   P+LE + S+TP      I LD+   D+     PE E+ N  +C L +D  T  + 
Sbjct  52   SASRTPILEEEPSNTP-----IIHLDVNFADVQQYSKPEAENLNEFLCGLFEDSKTRELA  106

Query  386  HEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLIS  565
             +YY++ K  P F P++STL  ++RY MS + W  I  + +DF+ +HVLPD +TC R+I 
Sbjct  107  FDYYQRLKERPEFRPEKSTLRHVIRYLMSLKQWDLILSVSEDFKVYHVLPDRATCSRVIK  166

Query  566  SCVRARKFKIVNSLLESLI  622
             C+  RKF++ + LL+  +
Sbjct  167  FCIDRRKFRVADVLLDVFM  185



>ref|XP_008778816.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Phoenix dactylifera]
Length=614

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 72/121 (60%), Gaps = 0/121 (0%)
 Frame = +2

Query  257  NSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQR  436
            N  P I++        PSP+ + +  N  IC L + P T  +  EYY+KA+  P F P R
Sbjct  61   NGVPVIQVPSNSPARQPSPISDLDLTNEFICGLCRVPQTEALAFEYYQKARKQPKFHPDR  120

Query  437  STLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLES  616
             T NLL+R  +  + WGSIS L++DF  F++ PD S C RL+S CV+AR+FK+  SLL  
Sbjct  121  RTFNLLIRILLKHKQWGSISALVEDFGVFNLFPDRSMCTRLVSGCVKARRFKLAESLLRI  180

Query  617  L  619
            L
Sbjct  181  L  181



>ref|XP_008465506.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Cucumis melo]
Length=608

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 80/137 (58%), Gaps = 5/137 (4%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS   +P+LE      P+ + P I  +  L D    PL   ED N  +C L ++P T  +
Sbjct  46   SSGFPSPILEQ-----PSIALPDIHSNSNLHDFQLPPLSNVEDLNDFLCGLSQNPGTEDL  100

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
             ++YY KAK   GF P++STL  L+RY +  + W  I L+ +DF  F V PD  TC +L+
Sbjct  101  IYDYYVKAKERAGFRPEKSTLRHLIRYLVRLKKWDLIFLVSRDFVDFGVCPDRDTCSKLV  160

Query  563  SSCVRARKFKIVNSLLE  613
            SSCVR RKFK+V +LLE
Sbjct  161  SSCVRGRKFKVVKALLE  177



>ref|XP_003555735.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Glycine max]
 gb|KHM98995.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=609

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 86/151 (57%), Gaps = 15/151 (10%)
 Frame = +2

Query  197  ARSSSCSAPVLEHQASSTPNNSQPTI--------ELDLQLQDLCPSPLPEPEDFNALICT  352
            A  S+   P+LE + SS+   + PTI          D+Q Q       PEPE+ N  +C 
Sbjct  44   ANFSASPTPILEEEPSSS---NTPTIIHVVDVNFAADVQKQ----YSKPEPENLNEFLCG  96

Query  353  LLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVL  532
            L +DP T  +  +YY++ K  P F P++ TL  ++RY +S ++WGSI  + +DF+ +HVL
Sbjct  97   LFEDPKTKELAFDYYQRLKERPEFRPEKPTLKHVIRYLVSLKSWGSILSVSEDFKVYHVL  156

Query  533  PDGSTCCRLISSCVRARKFKIVNSLLESLID  625
            PD +TC RL+  C+  RKF++  SLL    D
Sbjct  157  PDRATCSRLVKFCIEHRKFRVAESLLYVFKD  187



>gb|KEH40726.1| PPR containing plant-like protein [Medicago truncatula]
Length=605

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 80/140 (57%), Gaps = 6/140 (4%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPE-PEDFNALICTLLKDPHTAG  379
            S+S   P+LE  +S+TP      I LD+   D      PE  ++ N  +C L +DP    
Sbjct  46   SASSHTPILEETSSNTP-----LIHLDVNFSDTTKYSKPEIDQNLNDFLCGLFEDPKKHE  100

Query  380  IGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRL  559
            +  +YY++ K  P F P +STLN ++RY +  + W     + +DF+ +HVLPD +TC +L
Sbjct  101  LAFDYYQRLKDRPEFRPMKSTLNHVIRYLLRFKKWEFFISVCEDFKVYHVLPDAATCSKL  160

Query  560  ISSCVRARKFKIVNSLLESL  619
            IS C++ RKFKI  + L++ 
Sbjct  161  ISFCIKNRKFKIAETFLDTF  180



>gb|KHN38588.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine 
soja]
Length=601

 Score =   108 bits (270),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 82/140 (59%), Gaps = 5/140 (4%)
 Frame = +2

Query  197  ARSSSCSAPVLEHQASS-TPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHT  373
            A  S+   P+LE + SS TP      +  D+Q Q       PEPE+ N  +C L +DP T
Sbjct  40   ANFSASPTPILEEEPSSNTPIIHVVDVNFDVQQQ----YSKPEPENLNEFLCGLFEDPKT  95

Query  374  AGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCC  553
              +  +YY++ K  P F P++ TL  ++RY +S ++W SI  +  DF+ +HVLPD +TC 
Sbjct  96   KELAFDYYQRLKERPEFRPEKPTLKHVIRYLVSLKSWDSILSVSDDFKVYHVLPDRATCS  155

Query  554  RLISSCVRARKFKIVNSLLE  613
            RL+  C+  RKF++  +LL+
Sbjct  156  RLVKFCIEHRKFRVAEALLD  175



>ref|XP_010043883.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Eucalyptus grandis]
 gb|KCW85901.1| hypothetical protein EUGRSUZ_B02618 [Eucalyptus grandis]
Length=615

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 79/138 (57%), Gaps = 5/138 (4%)
 Frame = +2

Query  206  SSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIG  385
            S+C +PVLE  + ++P+      + D    D    P  + E F+  +  L + P T    
Sbjct  50   SNCPSPVLEEHSGASPST-----QFDSPASDPLQGPTTDSESFDRFLRGLFEAPETEKFA  104

Query  386  HEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLIS  565
            +EYY KAK +P F P++ST++ L RY M  + W  I+ L  DF  ++V PD  TC RL+S
Sbjct  105  YEYYAKAKESPNFEPEKSTVDSLARYLMKEKKWDLIAGLSCDFEVYNVFPDKVTCARLVS  164

Query  566  SCVRARKFKIVNSLLESL  619
            +C+ ARKF++ + +LE L
Sbjct  165  NCIEARKFRVADGILEVL  182



>ref|XP_010668078.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Beta vulgaris subsp. vulgaris]
Length=617

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 70/111 (63%), Gaps = 5/111 (5%)
 Frame = +2

Query  302  CPSPLPEPEDF-----NALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYF  466
             P+   +P++F     N LI  LLKDP T  +G EYYEKAK +  F PQ++T   L+RY 
Sbjct  74   TPNSEFQPQNFDERNLNKLIRELLKDPRTEDLGFEYYEKAKSSSDFQPQKTTFKSLLRYL  133

Query  467  MSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLESL  619
            + S+ W  ISL+ +D + + +LPD   C R++S+C++ARK K+   LLES 
Sbjct  134  VKSKKWDLISLISRDMKMYQILPDKMFCARIVSTCIKARKSKVAYILLESF  184



>ref|XP_004498165.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cicer arietinum]
 ref|XP_004517308.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Cicer arietinum]
Length=632

 Score =   102 bits (255),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 53/144 (37%), Positives = 79/144 (55%), Gaps = 8/144 (6%)
 Frame = +2

Query  197  ARSSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCP---SPLPEPEDFNALICTLLKDP  367
            A  S+   P+LE  +S+TP      I LD+      P   S L   ++ N  +C L +D 
Sbjct  69   ANLSASHTPILEEPSSNTP-----LIHLDVNNFSSDPQQYSKLENDQNLNDFLCGLFEDQ  123

Query  368  HTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGST  547
                +  +YY++ K    FIP++STL  ++RY M  + W   S L  DF+ +HV PD +T
Sbjct  124  KKDELAFDYYQRLKERSEFIPKKSTLKYVIRYLMKFKKWEFFSSLSHDFKVYHVFPDVAT  183

Query  548  CCRLISSCVRARKFKIVNSLLESL  619
            C RLIS C++ RKFKI  +LL++ 
Sbjct  184  CSRLISFCIKNRKFKISETLLDAF  207



>ref|XP_009400607.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=614

 Score = 98.6 bits (244),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +2

Query  299  LCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSR  478
            L  SP    E  N  I  + ++  T  +  EYY+KAK  P F P R TL LL+R  + S+
Sbjct  76   LQASPAAGTEITNEFIQGVCRNLQTEAVAFEYYQKAKELPVFRPDRRTLKLLIRSLVKSK  135

Query  479  NWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLESL  619
             W SIS L+ D R F V+PD  TC RLI SC+RARKFK+  +LL  L
Sbjct  136  QWSSISALVDDLRFFGVVPDRFTCARLIGSCIRARKFKLAEALLGVL  182



>gb|EPS59551.1| hypothetical protein M569_15254, partial [Genlisea aurea]
Length=412

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 62/106 (58%), Gaps = 3/106 (3%)
 Frame = +2

Query  323  PEDF---NALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSI  493
             EDF   N LIC L +D  T  +G+E Y + KGN  F PQ  TL LLVR+ + +++W  +
Sbjct  2    SEDFGELNGLICGLFEDSATENLGYECYRRCKGNLNFTPQNRTLKLLVRHLIRNKDWSLL  61

Query  494  SLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLESLIDYD  631
                 D R+F +LP  S C +LISSCVR RK  +  S L+  ++ D
Sbjct  62   LSFCDDLRSFGILPGKSLCVKLISSCVRGRKLNLAYSFLDVFLEID  107



>ref|XP_004976594.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Setaria italica]
Length=607

 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 76/143 (53%), Gaps = 10/143 (7%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPE----DFNALICTLLKDPH  370
            S SC++P+LE      P  + P     +        PLP+        N  I     DP 
Sbjct  43   SRSCASPLLE------PTKNLPDEFPAVPAAAPVSPPLPDAALKLGISNKFIRGFCSDPQ  96

Query  371  TAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTC  550
            T  +  E Y +A   PGF+P++ T N L    + ++ WGS+ LL++DFRA+ VLP+  TC
Sbjct  97   TEQLAFECYRRALLQPGFLPEKKTANALTVQLLRAKQWGSLELLVEDFRAYGVLPEKRTC  156

Query  551  CRLISSCVRARKFKIVNSLLESL  619
             RL++ C+RAR+F + +++L  L
Sbjct  157  ARLVACCIRARQFGLADAVLGVL  179



>emb|CCI55317.1| PH01B001I13.13 [Phyllostachys edulis]
Length=636

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 77/143 (54%), Gaps = 11/143 (8%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCP-SPLPEPEDF---NALICTLLKDPH  370
            S SC++P+LE      P N    I+  + +    P SPLP+       N  I  L  D  
Sbjct  40   SRSCASPLLE------PKNLPDEIQ-TVSVSAPAPVSPLPDAPKLGISNKFIRGLCSDRQ  92

Query  371  TAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTC  550
            T  +  E Y +A   P F P++ T+N L    + ++ W S+ LL++DFRA+ VLP+  TC
Sbjct  93   TEQLAFECYRRALQQPEFRPEKKTVNALTVQLLRAKQWNSLELLVEDFRAYGVLPERRTC  152

Query  551  CRLISSCVRARKFKIVNSLLESL  619
             RL++SC++ARKF   + +L  L
Sbjct  153  ARLVASCIKARKFGFADVVLGVL  175



>ref|XP_006399876.1| hypothetical protein EUTSA_v10016019mg [Eutrema salsugineum]
 gb|ESQ41329.1| hypothetical protein EUTSA_v10016019mg [Eutrema salsugineum]
Length=611

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 72/136 (53%), Gaps = 15/136 (11%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS CS  VLE     +P++ Q          D  P   P P+  N ++  LL+DP T  +
Sbjct  42   SSRCSL-VLEEDEKKSPSSKQ----------DKWPFFEPVPDGLNLVLSRLLRDPETQKL  90

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
              E+YEKAK N        T   L+ Y ++++NW  +  L +D R ++ LPD  TC +LI
Sbjct  91   SSEFYEKAKENSEL----RTTKHLINYLVNAKNWDLLVSLCEDLREYNALPDAHTCSQLI  146

Query  563  SSCVRARKFKIVNSLL  610
             SC+R RKF++ + LL
Sbjct  147  RSCIRERKFRVAHCLL  162



>ref|XP_002871585.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47844.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=609

 Score = 86.7 bits (213),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 68/136 (50%), Gaps = 15/136 (11%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS CS  VLE     +P+  +          D  P   P P+D N ++   L+DP T  +
Sbjct  42   SSRCSM-VLEEDEKKSPSPKE----------DKWPFFEPGPDDLNRVLSRFLRDPETRKL  90

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
              E+YEKAK N        T   L+ Y +SS+NW  +  L +D R    LPD  TC  LI
Sbjct  91   SSEFYEKAKENSEL----RTTKHLINYLVSSKNWNLLVSLCEDLREHKALPDAQTCSNLI  146

Query  563  SSCVRARKFKIVNSLL  610
             SC+R RKF+I + LL
Sbjct  147  RSCIRERKFRITHCLL  162



>ref|NP_001174064.1| Os04g0583150 [Oryza sativa Japonica Group]
 emb|CAE04154.2| OSJNBa0088A01.11 [Oryza sativa Japonica Group]
 gb|EAZ31756.1| hypothetical protein OsJ_15910 [Oryza sativa Japonica Group]
 dbj|BAG89668.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH92792.1| Os04g0583150 [Oryza sativa Japonica Group]
Length=606

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 75/150 (50%), Gaps = 23/150 (15%)
 Frame = +2

Query  203  SSSCSAPVLE--------HQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDF---NALIC  349
            S SC++P+LE        H  S++     P             SPLP+       N  I 
Sbjct  41   SRSCASPLLEPKNLPDEFHAVSASTPAPVPV------------SPLPDAPKLGISNKFIR  88

Query  350  TLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHV  529
             L  D  T  +  E Y +A   P F+P + T+N L    + ++ W S+  L++DFRA+ V
Sbjct  89   GLCSDRQTEQLAFECYRRALHQPEFLPDKKTMNALTVQLLRAKQWSSLEFLVEDFRAYGV  148

Query  530  LPDGSTCCRLISSCVRARKFKIVNSLLESL  619
            +P+  TC RL++SCV+ARKF + + +L  L
Sbjct  149  MPERRTCARLVASCVKARKFGLADMVLGVL  178



>ref|XP_003580383.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Brachypodium distachyon]
Length=612

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 58/95 (61%), Gaps = 0/95 (0%)
 Frame = +2

Query  335  NALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDF  514
            N  I  L  D  T  +  E Y +A   P F P + T+N+L  + + ++ WGS+  L++DF
Sbjct  88   NKFIRGLCGDRQTEQLAFECYRRALQQPEFRPDKKTMNVLTVHLLRAKQWGSLEHLVEDF  147

Query  515  RAFHVLPDGSTCCRLISSCVRARKFKIVNSLLESL  619
             A+ VLP+  TC RL++SCVRARKF + ++LL  L
Sbjct  148  GAYAVLPERRTCARLVASCVRARKFGLADALLGVL  182



>ref|NP_196881.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
 sp|Q66GP4.1|PP379_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic; Flags: Precursor [Arabidopsis thaliana]
 gb|AAU05481.1| At5g13770 [Arabidopsis thaliana]
 gb|AAU95422.1| At5g13770 [Arabidopsis thaliana]
 gb|AED91939.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=609

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 69/136 (51%), Gaps = 15/136 (11%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS CS  VLE     +P+  +          D  P   P P D N ++   L+DP T  +
Sbjct  42   SSRCSM-VLEEDEKKSPSPKE----------DKWPFFEPGPNDLNRVLSRFLRDPETRKL  90

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
              E+YEKAK N     +  T   L+ Y +SS++W  +  + +D R    LPDG TC  LI
Sbjct  91   SSEFYEKAKENS----ELRTTKHLISYLVSSKSWDLLVSVCEDLREHKALPDGQTCSNLI  146

Query  563  SSCVRARKFKIVNSLL  610
             SC+R RKF+I + LL
Sbjct  147  RSCIRDRKFRITHCLL  162



>dbj|BAB10598.1| unnamed protein product [Arabidopsis thaliana]
Length=563

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 58/106 (55%), Gaps = 4/106 (4%)
 Frame = +2

Query  293  QDLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMS  472
            +D  P   P P D N ++   L+DP T  +  E+YEKAK N        T   L+ Y +S
Sbjct  15   EDKWPFFEPGPNDLNRVLSRFLRDPETRKLSSEFYEKAKENSEL----RTTKHLISYLVS  70

Query  473  SRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLL  610
            S++W  +  + +D R    LPDG TC  LI SC+R RKF+I + LL
Sbjct  71   SKSWDLLVSVCEDLREHKALPDGQTCSNLIRSCIRDRKFRITHCLL  116



>ref|XP_006853735.1| hypothetical protein AMTR_s00056p00173630 [Amborella trichopoda]
 gb|ERN15202.1| hypothetical protein AMTR_s00056p00173630 [Amborella trichopoda]
Length=616

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 65/114 (57%), Gaps = 2/114 (2%)
 Frame = +2

Query  275  ELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLL  454
            E+D  L +L  +P  + +  N  I  L ++  T  +  +YY+KAK  P F+P + T+N L
Sbjct  70   EIDGHLPNL-QAPKSKRQSLNKFIQGLFRNRQTETLAFDYYQKAKDQPEFLPDQFTVNAL  128

Query  455  VRYFMSSRNWGSIS-LLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLE  613
              + + ++ W      L+ D + F V PD   CCR++ +C++ARKFKI + LL+
Sbjct  129  AGFILRTKQWSLFEEFLVVDIKRFSVFPDDQICCRVLRTCIKARKFKITDLLLD  182



>gb|KFK25604.1| hypothetical protein AALP_AA8G136200 [Arabis alpina]
Length=606

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/136 (38%), Positives = 69/136 (51%), Gaps = 17/136 (13%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS CS  VLE     +P             +D  P   P P+  N ++  LL+DP T  +
Sbjct  39   SSRCSL-VLEEDEKKSPK------------EDKWPFFEPVPDGLNRVLSRLLRDPETKKL  85

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
             +E+Y+KAK N  F   +  +N LV    SS+NW  +  L +D R    LPD  TC  LI
Sbjct  86   TNEFYKKAKENSEFRTAKHLINHLV----SSKNWDLLVSLCEDLRECKALPDAHTCSILI  141

Query  563  SSCVRARKFKIVNSLL  610
             SC+R RKF+I + LL
Sbjct  142  RSCIRERKFRITHCLL  157



>gb|EAY95290.1| hypothetical protein OsI_17116 [Oryza sativa Indica Group]
Length=608

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 56/95 (59%), Gaps = 0/95 (0%)
 Frame = +2

Query  335  NALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDF  514
            N  I  L  D  T  +  E Y +A   P F+P + T+N L    + ++ W S+  L++DF
Sbjct  86   NKFIRGLCSDRQTEQLAFECYRRALHQPEFLPDKKTMNALTVQLLRAKQWSSLEFLVEDF  145

Query  515  RAFHVLPDGSTCCRLISSCVRARKFKIVNSLLESL  619
            RA+ V+P+  TC RL++SCV+ARKF + + +L  L
Sbjct  146  RAYGVMPERRTCARLVASCVKARKFGLADMVLGVL  180



>ref|XP_006652694.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Oryza brachyantha]
Length=608

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 55/95 (58%), Gaps = 0/95 (0%)
 Frame = +2

Query  335  NALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDF  514
            N  I  L  D  T     E Y +A   P F P + T+N L    + ++ W S+ LL++DF
Sbjct  86   NKFIRGLCSDRQTEQFAFECYRRALHQPEFRPDKKTMNALTVQLLRAKQWSSLELLVEDF  145

Query  515  RAFHVLPDGSTCCRLISSCVRARKFKIVNSLLESL  619
            RA+ VLP+  TC RL++SC++ARKF + + +L  L
Sbjct  146  RAYGVLPERRTCARLVASCIKARKFGLADMVLGVL  180



>gb|EMT31983.1| hypothetical protein F775_29312 [Aegilops tauschii]
Length=609

 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 74/151 (49%), Gaps = 24/151 (16%)
 Frame = +2

Query  203  SSSCSAPVLE--------HQASS-TPNNSQPTIELDLQLQDLCPSPLPEPEDF---NALI  346
            S SC++PVLE        H  SS  P  + P             S LP+  +    N  I
Sbjct  41   SRSCASPVLEPKNLPGELHVLSSPAPAKAAPV------------STLPDAANLGISNKFI  88

Query  347  CTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFH  526
              L  D  T  +  E Y +A   P F P + T+N L    + ++ W S+  L+QDF A+ 
Sbjct  89   RGLCGDRQTEPLAFECYRRALQQPEFRPDKKTMNALTVQLLRAKQWSSLEHLVQDFMAYG  148

Query  527  VLPDGSTCCRLISSCVRARKFKIVNSLLESL  619
            VLP+  TC RL+++CV+AR+F + + +L  L
Sbjct  149  VLPERRTCARLVATCVKARRFGLADVVLGVL  179



>ref|XP_006387490.1| hypothetical protein POPTR_0970s00010g [Populus trichocarpa]
 gb|ERP46404.1| hypothetical protein POPTR_0970s00010g [Populus trichocarpa]
Length=230

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 69/138 (50%), Gaps = 40/138 (29%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPED-FNALICTLLKDPHTAG  379
            SSSC +P++E ++S+    + P I LDL+L+D    P+P+  D  N  +C +L+DP +  
Sbjct  50   SSSCPSPIIEEESST----NSPVIPLDLRLEDTQHYPIPDHSDKLNDFLCGVLRDPKSEE  105

Query  380  IGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRL  559
            + +EYY+KAK    F P+R  L L                                   L
Sbjct  106  LAYEYYKKAKEKQEFRPKRPMLKL-----------------------------------L  130

Query  560  ISSCVRARKFKIVNSLLE  613
            ISSC+RARKFKIV  LLE
Sbjct  131  ISSCIRARKFKIVEGLLE  148



>gb|ACG27989.1| hypothetical protein [Zea mays]
Length=603

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 70/141 (50%), Gaps = 16/141 (11%)
 Frame = +2

Query  203  SSSCSAPVLE-----HQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDP  367
            S SC AP+LE      +  + P  + P +          P   P+    N  I  L  DP
Sbjct  43   SRSC-APLLEPKNLPDEFEAVPATTTPPL----------PDAAPKLGISNKFIRGLCGDP  91

Query  368  HTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGST  547
             T  +  E Y +A   P F  ++ T N L    +  + WGS+ LL++DFRA  VLP+  T
Sbjct  92   QTEQLAFEGYRRALLQPEFRLEKKTANALTLQLIREKQWGSLELLVEDFRAHGVLPEKRT  151

Query  548  CCRLISSCVRARKFKIVNSLL  610
            C RL++ C+RA +F + +++L
Sbjct  152  CARLVACCIRAGRFGLADAVL  172



>emb|CDX91096.1| BnaC02g05010D [Brassica napus]
Length=613

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 66/136 (49%), Gaps = 14/136 (10%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS CS  VLE     +P   Q          +  P   P P+  N ++   L+DP T  +
Sbjct  41   SSRCSL-VLEEDEKKSPGPKQ---------DNKWPFFEPAPDVLNRVLSKFLQDPKTHKV  90

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
              E+YEKAK N        T   L+ + +SS+NW  +  L +D R +  LPD  T  +LI
Sbjct  91   SSEFYEKAKANSEL----RTTKHLINHLVSSKNWDLLLSLCEDLREYKALPDAHTSSQLI  146

Query  563  SSCVRARKFKIVNSLL  610
             SC+R  KFKI + LL
Sbjct  147  RSCIRQGKFKITHCLL  162



>tpg|DAA36322.1| TPA: hypothetical protein ZEAMMB73_184989 [Zea mays]
Length=603

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +2

Query  335  NALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDF  514
            N  I  L  DP T  +  E Y +A   P F  ++ T N L    +  + WGS+ LL++DF
Sbjct  81   NKFIRGLCGDPQTEQLAFEGYRRALLQPEFRLEKKTANALTLQLIREKQWGSLELLVEDF  140

Query  515  RAFHVLPDGSTCCRLISSCVRARKFKIVNSLL  610
            RA  VLP+  TC RL++ C+RA +F + +++L
Sbjct  141  RAHGVLPEKRTCARLVACCIRAGRFGLADAVL  172



>ref|XP_007222296.1| hypothetical protein PRUPE_ppa003348mg [Prunus persica]
 gb|EMJ23495.1| hypothetical protein PRUPE_ppa003348mg [Prunus persica]
Length=583

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 68/143 (48%), Gaps = 46/143 (32%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSP-----LPEPEDFNALICTLLKDP  367
            SS C +P+LE +AS+T     P IELDL+     P P      P+ ++ N  +C L +D 
Sbjct  53   SSGCHSPILEDEASTTL----PVIELDLKF----PDPQEEFSTPDADNLNDFLCGLFQDR  104

Query  368  HTAGIGHEYYEKAKGN-PGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGS  544
             T    +E YEKAK   P FIP +ST   L+                             
Sbjct  105  QTEEFAYEQYEKAKKKRPEFIPNKSTFEHLI-----------------------------  135

Query  545  TCCRLISSCVRARKFKIVNSLLE  613
               RLI+SC+RARKFK+V +LLE
Sbjct  136  ---RLIASCIRARKFKMVRTLLE  155



>ref|XP_010453475.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At5g13770, chloroplastic-like [Camelina sativa]
Length=602

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 63/136 (46%), Gaps = 14/136 (10%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            S  C + VLE     +P   +          D  P   P  +  N ++   L+DP T  +
Sbjct  38   SHVCCSLVLEEDEKKSPGPKE----------DKXPLFGPGTDGLNRVLSRFLRDPETRKL  87

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
              E+YEKAK N        T   L+ Y +SS+NW  +  L +D R    LPD  TC  LI
Sbjct  88   SSEFYEKAKENSEL----RTTKHLINYLVSSKNWDLLLSLCEDLREHKALPDAQTCSNLI  143

Query  563  SSCVRARKFKIVNSLL  610
             SC+  R+F+I + LL
Sbjct  144  RSCISDRRFRITHCLL  159



>ref|XP_010492155.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Camelina sativa]
Length=614

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 63/136 (46%), Gaps = 14/136 (10%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            S  C + VLE     +P   +          D  P   P  +  N ++   L+DP T  +
Sbjct  38   SHVCCSLVLEEDEKKSPGPKE----------DKWPLFGPGTDGLNRVLSRFLRDPETRKL  87

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
              E+YEKAK N        T   L+ Y +SS+NW  +  L +D R    LPD  TC  LI
Sbjct  88   SSEFYEKAKENSEL----RTTKHLITYLVSSKNWDLLLSLCEDLREHKALPDAQTCSNLI  143

Query  563  SSCVRARKFKIVNSLL  610
             SC+  R+F+I + LL
Sbjct  144  RSCISDRRFRITHCLL  159



>ref|XP_006289562.1| hypothetical protein CARUB_v10003108mg [Capsella rubella]
 gb|EOA22460.1| hypothetical protein CARUB_v10003108mg [Capsella rubella]
Length=612

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 64/136 (47%), Gaps = 15/136 (11%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS CS  VLE     +P+             D  P   P   D + ++   L+DP T  +
Sbjct  42   SSRCSL-VLEEDEKKSPDPKG----------DKWPFFGPGTGDIDRVLSRFLRDPETRKL  90

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
              E+YEKAK N     +  T   L+ Y +SS+NW  +  L +D R     PD  TC  LI
Sbjct  91   SSEFYEKAKDNS----ELRTTKHLINYLVSSKNWDLLVSLCEDLREHKAFPDAQTCTNLI  146

Query  563  SSCVRARKFKIVNSLL  610
             SC+  +KF+I + LL
Sbjct  147  RSCISNKKFRITHCLL  162



>ref|XP_009125945.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic [Brassica rapa]
 emb|CDX85626.1| BnaA02g01870D [Brassica napus]
Length=613

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 65/136 (48%), Gaps = 14/136 (10%)
 Frame = +2

Query  203  SSSCSAPVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGI  382
            SS CS  VLE     +P   Q          +  P   P P+  N ++   L+DP T  +
Sbjct  42   SSRCSL-VLEEDEKKSPGRKQD---------NKWPFFEPAPDVLNRVLSKYLQDPKTHKV  91

Query  383  GHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLI  562
              E+YEKAK N        T   L+ + +SS+NW  +  L +D R    LPD  T  +LI
Sbjct  92   SSEFYEKAKENSEL----RTTKHLINHLVSSKNWDLLVSLCEDLREHKALPDLHTSSQLI  147

Query  563  SSCVRARKFKIVNSLL  610
             SC+R  KF+I + LL
Sbjct  148  RSCIRQGKFRITHYLL  163



>emb|CBI27495.3| unnamed protein product [Vitis vinifera]
Length=552

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 63/131 (48%), Gaps = 37/131 (28%)
 Frame = +2

Query  221  PVLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYE  400
             +LE +  ST ++  P IELD++L DL P    + E+ N  +C L +DP +  +  +YY+
Sbjct  21   KILEDK-ESTHDHHLPVIELDVELPDLTP----KDENLNDFLCGLFRDPRSEELAFDYYQ  75

Query  401  KAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRA  580
            K K  P F P + TL  ++                                RLISSC+RA
Sbjct  76   KVKERPEFRPDKETLERII--------------------------------RLISSCIRA  103

Query  581  RKFKIVNSLLE  613
            RKF+I  SLLE
Sbjct  104  RKFRITESLLE  114



>emb|CBI24106.3| unnamed protein product [Vitis vinifera]
Length=568

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 59/124 (48%), Gaps = 36/124 (29%)
 Frame = +2

Query  242  SSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPG  421
            S+  ++  P IELD++L DL P    + E+ N  +C L +DP +  +  +YY+K K  P 
Sbjct  13   STHDHHHLPVIELDVELPDLTP----KDENLNDFLCGLFRDPRSEELAFDYYQKVKERPE  68

Query  422  FIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVN  601
            F P + TL  ++                                RLISSC+RARKF+I  
Sbjct  69   FRPDKETLERII--------------------------------RLISSCIRARKFRITE  96

Query  602  SLLE  613
            SLLE
Sbjct  97   SLLE  100



>ref|XP_008778815.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, 
chloroplastic-like [Phoenix dactylifera]
Length=245

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 55/128 (43%), Gaps = 35/128 (27%)
 Frame = +2

Query  236  QASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTAGIGHEYYEKAKGN  415
            Q    P+NS PT +         PS +   +  N  IC L + P T  +  E Y+K    
Sbjct  57   QVIQVPSNS-PTRQ---------PSLISYLDLTNKFICGLCRVPQTEALAFENYQK----  102

Query  416  PGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCRLISSCVRARKFKI  595
                                  W SIS L++DF   ++ PD S C RL++ CV+A +FK+
Sbjct  103  ---------------------QWSSISALVEDFDVLNLFPDRSMCIRLVNGCVKAGRFKL  141

Query  596  VNSLLESL  619
              SLL  L
Sbjct  142  AESLLRIL  149



>gb|KJB35743.1| hypothetical protein B456_006G126500 [Gossypium raimondii]
Length=585

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 74/141 (52%), Gaps = 40/141 (28%)
 Frame = +2

Query  203  SSSCSAP--VLEHQASSTPNNSQPTIELDLQLQDLCPSPLPEPEDFNALICTLLKDPHTA  376
            +SSC++P  ++E  +SS+  ++ P  +L L+  D      P+ ++ N L+C LL+D  + 
Sbjct  52   NSSCNSPSAIMEDASSSSSTSNVPITKLGLKFHD------PDVDNLNGLLCGLLQDTPSE  105

Query  377  GIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSISLLLQDFRAFHVLPDGSTCCR  556
             + +++YEKAK NP FIP++  L LL+                                R
Sbjct  106  DVAYDFYEKAKENPRFIPEKKMLKLLI--------------------------------R  133

Query  557  LISSCVRARKFKIVNSLLESL  619
            LI++CV+ARKF +V +LLE+ 
Sbjct  134  LINTCVKARKFMVVEALLEAF  154



>ref|XP_009768784.1| PREDICTED: pentatricopeptide repeat-containing protein At5g27270 
[Nicotiana sylvestris]
Length=1065

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 29/105 (28%), Positives = 52/105 (50%), Gaps = 2/105 (2%)
 Frame = +2

Query  317  PEPEDFNALICTLLKDPHTAGIGHEYYEKAKGNPGFIPQRSTLNLLVRYFMSSRNWGSIS  496
            P    F  ++C+L+K  H A +  + + + K + GFIP+ +T +LL+     S N+    
Sbjct  291  PNHFTFTVVLCSLVKQGH-AEVAFKTFNQMK-SLGFIPEEATYSLLISLVSKSGNYDDAF  348

Query  497  LLLQDFRAFHVLPDGSTCCRLISSCVRARKFKIVNSLLESLIDYD  631
             L +D R+  ++P   TC  L++   R   +    +L E +  YD
Sbjct  349  GLYEDMRSQGIIPSNFTCASLLTMYYRKEDYPKALALFEEMERYD  393



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875